RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780669|ref|YP_003065082.1|
2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter
asiaticus str. psy62]
         (301 letters)



>3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla
           melitensis, DAHP synthetase I, cytoplasm,
           lipopolysaccharide biosynthesis; HET: PG4; 1.85A
           {Brucella melitensis}
          Length = 298

 Score =  278 bits (711), Expect = 1e-75
 Identities = 173/285 (60%), Positives = 220/285 (77%), Gaps = 4/285 (1%)

Query: 17  DKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNI 76
               M+  N+ + +G+    VTFSN     LIAGPCQ+E+ DHAF +A +L  +   L I
Sbjct: 18  GPGSMVTANSTVKVGN----VTFSNSAPLALIAGPCQMETRDHAFEMAGRLKEMTDKLGI 73

Query: 77  GLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVD 136
           GLVYKSSFDKANR+SL   RG+GL+K  E+F DLKK+YGFP+LTD+HTE+QC A+A  VD
Sbjct: 74  GLVYKSSFDKANRTSLKAARGIGLEKALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVD 133

Query: 137 ILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGT 196
           +LQIPA LCRQTDLL AAA+TGRV+NVKKGQFL+PW+M N+L K+   G  +VL  ERG 
Sbjct: 134 VLQIPAFLCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLAKITESGNPNVLATERGV 193

Query: 197 SFGYNTLVTDMRSIPIMTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIG 256
           SFGYNTLV+DMR++PIM  +G PVIFDA+HSVQQPG  G  +GG+R+++  LA+AAVA+G
Sbjct: 194 SFGYNTLVSDMRALPIMAGLGAPVIFDATHSVQQPGGQGGSTGGQREFVETLARAAVAVG 253

Query: 257 IAGIFLETHQDPDNAPSDGPNMINIKDLPKLLSQLLAIDKIIKPL 301
           +AG F+ETH+DPDNAPSDGPNM+ I  +P LL +L+A D+I K L
Sbjct: 254 VAGFFIETHEDPDNAPSDGPNMVPIDKMPALLEKLMAFDRIAKAL 298


>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional
           3-deoxy-7-phosphoheptulonate synthase/chorismat listeria
           monocytogenes EGD-E; 1.95A {Listeria monocytogenes}
          Length = 385

 Score =  258 bits (660), Expect = 1e-69
 Identities = 69/268 (25%), Positives = 126/268 (47%), Gaps = 22/268 (8%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +   N    V + GPC +ES++    +AE + A      + L+   +F    R+S   
Sbjct: 134 KGLPIGNG-EPVFVFGPCSVESYEQVAAVAESIKAKG----LKLIRGGAFKP--RTSPYD 186

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            +G+GL+ G +I + +  +YG  +++++ T    E   D VD++QI A   +  +LL AA
Sbjct: 187 FQGLGLE-GLKILKRVSDEYGLGVISEIVTPADIEVALDYVDVIQIGARNMQNFELLKAA 245

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTS--FGYNTLVTDMRSIPI 212
            +  + I +K+G   +  E     + + + G   ++ CERG            D+ ++PI
Sbjct: 246 GRVDKPILLKRGLSATIEEFIGAAEYIMSQGNGKIILCERGIRTYEKATRNTLDISAVPI 305

Query: 213 MTSM-GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNA 271
           +     +PV+ D +HS            G +  ++P AKAA+AI   G+  E H DP  A
Sbjct: 306 LKKETHLPVMVDVTHST-----------GRKDLLLPCAKAALAIEADGVMAEVHPDPAVA 354

Query: 272 PSDGPNMINIKDLPKLLSQLLAIDKIIK 299
            SD    ++I +  +  + +LA + +  
Sbjct: 355 LSDSAQQMDIPEFEEFWNAILASNLVPH 382


>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics,
           transferase; 1.80A {Haemophilus influenzae} SCOP:
           c.1.10.4 PDB: 3e9a_A
          Length = 292

 Score =  231 bits (589), Expect = 2e-61
 Identities = 119/267 (44%), Positives = 173/267 (64%), Gaps = 2/267 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             +  +N++ FVL  G   +ES D A  + E    + + L +  V+K+SFDKANRSS+  
Sbjct: 9   GNIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKASFDKANRSSIHS 68

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RG G+++G +IF++LK  +G  I+TDVH   QC+ +AD VDI+Q+PA L RQTDL+ A 
Sbjct: 69  YRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPAFLARQTDLVEAM 128

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
           A+TG VINVKK QFLSP +M NI++K+   G   ++ C+RGT+FGY+ L+ DM    +M 
Sbjct: 129 AKTGAVINVKKPQFLSPSQMGNIVEKIEECGNDKIILCDRGTNFGYDNLIVDMLGFSVMK 188

Query: 215 SM--GVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
               G PVIFD +HS+Q     G  S G R  +  LA++ +A+GIAG+FLE H +P+ A 
Sbjct: 189 KASKGSPVIFDVTHSLQCRDPFGAASSGRRAQVTELARSGLAVGIAGLFLEAHPNPNQAK 248

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIK 299
            DGP+ + +  L   +SQ+ AID ++K
Sbjct: 249 CDGPSALPLSALEGFVSQMKAIDDLVK 275


>2nwr_A 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KDO8P, KDO8PS, PEP,
           A5P, transferase; HET: PEP; 1.50A {Aquifex aeolicus}
           PDB: 2nws_A* 2nx1_A* 3e0i_A* 1fwn_A* 1fwt_A* 1fws_A*
           1fx6_A 1fww_A 1fxq_A* 1fy6_A* 1jcx_A* 1jcy_A* 1pck_A*
           1pcw_A* 1fxp_A* 2a21_A* 2a2i_A* 1pe1_A* 3e12_A* 2nx3_A*
           ...
          Length = 267

 Score =  217 bits (552), Expect = 3e-57
 Identities = 123/257 (47%), Positives = 174/257 (67%), Gaps = 2/257 (0%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSL-NIGLVYKSSFDKANRSSLAGKRGVGLKK 102
           +F++IAGP  IES +    + E++  + +    +  V+KSSFDKANRSS+   RG GL+ 
Sbjct: 3   KFLVIAGPNAIESEELLLKVGEEIKRLSEKFKEVEFVFKSSFDKANRSSIHSFRGHGLEY 62

Query: 103 GREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVIN 162
           G +  R +K+++G  I TD+H   Q E +A+  DI+QIPA LCRQTDLL AAA+TGR +N
Sbjct: 63  GVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAVN 122

Query: 163 VKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIF 222
           VKKGQFL+PW+  N+++KL   GAK++   ERGT+FGYN LV D RS+PIM      VI+
Sbjct: 123 VKKGQFLAPWDTKNVVEKLKFGGAKEIYLTERGTTFGYNNLVVDFRSLPIMK-QWAKVIY 181

Query: 223 DASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           DA+HSVQ PG  G+ SGG R++I PL +AAVA+G  G+F+ETH +P+ A SD    + + 
Sbjct: 182 DATHSVQLPGGLGDKSGGMREFIFPLIRAAVAVGCDGVFMETHPEPEKALSDASTQLPLS 241

Query: 283 DLPKLLSQLLAIDKIIK 299
            L  ++  +L I ++  
Sbjct: 242 QLEGIIEAILEIREVAS 258


>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural
           genomics, joint center for structural genomics, JCSG;
           1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A*
          Length = 350

 Score =  186 bits (473), Expect = 6e-48
 Identities = 71/267 (26%), Positives = 118/267 (44%), Gaps = 24/267 (8%)

Query: 37  VTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAGKR 96
           V   N   F +IAGPC +E  +     A  L  +   +  G  YK      +       +
Sbjct: 100 VKIGNGY-FTIIAGPCSVEGREMLMETAHFLSELGVKVLRGGAYKPRTSPYS------FQ 152

Query: 97  GVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQ 156
           G+G K G E  R+   KYG  ++T+   E     +A+  DI+QI A   +   LL+ A  
Sbjct: 153 GLGEK-GLEYLREAADKYGMYVVTEALGEDDLPKVAEYADIIQIGARNAQNFRLLSKAGS 211

Query: 157 TGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTS----FGYNTLVTDMRSIPI 212
             + + +K+G   +  E     + +   G   ++ CERG         NTL      I  
Sbjct: 212 YNKPVLLKRGFMNTIEEFLLSAEYIANSGNTKIILCERGIRTFEKATRNTLDISAVPIIR 271

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
             S  +P++ D SHS           GG R  ++PL++AA+A+G  GI +E H +P+ A 
Sbjct: 272 KESH-LPILVDPSHS-----------GGRRDLVIPLSRAAIAVGAHGIIVEVHPEPEKAL 319

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIK 299
           SDG   ++ +   +L+ ++  +   + 
Sbjct: 320 SDGKQSLDFELFKELVQEMKKLADALG 346


>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate,
           synthase, shikimate, DAHP, DAH7P, dahps, DAH7PS, lyase;
           HET: PEP; 2.25A {Pyrococcus furiosus}
          Length = 262

 Score =  171 bits (435), Expect = 1e-43
 Identities = 74/262 (28%), Positives = 116/262 (44%), Gaps = 17/262 (6%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N V F     F +IAGPC IES +    +AE L  +   +  G  +K       R+S   
Sbjct: 16  NDVKFGEG--FTIIAGPCSIESREQIMKVAEFLAEVGIKVLRGGAFK------PRTSPYS 67

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            +G G +K     R+   +YG   +T+V   +  E +A   DILQI A   +  +LL   
Sbjct: 68  FQGYG-EKALRWMREAADEYGLVTVTEVMDTRHVELVAKYSDILQIGARNSQNFELLKEV 126

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            +    + +K+G   +  E+    + + A G ++V+ CERG            R    ++
Sbjct: 127 GKVENPVLLKRGMGNTIQELLYSAEYIMAQGNENVILCERGIRTFET----ATRFTLDIS 182

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
           ++ V         +  P        G R  ++PLAKAA AIG  GI +E H +P+ A SD
Sbjct: 183 AVPVVKELSHLPIIVDPSH----PAGRRSLVIPLAKAAYAIGADGIMVEVHPEPEKALSD 238

Query: 275 GPNMINIKDLPKLLSQLLAIDK 296
               +   D  +LL +L A+  
Sbjct: 239 SQQQLTFDDFLQLLKELEALGW 260


>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel,
           transferase; HET: PEP; 2.30A {Aeropyrum pernix}
          Length = 276

 Score =  151 bits (382), Expect = 2e-37
 Identities = 51/264 (19%), Positives = 100/264 (37%), Gaps = 17/264 (6%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
             V         +IAGPC +ES +     A  +      +  G  +K             
Sbjct: 30  EGVRIGGG-SKAVIAGPCSVESWEQVREAALAVKEAGAHMLRGGAFKPRTS-------PY 81

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
                  +G ++ R    + G P++T+V   +  E ++   D+LQI A   +   LL   
Sbjct: 82  SFQGLGLEGLKLLRRAGDEAGLPVVTEVLDPRHVETVSRYADMLQIGARNMQNFPLLREV 141

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMT 214
            ++G+ + +K+G   +  E+    + +   G   V+  ERG      +    +    +  
Sbjct: 142 GRSGKPVLLKRGFGNTVEELLAAAEYILLEGNWQVVLVERGIRTFEPSTRFTLDVAAVAV 201

Query: 215 SMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSD 274
                       +     +  +   G R  +  LAKA +A G  G+ +E H +P+ A SD
Sbjct: 202 LK--------EATHLPVIVDPSHPAGRRSLVPALAKAGLAAGADGLIVEVHPNPEEALSD 253

Query: 275 GPNMINIKDLPKLLSQLLAIDKII 298
               +   +  +L+ + L   +++
Sbjct: 254 AKQQLTPGEFARLMGE-LRWHRLL 276


>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetase;
           manno-octulosonate, synthase, lipopolysaccharide, KDOP,
           KDO8 kdops; 1.75A {Neisseria meningitidis serogroup B}
           PDB: 3fyo_A* 3fyp_A* 1phw_A* 1g7v_A* 1gg0_A 1phq_A*
           1d9e_A* 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A*
          Length = 280

 Score =  145 bits (366), Expect = 9e-36
 Identities = 116/267 (43%), Positives = 164/267 (61%), Gaps = 2/267 (0%)

Query: 35  NQVTFSNEQRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNIGLVYKSSFDKANRSSLAG 94
           N +T  N   FVL  G   +ES D           + + L I  ++K+SFDKANRSS+  
Sbjct: 6   NDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHS 65

Query: 95  KRGVGLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAA 154
            RGVGL++G +IF  +K ++G P++TDVH   QC+ +A+  D++Q+PA L RQTDL+ A 
Sbjct: 66  YRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAM 125

Query: 155 AQTGRVINVKKGQFLSPWEMHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIP--I 212
           A+TG V+N+KK QFLSP +M NI++K H  G   ++ CERG+SFGY+ LV DM       
Sbjct: 126 AKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMK 185

Query: 213 MTSMGVPVIFDASHSVQQPGIHGNCSGGERQYIVPLAKAAVAIGIAGIFLETHQDPDNAP 272
            T   +PVIFD +HS+Q        SGG R   + LA A +A  +AG+FLE+H DP  A 
Sbjct: 186 QTCGNLPVIFDVTHSLQTRDAGSAASGGRRAQALDLALAGMATRLAGLFLESHPDPKLAK 245

Query: 273 SDGPNMINIKDLPKLLSQLLAIDKIIK 299
            DGP+ + +  L   L ++ A+D +IK
Sbjct: 246 CDGPSALPLHLLEDFLIRIKALDDLIK 272


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 54.9 bits (132), Expect = 2e-08
 Identities = 68/353 (19%), Positives = 105/353 (29%), Gaps = 148/353 (41%)

Query: 9   LEEKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFV--------LIAGPCQIESHDHA 60
           L E +    + + IH  AA  L    N  T    +  +        +   P   +  + A
Sbjct: 88  LTEFENCYLEGNDIHALAAKLLQE--NDTTLVKTKELIKNYITARIMAKRPFD-KKSNSA 144

Query: 61  -FMIAE----KLYAIC--QSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKK 113
            F        +L AI   Q  N    Y   F+                   E  RDL + 
Sbjct: 145 LFRAVGEGNAQLVAIFGGQG-NTD-DY---FE-------------------E-LRDLYQT 179

Query: 114 YGFPILTDVHTEQQCEAIADSVDILQIPALLCRQTDLLTAAAQTGRVINVKKGQFLSPWE 173
           Y   ++ D+        I  S + L     L R T    A     + +N+ +      W 
Sbjct: 180 YH-VLVGDL--------IKFSAETLS---ELIRTTL--DAEKVFTQGLNILE------W- 218

Query: 174 MHNILQKLHAHGAKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVI----FDASHSV- 228
               L+  +     D           Y  L+    SIPI  S   P+I      A + V 
Sbjct: 219 ----LE--NPSNTPDK---------DY--LL----SIPI--SC--PLIGVIQL-AHYVVT 252

Query: 229 -----QQPG-IHGNCSG--GERQYIVPLAKAAVAIGIAG------------------IFL 262
                  PG +     G  G  Q +V     AVAI                      I +
Sbjct: 253 AKLLGFTPGELRSYLKGATGHSQGLV----TAVAIAETDSWESFFVSVRKAITVLFFIGV 308

Query: 263 ETHQD-P-------------DN---APSDGPNMINIKDLPKLLSQLLA-IDKI 297
             ++  P             +N    PS  P M++I +L +   Q+   ++K 
Sbjct: 309 RCYEAYPNTSLPPSILEDSLENNEGVPS--P-MLSISNLTQ--EQVQDYVNKT 356



 Score = 33.4 bits (76), Expect = 0.065
 Identities = 32/149 (21%), Positives = 53/149 (35%), Gaps = 44/149 (29%)

Query: 6    PQNLE-----EKQRRIDKNHMIHTNAAIHLGSGKNQVTFSNEQRFVLIAGPCQIESHDHA 60
            P NL      EK +RI +N+       I  G  K +  F             +I  H  +
Sbjct: 1669 PVNLTIHFGGEKGKRIRENYSAMIFETIVDGKLKTEKIFK------------EINEHSTS 1716

Query: 61   FMI-AEKLYAICQSLNIGLVYKSSFDKANRSSLAGKRGVGLKKGREIFRDLKKKYGFPIL 119
            +   +EK          GL+  + F +   + +           +  F DLK K   P  
Sbjct: 1717 YTFRSEK----------GLLSATQFTQPALTLME----------KAAFEDLKSKGLIP-- 1754

Query: 120  TDV----HTEQQCEAIADSVDILQIPALL 144
             D     H+  +  A+A   D++ I +L+
Sbjct: 1755 ADATFAGHSLGEYAALASLADVMSIESLV 1783


>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant
           photosynthetic reaction center, peripheral antenna; HET:
           CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1
          Length = 154

 Score = 32.3 bits (72), Expect = 0.14
 Identities = 11/42 (26%), Positives = 20/42 (47%), Gaps = 16/42 (38%)

Query: 241 ERQYIVPLAKAAVAIGIAGIFLETHQDPDNAPSDGPNMINIK 282
           E+Q +  L +A+         L+ + D D+AP+     + IK
Sbjct: 18  EKQALKKL-QAS---------LKLYAD-DSAPA-----LAIK 43



 Score = 26.5 bits (57), Expect = 8.6
 Identities = 10/40 (25%), Positives = 13/40 (32%), Gaps = 17/40 (42%)

Query: 110 LKK-KYGFPILTDVHTEQQCEAIADSVDILQIPALLCRQT 148
           LKK +    +  D           DS      PAL  + T
Sbjct: 22  LKKLQASLKLYAD-----------DSA-----PALAIKAT 45


>1n8f_A DAHP synthetase; (beta/alpha)8 barrel, metal binding protein; HET:
           PEP; 1.75A {Escherichia coli} SCOP: c.1.10.4 PDB: 1gg1_A
           1kfl_A* 1qr7_A*
          Length = 350

 Score = 29.4 bits (66), Expect = 1.1
 Identities = 21/94 (22%), Positives = 39/94 (41%), Gaps = 19/94 (20%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSL--NIGLVYKSSFDKANRSSLAGKRGV--- 98
           R +++ GPC I     A   A +L A+ + L   + +V +  F+K   +   G +G+   
Sbjct: 53  RLLVVIGPCSIHDPVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTV--GWKGLIND 110

Query: 99  -----------GLKKGREIFRDLKKKYGFPILTD 121
                      GL+  R++  D+    G P   +
Sbjct: 111 PHMDNSFQINDGLRIARKLLLDINDS-GLPAAGE 143


>1vju_A Coproporphyrinogen III oxidase; structural genomics, PSI, protein
           structure initiative, structural genomics of pathogenic
           protozoa consortium; 1.40A {Leishmania major} SCOP:
           d.248.1.1 PDB: 2qt8_A* 3dwr_A 3dws_A* 3ejo_A 3e8j_A*
          Length = 309

 Score = 27.8 bits (61), Expect = 3.6
 Identities = 13/63 (20%), Positives = 25/63 (39%), Gaps = 5/63 (7%)

Query: 171 PWEMHNILQKLHAHG--AKDVLFCERGTSFGYNTLVTDMRSIPIMTSMGVPVIFDASHSV 228
           P+    +  +    G  A+  L  +RGT FG   L +  R+  I+ S+     +  +   
Sbjct: 233 PYTEQQVEFQEFRRGRYAEFNLVIDRGTKFG---LQSGGRTESILISLPPRARWGYNWQP 289

Query: 229 QQP 231
           +  
Sbjct: 290 EPG 292


>1of8_A Phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited;
           beta-alpha-barrel, lyase, synthase, synthetase; HET: PEP
           G3P; 1.5A {Saccharomyces cerevisiae} SCOP: c.1.10.4 PDB:
           1oab_A* 1of6_A* 1hfb_A* 1ofa_A* 1ofb_A 1ofo_A 1ofp_A
           1ofq_A 1ofr_A* 1og0_A*
          Length = 370

 Score = 26.7 bits (59), Expect = 7.1
 Identities = 23/106 (21%), Positives = 46/106 (43%), Gaps = 15/106 (14%)

Query: 44  RFVLIAGPCQIESHDHAFMIAEKLYAICQSL--NIGLVYKSSFDKA----------NRSS 91
           R ++I GPC I   + A   A +L  +   L  ++ ++ ++  +K           N   
Sbjct: 68  RVLVIVGPCSIHDLEAAQEYALRLKKLSDELKGDLSIIMRAYLEKPRTTVGWKGLINDPD 127

Query: 92  LAGKRGV--GLKKGREIFRDLKKKYGFPILTDVHTEQQCEAIADSV 135
           +     +  GL+  R++F +L    G PI +++      + +AD V
Sbjct: 128 VNNTFNINKGLQSARQLFVNLTNI-GLPIGSEMLDTISPQYLADLV 172


>3f6t_A Aspartate aminotransferase; YP_194538.1, structural genomics, joint
           center for structural genomics, JCSG; HET: LLP; 2.15A
           {Lactobacillus acidophilus ncfm}
          Length = 533

 Score = 26.3 bits (57), Expect = 8.0
 Identities = 7/30 (23%), Positives = 12/30 (40%)

Query: 162 NVKKGQFLSPWEMHNILQKLHAHGAKDVLF 191
             KK + L  +E+   +  L     K  +F
Sbjct: 6   EEKKLEALGAFEISRKMLALAQKNEKSNIF 35


>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide,
           monooxygenase, metab enzyme, oxidoreductase, heme,
           cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo
           sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A*
          Length = 456

 Score = 26.2 bits (57), Expect = 8.8
 Identities = 11/29 (37%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 92  LAGKRGVGLKKGREIFRDLKKKYGFPILT 120
           +A K  VG +  +++F D  KKYG P++ 
Sbjct: 1   MAKKDEVGGRVLQDVFLDWAKKYG-PVVR 28


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.321    0.137    0.404 

Gapped
Lambda     K      H
   0.267   0.0632    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 2,557,996
Number of extensions: 114449
Number of successful extensions: 329
Number of sequences better than 10.0: 1
Number of HSP's gapped: 314
Number of HSP's successfully gapped: 21
Length of query: 301
Length of database: 5,693,230
Length adjustment: 92
Effective length of query: 209
Effective length of database: 3,462,782
Effective search space: 723721438
Effective search space used: 723721438
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 56 (25.6 bits)