HHsearch results for GI: 254780670 and protein with PDBid: 1r0m_A

>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A
Probab=99.66  E-value=1.9e-13  Score=118.31  Aligned_cols=291  Identities=19%  Similarity=0.219  Sum_probs=192.8

Q ss_pred             CEEEEEEEEEE--------EECCCCCE---EEEEEEECCCCEEEEECCCCCCCCCCEEEEECCCCCCCCCCHHHHHHHHH
Q ss_conf             91058998688--------60797842---99999984897676634478664775467626898651680489999999
Q gi|254780670|r    1 MFINDIIAREV--------IDSRGSPT---IEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGVLKAIAFV   69 (424)
Q Consensus         1 m~I~~i~~r~I--------lDSRG~PT---vEvev~~~~g~~gra~~PSGaStG~~Ea~elrD~~~~~~G~gV~~Av~~i   69 (424)
                      |+|++|..+.+        -.|+|.-|   +=+.+.+++|..|.+-+.+-..             +.|.+..+..+.+.+
T Consensus         8 mkI~~i~~~~~~lPl~~p~~~s~g~~~~~~~~v~~~~~dG~~G~GE~~~~~~-------------p~~~~et~~~~~~~l   74 (375)
T 1r0m_A            8 FKIEAAEIVVARLPLKFRFETSFGVQTHKVVPLLILHGEGVQGVAEGTMEAR-------------PMYREETIAGALDLL   74 (375)
T ss_dssp             EECCEEEEEEEEEEBC----------CEEEEEEEEEEETTEEEEEECCCBSS-------------SSSSSCBHHHHHHHH
T ss_pred             EEEEEEEEEEEEECCCCCEECCCEEEEEEEEEEEEEECCCCEEEEEEECCCC-------------CCCCCCHHHHHHHHH
T ss_conf             1287999999970467876887746998899999998689889997636778-------------875800099999999


Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCCCCCEEECC
Q ss_conf             87567897598855789888646530366432212322220244899875266349848882253245647543000003
Q gi|254780670|r   70 NDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTSNLPLYKYLGGCSAHILPVPLMNILN  149 (424)
Q Consensus        70 n~~i~~~L~g~~~~dQ~~iD~~Li~lDgT~nks~lGaNailAvSlA~akA~A~~~~~pLy~yl~~~~~~~lP~P~~Niin  149 (424)
                      ++.+.|.|+|+++.+...|-+.|-.+.+       ..-++-|+.+|++-+.++..++|||+.|++.. ..+|+...... 
T Consensus        75 ~~~~~p~lig~~~~~~~~i~~~l~~~~~-------~~~a~said~AlwDl~gK~~~~pl~~LLG~~~-~~~~~~~~~~~-  145 (375)
T 1r0m_A           75 RGTFLPAILGQTFANPEAVSDALGSYRG-------NRMARAMVEMAAWDLWARTLGVPLGTLLGGHK-EQVEVGVSLGI-  145 (375)
T ss_dssp             HHTHHHHHTTCEESSHHHHHHTTTTSCS-------CHHHHHHHHHHHHHHHHHHHTCBHHHHHTCCC-SEEEBCEEECC-
T ss_pred             HHHHHHHHCCCCCCCHHHHHHHHHHCCC-------CHHHHHHHHHHHHHHHHHHCCCCCHHHCCCCC-CCEEEEEECCC-
T ss_conf             9988888638996679999999987337-------56899999999999999764997042248976-63466531024-


Q ss_pred             CCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             664556776610256514887748999899999999999875200001---36765576448868468999999999975
Q gi|254780670|r  150 GGIHADNALDFQEFMIMPVGAENIREAIRMGAEVFHTLKKELKSKGYS---TNVGDEGGFSPNLKTADSALDLIANSIEK  226 (424)
Q Consensus       150 GG~HA~~~l~iQEfmIiP~g~~sf~eal~~~~ev~~~lk~~L~~~g~~---t~vgDEGGfap~~~~~eeaL~ll~eAi~~  226 (424)
                                          ..+ .+.+      ...+++ ..+.|+.   ..+|      |..+  .+.+..+.+++  
T Consensus       146 --------------------~~~-~~~~------~~~~~~-~~~~Gf~~~K~kvg------~~~d--~~~~~~~~~~~--  187 (375)
T 1r0m_A          146 --------------------QAD-EQAT------VDLVRR-HVEQGYRRIKLKIK------PGWD--VQPVRATREAF--  187 (375)
T ss_dssp             --------------------CSS-HHHH------HHHHHH-HHHTTCSCEEEECB------TTBS--HHHHHHHHHHC--
T ss_pred             --------------------CCC-CHHH------HHHHHH-HHHCCCCCCCCCCC------CCHH--HHHHHHHHHHC--
T ss_conf             --------------------553-0589------999999-87559862334566------5014--89999987637--


Q ss_pred             CCCCCCCCHHHHHCHHHHHHCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHHHHHCCCCEE
Q ss_conf             38531110234311046532027851111468656878999999987654486997767631042379988642388368
Q gi|254780670|r  227 AGYNAGKDLLIALDCAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGSNCQ  306 (424)
Q Consensus       227 aGy~~g~di~i~lD~AAsefy~~~kY~~~~~~~~~t~~elid~y~~l~~~yPI~sIEDP~~e~D~~gw~~l~~~~g~~~~  306 (424)
                            .|+.|.+|+       ++.|         +.++-+. +.. +++|+|.++|||+..+|++++.++.+..+  +-
T Consensus       188 ------~d~~l~vDa-------N~~~---------~~~~A~~-~~~-l~~~~i~~iEeP~~~~d~~~~~~l~~~~~--ip  241 (375)
T 1r0m_A          188 ------PDIRLTVDA-------NSAY---------TLADAGR-LRQ-LDEYDLTYIEQPLAWDDLVDHAELARRIR--TP  241 (375)
T ss_dssp             ------TTSCEEEEC-------TTCC---------CGGGHHH-HHT-TGGGCCSCEECCSCTTCSHHHHHHHHHCS--SC
T ss_pred             ------CCCEECCCH-------HHCC---------CHHHHHH-HHH-HCCCCCCHHHHCCCCCCHHHHHHHHHCCC--CC
T ss_conf             ------871020240-------3206---------8999998-752-13235325651368214799999864579--88


Q ss_pred             EECCCEEECCHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHH
Q ss_conf             5043000021488852100386522342545300389999999999987986999507888723589989998
Q gi|254780670|r  307 LVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISHRSGETEDHTIADLAVA  379 (424)
Q Consensus       307 IvGDDL~vTn~~rl~~gi~~~~~NailiK~NQiGTvset~ea~~~a~~~g~~~ivShRSGETeD~~iaDLAVg  379 (424)
                      |.+|.- ++++.-+.+.++.++++.+.+|+..+|.+|++++.+.+|+++|..+++++ ..|+.=...+-+.++
T Consensus       242 ia~dE~-~~~~~~~~~~i~~~~~d~i~~d~~~~GGit~~~ki~~~A~~~gi~~~~~~-~~~s~i~~aa~~hla  312 (375)
T 1r0m_A          242 LCLDES-VASASDARKALALGAGGVINLKVARVGGHAESRRVHDVAQSFGAPVWCGG-MLESGIGRAHNIHLS  312 (375)
T ss_dssp             EEESTT-CCSHHHHHHHHHHTSCSEEEECTTTTTSHHHHHHHHHHHHHTTCCEEECC-CCCCHHHHHHHHHHT
T ss_pred             CCCCEE-CCCHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHHHHCCCCEEECC-CCCCHHHHHHHHHHH
T ss_conf             648700-24504589999818987783045556857999999999998799788789-754699999999999