BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780670|ref|YP_003065083.1| phosphopyruvate hydratase
[Candidatus Liberibacter asiaticus str. psy62]
         (424 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780670|ref|YP_003065083.1| phosphopyruvate hydratase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040347|gb|ACT57143.1| phosphopyruvate hydratase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 424

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/424 (100%), Positives = 424/424 (100%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGK 60
           MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGK
Sbjct: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGK 60

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA
Sbjct: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG
Sbjct: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD
Sbjct: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK
Sbjct: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI
Sbjct: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI
Sbjct: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420

Query: 421 LIHQ 424
           LIHQ
Sbjct: 421 LIHQ 424


>gi|315122219|ref|YP_004062708.1| phosphopyruvate hydratase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495621|gb|ADR52220.1| phosphopyruvate hydratase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 424

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/424 (86%), Positives = 398/424 (93%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGK 60
           MFIN+IIAREVIDSRG+PT+EVDV LEDGS+G A+VPSGASTGIHEAFELRD+EKRYFGK
Sbjct: 1   MFINNIIAREVIDSRGNPTVEVDVYLEDGSSGHAIVPSGASTGIHEAFELRDKEKRYFGK 60

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+ FVN+EIR ALLG DAR+QLLID+IMIDLDGTPNKSRLGANAILGVSLAVSKAA
Sbjct: 61  GVLKAVEFVNNEIRAALLGYDARNQLLIDRIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           AQTSNLPLY+Y GGC+AH+LPVPLMNILNGG+HADN LDFQEFMI+PVGAENIREAIRMG
Sbjct: 121 AQTSNLPLYQYWGGCNAHVLPVPLMNILNGGLHADNTLDFQEFMILPVGAENIREAIRMG 180

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFHTLK+ELKS+GYST++GDEGGFSP LKTADSALDLI +SIEKAGY AGKDL IALD
Sbjct: 181 AEVFHTLKQELKSQGYSTDIGDEGGFSPKLKTADSALDLIVHSIEKAGYIAGKDLFIALD 240

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           CAA+ FFK  KYIL+GENLELQPNEM  YLANLV +YPIYSIEDGMSEDDWHGWKILT+K
Sbjct: 241 CAATTFFKDGKYILEGENLELQPNEMVDYLANLVKRYPIYSIEDGMSEDDWHGWKILTDK 300

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG++CQLVGDDLFVTNP RLHKGI   +AN+ILIKPNQIGSVSETLNTIEKA MAGYPSI
Sbjct: 301 IGTHCQLVGDDLFVTNPARLHKGIESGIANSILIKPNQIGSVSETLNTIEKAHMAGYPSI 360

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           ISHRSGETEDHTIADLAVATNCGQIK GSLARSDR+AKYNQLIRIEE+LGKQAKFAG SI
Sbjct: 361 ISHRSGETEDHTIADLAVATNCGQIKAGSLARSDRLAKYNQLIRIEENLGKQAKFAGYSI 420

Query: 421 LIHQ 424
           L  Q
Sbjct: 421 LTQQ 424


>gi|15888752|ref|NP_354433.1| enolase [Agrobacterium tumefaciens str. C58]
 gi|23814079|sp|Q8UFH1|ENO_AGRT5 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|15156500|gb|AAK87218.1| enolase [Agrobacterium tumefaciens str. C58]
          Length = 424

 Score =  610 bits (1572), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 296/419 (70%), Positives = 352/419 (84%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DIIARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD  KRY GKGV
Sbjct: 4   ITDIIAREILDSRGNPTVEVDVYLEDGSMGRAAVPSGASTGAHEAVELRDGGKRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN EI  A+ G DA +Q+ ID++MI LDGTPNKSRLGANAILGVSLA++KAAA+
Sbjct: 64  EKAVEAVNTEIFDAIGGFDAENQIQIDQMMIALDGTPNKSRLGANAILGVSLAIAKAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMI+PVGAENIREA+RMG+E
Sbjct: 124 ASGLPLYRYVGGPNAHLLPVPMMNIINGGAHADNPIDFQEFMILPVGAENIREAVRMGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKKEL ++G++TNVGDEGGF+P L++A +ALD I  SIEKAGY  G+D+ + LDCA
Sbjct: 184 VFHTLKKELSAQGHNTNVGDEGGFAPGLESAPAALDFIMKSIEKAGYRPGEDMYVGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+L+GE   L+P  MA YLA LV++YPI S+EDGM+EDDW GWK LT+ +G
Sbjct: 244 STEFFKDGKYVLEGEGRTLEPGAMAEYLAELVNKYPIISVEDGMAEDDWEGWKTLTDLVG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  AGY +++S
Sbjct: 304 NKCQLVGDDLFVTNSARLRDGIKMGVANSILVKVNQIGSLSETLDAVETAHKAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA +AGRSIL
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGPQAAYAGRSIL 422


>gi|307321540|ref|ZP_07600935.1| enolase [Sinorhizobium meliloti AK83]
 gi|306892847|gb|EFN23638.1| enolase [Sinorhizobium meliloti AK83]
          Length = 424

 Score =  605 bits (1560), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 289/419 (68%), Positives = 346/419 (82%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIIGREILDSRGNPTVEVDVHLEDGSFGRAAVPSGASTGAHEAVELRDGGTRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            +A+  VN EI  A+ G DA +Q+ ID+ MI+LDGTPNKSRLGANAILGVSLAV+KAAA+
Sbjct: 64  ERAVDAVNGEIFEAIGGLDAENQIQIDRTMIELDGTPNKSRLGANAILGVSLAVAKAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
           TS LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMIMPVGAE +++A+RMG+E
Sbjct: 124 TSGLPLYRYVGGPNAHLLPVPMMNIINGGAHADNPIDFQEFMIMPVGAETLKDAVRMGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK+L + G++TNVGDEGGF+P L +A +ALD I  SIEKAGY  G+D+ +ALDCA
Sbjct: 184 VFHTLKKQLAADGHNTNVGDEGGFAPGLASAPAALDFIMKSIEKAGYKPGEDMYVALDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+L+GE   L+P  MA YLA L  +YPI SIEDGM+EDDW GWK LT+ +G
Sbjct: 244 STEFFKDGKYVLEGEGRTLEPGAMAEYLAELAGKYPIISIEDGMAEDDWDGWKSLTDLVG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  A Y +++S
Sbjct: 304 NKCQLVGDDLFVTNSARLRDGIKMGVANSILVKVNQIGSLSETLDAVETAHKARYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA++AG S+L
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEQLGPQAQYAGGSVL 422


>gi|325292758|ref|YP_004278622.1| Enolase [Agrobacterium sp. H13-3]
 gi|325060611|gb|ADY64302.1| Enolase [Agrobacterium sp. H13-3]
          Length = 424

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 296/419 (70%), Positives = 346/419 (82%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DIIARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD  KRY GKGV
Sbjct: 4   ITDIIAREILDSRGNPTVEVDVYLEDGSMGRAAVPSGASTGAHEAVELRDGGKRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN EI  A+ G DA +Q+ ID++MI LDGTPNKSR+GANAILGVSLAV+KAAA+
Sbjct: 64  EKAVEAVNTEIFDAIGGFDAENQIQIDQMMIALDGTPNKSRIGANAILGVSLAVAKAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMI+PVGAENIREA+RMG+E
Sbjct: 124 ASGLPLYRYVGGPNAHLLPVPMMNIINGGAHADNPIDFQEFMILPVGAENIREAVRMGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKKEL ++G++TNVGDEGGF+P L++A +ALD I  SIEKAGY  G D+ I LDCA
Sbjct: 184 VFHTLKKELSAQGHNTNVGDEGGFAPGLESAPAALDFIMKSIEKAGYRPGDDMFIGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ FFK   Y+ +GE     P E A YLA LV +YPI S+EDGM+EDDW GWK LT+ IG
Sbjct: 244 ATEFFKNGNYVYEGEGKTRSPIEQAEYLAELVAKYPIISVEDGMAEDDWDGWKALTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  AGY +++S
Sbjct: 304 NKCQLVGDDLFVTNSARLRDGIKMGVANSILVKVNQIGSLSETLDAVETAHKAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA +AGRSIL
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGPQAAYAGRSIL 422


>gi|222148554|ref|YP_002549511.1| phosphopyruvate hydratase [Agrobacterium vitis S4]
 gi|254783225|sp|B9JW75|ENO_AGRVS RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|221735540|gb|ACM36503.1| enolase [Agrobacterium vitis S4]
          Length = 424

 Score =  595 bits (1534), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 294/419 (70%), Positives = 344/419 (82%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DIIARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD  KRY GKGV
Sbjct: 4   ITDIIAREILDSRGNPTVEVDVYLEDGSMGRAAVPSGASTGAHEAVELRDGGKRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN EI  A+ G DA +Q+ ID IM +LDGTPNKSRLGANAILGVSLAV+KAAA+
Sbjct: 64  EKAVEAVNSEIYDAIGGHDAENQIQIDTIMRELDGTPNKSRLGANAILGVSLAVAKAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG +A ILPVP+MNI+NGG HADN +DFQEFMIMPVGA+NIR+A+RMG+E
Sbjct: 124 ASGLPLYRYVGGPNARILPVPMMNIINGGAHADNPIDFQEFMIMPVGADNIRDAVRMGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKKEL ++G++TNVGDEGGF+P LK+A  ALD I  SIEKAGY  G+D+ +ALDCA
Sbjct: 184 VFHTLKKELSAQGFNTNVGDEGGFAPGLKSAPEALDFIMKSIEKAGYRPGEDMYLALDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+L+GE   L+P  MA YLA L  +YPI SIEDGM EDDW GWK LT+KIG
Sbjct: 244 STEFFKDGKYVLEGEGRTLEPEAMAEYLAELAAKYPIISIEDGMGEDDWDGWKYLTDKIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           +  QLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  A Y +++S
Sbjct: 304 ATTQLVGDDLFVTNSARLRDGIRMGVANSILVKVNQIGSLSETLDAVETAHKAAYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED  IADL+VATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG QA +AG SIL
Sbjct: 364 HRSGETEDSIIADLSVATNCGQIKTGSLSRSDRLAKYNQLIRIEELLGPQAAYAGTSIL 422


>gi|254500543|ref|ZP_05112694.1| phosphopyruvate hydratase [Labrenzia alexandrii DFL-11]
 gi|222436614|gb|EEE43293.1| phosphopyruvate hydratase [Labrenzia alexandrii DFL-11]
          Length = 432

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 283/419 (67%), Positives = 335/419 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI  R++ DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 12  IIDITGRQIFDSRGNPTVEVDVFLEDGSFGRAAVPSGASTGAHEAVELRDGGDRYMGKGV 71

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
             A+  VN EI   + G +A DQL ID+ MIDLDGTPNK+RLGANAILGVSLAVS+AAAQ
Sbjct: 72  QNAVDAVNGEIFETIGGLEAEDQLQIDRAMIDLDGTPNKARLGANAILGVSLAVSRAAAQ 131

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            + LPLY+Y+GG SA  LPVP+MNI+NGG HADN +DFQEFMIMPVGAE++ EA+RMG+E
Sbjct: 132 ATGLPLYRYVGGTSARTLPVPMMNIINGGEHADNPIDFQEFMIMPVGAESLSEAVRMGSE 191

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK L + GY+TNVGDEGGF+PNL + D A+  +  +IE AGY  G+D+ +ALD A
Sbjct: 192 VFHTLKKALSAAGYNTNVGDEGGFAPNLASTDDAIGFVMKAIETAGYKPGEDMFLALDAA 251

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+L+GE   L P EMA YL +LV++YPI SIEDG++EDDW GWK  T+  G
Sbjct: 252 STEFFKDGKYVLEGEGKTLNPEEMAKYLEDLVNRYPIISIEDGLAEDDWDGWKAATDLFG 311

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
             CQLVGDDLFVTN  RL +GI   VAN+IL+K NQIG++SETL+ +E A  A Y +++S
Sbjct: 312 DKCQLVGDDLFVTNSARLRQGIEMGVANSILVKVNQIGTLSETLDAVETAHKASYTAVMS 371

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA +AGRSIL
Sbjct: 372 HRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGPQAFYAGRSIL 430


>gi|15965196|ref|NP_385549.1| enolase protein [Sinorhizobium meliloti 1021]
 gi|307309210|ref|ZP_07588881.1| enolase [Sinorhizobium meliloti BL225C]
 gi|21263593|sp|Q92Q98|ENO_RHIME RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|15074376|emb|CAC46022.1| Probable enolase [Sinorhizobium meliloti 1021]
 gi|306900356|gb|EFN30972.1| enolase [Sinorhizobium meliloti BL225C]
          Length = 424

 Score =  592 bits (1525), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 289/419 (68%), Positives = 346/419 (82%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIIGREILDSRGNPTVEVDVHLEDGSFGRAAVPSGASTGAHEAVELRDGGTRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            +A+  VN EI  A+ G DA +Q+ ID+ MI+LDGTPNKSRLGANAILGVSLAV+KAAA+
Sbjct: 64  ERAVDAVNGEIFEAIGGLDAENQIQIDRTMIELDGTPNKSRLGANAILGVSLAVAKAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMIMPVGAE +++A+RMG+E
Sbjct: 124 ASGLPLYRYVGGPNAHLLPVPMMNIINGGAHADNPIDFQEFMIMPVGAETLKDAVRMGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK+L + G++TNVGDEGGF+P L +A +ALD I  SIEKAGY  G+D+ +ALDCA
Sbjct: 184 VFHTLKKQLAADGHNTNVGDEGGFAPGLASAPAALDFIMKSIEKAGYKPGEDMYVALDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+L+GE   L+P  MA YLA L  +YPI SIEDGM+EDDW GWK LT+ +G
Sbjct: 244 STEFFKDGKYVLEGEGRTLEPGAMAEYLAELAGKYPIISIEDGMAEDDWDGWKSLTDLVG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  A Y +++S
Sbjct: 304 NKCQLVGDDLFVTNSARLRDGIKMGVANSILVKVNQIGSLSETLDAVETAHKARYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA++AGRS+L
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEQLGPQAQYAGRSVL 422


>gi|150396293|ref|YP_001326760.1| phosphopyruvate hydratase [Sinorhizobium medicae WSM419]
 gi|166232233|sp|A6U8E5|ENO_SINMW RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|150027808|gb|ABR59925.1| Phosphopyruvate hydratase [Sinorhizobium medicae WSM419]
          Length = 424

 Score =  590 bits (1521), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 289/419 (68%), Positives = 345/419 (82%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIIGREILDSRGNPTVEVDVHLEDGSFGRAAVPSGASTGAHEAVELRDGGTRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            +A+  VN EI  A+ G DA +Q+ ID+ M +LDGTPNKSRLGANAILGVSLAV+KAAA+
Sbjct: 64  ERAVDAVNGEIFEAIGGLDAENQIQIDRTMFELDGTPNKSRLGANAILGVSLAVAKAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            + LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMIMPVGAE +++A+RMG+E
Sbjct: 124 AAGLPLYRYVGGPNAHLLPVPMMNIINGGAHADNPIDFQEFMIMPVGAETLKDAVRMGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK+L + G++TNVGDEGGF+P L +A +ALD I  SIEKAGY  G+D+ +ALDCA
Sbjct: 184 VFHTLKKQLAADGHNTNVGDEGGFAPGLASAPAALDFIMKSIEKAGYRPGEDMYVALDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+L+GE   L+P  MA YLA L  +YPI SIEDGM+EDDW GWK LT+ IG
Sbjct: 244 STEFFKDGKYVLEGEGRTLEPGAMAEYLAELAGKYPIVSIEDGMAEDDWDGWKALTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  A Y +++S
Sbjct: 304 NKCQLVGDDLFVTNSARLRDGIKMGVANSILVKVNQIGSLSETLDAVETAHKARYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA++AGRSIL
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEQLGPQAQYAGRSIL 422


>gi|227821844|ref|YP_002825814.1| phosphopyruvate hydratase [Sinorhizobium fredii NGR234]
 gi|254783263|sp|C3MBJ9|ENO_RHISN RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|227340843|gb|ACP25061.1| enolase [Sinorhizobium fredii NGR234]
          Length = 424

 Score =  588 bits (1516), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 289/419 (68%), Positives = 345/419 (82%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIIGREILDSRGNPTVEVDVHLEDGSFGRAAVPSGASTGAHEAVELRDGGTRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            +A+  VN EI  A+ G DA +Q+ IDK MI+LDGT NKSRLGANAILGVSLA++KAAA+
Sbjct: 64  ERAVDAVNGEIFEAIGGLDAENQIQIDKTMIELDGTSNKSRLGANAILGVSLAIAKAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            + LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMIMPVGAE +++A+RMG+E
Sbjct: 124 AAGLPLYRYVGGPNAHLLPVPMMNIINGGAHADNPIDFQEFMIMPVGAETLKDAVRMGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK+L ++G++TNVGDEGGF+P L +A +ALD I  SIEKAGY  G+D+ +ALDCA
Sbjct: 184 VFHTLKKQLAAEGHNTNVGDEGGFAPGLASAPAALDFIMKSIEKAGYKPGEDMYVALDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+L+GE   L+P  MA YLA L  +YPI SIEDGM+EDDW GWK LT+ IG
Sbjct: 244 STEFFKDGKYVLEGEGRTLEPGAMAEYLAELAGKYPIISIEDGMAEDDWDGWKALTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  A Y +++S
Sbjct: 304 NKCQLVGDDLFVTNSARLRDGIKMGVANSILVKVNQIGSLSETLDAVETAHKARYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA +AGRSIL
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEQLGLQAAYAGRSIL 422


>gi|307947118|ref|ZP_07662453.1| phosphopyruvate hydratase [Roseibium sp. TrichSKD4]
 gi|307770782|gb|EFO30008.1| phosphopyruvate hydratase [Roseibium sp. TrichSKD4]
          Length = 424

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 286/419 (68%), Positives = 344/419 (82%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I D+I RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   R+ GKGV
Sbjct: 4   IIDMIGREILDSRGNPTVEVDVFLEDGSFGRAAVPSGASTGAHEAVELRDGGDRFLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN EI   + G DA DQL ID+ M+DLDGT NK+RLGANAILGVSLAV++AAAQ
Sbjct: 64  RKAVEAVNGEIFETVGGLDAEDQLKIDQAMLDLDGTENKARLGANAILGVSLAVARAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG SA  LPVP+MNI+NGG HADN +DFQEFMIMPVGAE++ EA+RMGAE
Sbjct: 124 ASGLPLYRYVGGTSARTLPVPMMNIINGGAHADNPIDFQEFMIMPVGAESLSEAVRMGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK L + G++TNVGDEGGF+PNL++ D+A+  +  +IE AGY  G+D+ +ALD A
Sbjct: 184 VFHTLKKALNAAGHNTNVGDEGGFAPNLESTDAAIGFVMKAIETAGYKPGEDMFLALDAA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+L+GE   L P EMA YL +LV++YPI SIEDG++EDDW GWK  T+  G
Sbjct: 244 STEFFKDGKYVLEGEGKSLAPEEMAKYLEDLVERYPIISIEDGLAEDDWAGWKAATDLFG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN +RL +GIN+ VAN+ILIK NQIG++SETL+ +E A  AGY +++S
Sbjct: 304 NKCQLVGDDLFVTNSKRLRQGINQGVANSILIKVNQIGTLSETLDAVETAHKAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA +AGRSIL
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGAQAIYAGRSIL 422


>gi|148255828|ref|YP_001240413.1| phosphopyruvate hydratase [Bradyrhizobium sp. BTAi1]
 gi|166232172|sp|A5EK13|ENO_BRASB RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|146408001|gb|ABQ36507.1| enolase [Bradyrhizobium sp. BTAi1]
          Length = 427

 Score =  586 bits (1511), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 283/420 (67%), Positives = 343/420 (81%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVEVDVVLEDGSVGRAAVPSGASTGAHEAVELRDGDKHRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +NDEI  AL     +DQ+ ID+I+I+LDGTPNKSR+GANAILGVSLA +KAAA
Sbjct: 64  VLKAVEAINDEIYEALSDMSVQDQVQIDQILIELDGTPNKSRIGANAILGVSLACAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + ++PLY+Y+GG SA  LPVP+MNI+NGG+HADN +DFQEFMIMPVGA +  EA+R G+
Sbjct: 124 ISYDMPLYRYVGGTSARTLPVPMMNIVNGGVHADNPIDFQEFMIMPVGAPSFAEALRCGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLK ELK  G++TNVGDEGGF+PNL +AD+ALD + ++I KAGYNAG+D+++ALDC
Sbjct: 184 EIFHTLKGELKKAGHNTNVGDEGGFAPNLPSADAALDFVMSAIGKAGYNAGEDVMLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FF+  KY+ +GEN     +E A YLA+LV +YPI SIEDGMSEDD  GWK LT+ I
Sbjct: 244 AATEFFRDGKYVYEGENKSRSRSEQARYLADLVARYPIVSIEDGMSEDDMDGWKELTDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS CQLVGDDLFVTN  RL  GI    AN+ILIK NQIG+++ETL  +E A  AGY +++
Sbjct: 304 GSKCQLVGDDLFVTNVNRLADGIRNGRANSILIKVNQIGTLTETLAAVEMAYKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLAR+DR AKYNQL+RIE+ L  QA++AGRS L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARADRTAKYNQLLRIEQELDAQARYAGRSAL 423


>gi|86357552|ref|YP_469444.1| 2-phosphoglycerate dehydratase (enolase) protein [Rhizobium etli
           CFN 42]
 gi|190891625|ref|YP_001978167.1| 2-phosphoglycerate dehydratase [Rhizobium etli CIAT 652]
 gi|119369377|sp|Q2K8W9|ENO_RHIEC RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|86281654|gb|ABC90717.1| 2-phosphoglycerate dehydratase (enolase) protein [Rhizobium etli
           CFN 42]
 gi|190696904|gb|ACE90989.1| 2-phosphoglycerate dehydratase protein [Rhizobium etli CIAT 652]
 gi|327189239|gb|EGE56418.1| 2-phosphoglycerate dehydratase (enolase) protein [Rhizobium etli
           CNPAF512]
          Length = 424

 Score =  585 bits (1509), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 287/419 (68%), Positives = 340/419 (81%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DIIARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD  KRY GKGV
Sbjct: 4   ITDIIAREILDSRGNPTVEVDVYLEDGSMGRAAVPSGASTGAHEAVELRDGGKRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+   N EI  A+ G DA +Q+ ID IMI+LDGTPNKSRLGANAILGVSLAV+KAAAQ
Sbjct: 64  EKAVEAANTEIFDAIGGIDAENQIQIDNIMIELDGTPNKSRLGANAILGVSLAVAKAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG SA +LPVP+MNI+NGG HADN +DFQEFMI+PVGA+ I EA+RMG+E
Sbjct: 124 ASGLPLYRYVGGASASLLPVPMMNIINGGAHADNPIDFQEFMILPVGADTIAEAVRMGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTL+KEL ++G++TNVGDEGGF+P LK+A  ALD I  S+EKAGY  G+D+ + LDCA
Sbjct: 184 VFHTLRKELAAQGHNTNVGDEGGFAPGLKSASEALDFIVKSVEKAGYKPGEDIYLGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+L+GE   L+   MA YLA L  +YPI SIEDGM+EDDW GWK LT+  G
Sbjct: 244 STEFFKDGKYVLEGEGRTLESGAMAEYLAELAAKYPIISIEDGMAEDDWDGWKALTDLAG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS++ETL+ +  A  A Y +++S
Sbjct: 304 KKIQLVGDDLFVTNSARLRDGIRMGVANSILVKVNQIGSLTETLDAVNTAHKAAYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG QA++AGRSI+
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEGLGPQAQYAGRSII 422


>gi|222085874|ref|YP_002544405.1| phosphopyruvate hydratase [Agrobacterium radiobacter K84]
 gi|254783224|sp|B9JEY7|ENO_AGRRK RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|221723322|gb|ACM26478.1| phosphopyruvate hydratase [Agrobacterium radiobacter K84]
          Length = 424

 Score =  584 bits (1505), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 286/419 (68%), Positives = 343/419 (81%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DIIARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD  KRY GKGV
Sbjct: 4   ITDIIAREILDSRGNPTVEVDVYLEDGSLGRAAVPSGASTGAHEAVELRDGGKRYHGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN EI  A+ G DA +Q+ ID IMI+LDGTPNKSR+GANAILGVSLAV+KAAAQ
Sbjct: 64  EKAVEAVNTEIFDAIGGMDAENQIQIDDIMIELDGTPNKSRIGANAILGVSLAVAKAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
           ++NLPLY+Y+GG  A +LPVP+MNI+NGG HADN +DFQEFMI+P+GAE  R+A+R+G+E
Sbjct: 124 SANLPLYRYVGGAHARLLPVPMMNIINGGAHADNPIDFQEFMILPIGAETFRDAVRIGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           +FH LKKEL S+G++TNVGDEGGF+P L +A +ALD I  SIEKAGY  G+++ + LDCA
Sbjct: 184 IFHVLKKELASQGHNTNVGDEGGFAPGLSSAPAALDFIMKSIEKAGYKPGEEVALGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+L+GE   L+P  MA YLA L  +YPI SIEDGM+EDDW GWK LT+ IG
Sbjct: 244 STEFFKDGKYVLEGEGRTLEPGAMAEYLAELAAKYPIVSIEDGMAEDDWEGWKALTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTN  RL  GI   VAN+IL+K NQIG+++ETL+ +E A  A Y +++S
Sbjct: 304 KKTQLVGDDLFVTNSARLRDGIRMGVANSILVKVNQIGTLTETLDAVETAHKANYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG QAK+AG SIL
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEGLGPQAKYAGSSIL 422


>gi|126739422|ref|ZP_01755115.1| enolase [Roseobacter sp. SK209-2-6]
 gi|126719522|gb|EBA16231.1| enolase [Roseobacter sp. SK209-2-6]
          Length = 424

 Score =  583 bits (1503), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 282/420 (67%), Positives = 338/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVVLEDGTMGRAAVPSGASTGAYEAVERRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   L+G DA +Q+ +D  MI+LDGT NK RLGANAILGVS+AV+KAAA
Sbjct: 64  VLEAVAAVNGEIAEELVGFDATEQVAVDSAMIELDGTENKGRLGANAILGVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PL++Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV AENIREA+RMGA
Sbjct: 124 DFTTQPLFRYVGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAAENIREAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+PN+ ++  ALD I  S+EKAGY  G+D+ +ALDC
Sbjct: 184 EVFHTLKKELSAAGLSTGIGDEGGFAPNIGSSREALDFILKSVEKAGYRPGEDIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ +FK   Y+  GE   L   E A YLA LV+ YPI SIEDGMSEDDW GWK+LT+KI
Sbjct: 244 AATEYFKDGNYVFSGEGKTLSSEENADYLAALVNDYPIISIEDGMSEDDWDGWKLLTDKI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI+  VAN++L+K NQIGS++ETL  ++ A  AGY +++
Sbjct: 304 GDKVQLVGDDLFVTNPARLSDGISRGVANSMLVKVNQIGSLTETLKAVDIAHRAGYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG+ A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEVLGEVAEYAGRSIL 423


>gi|90423983|ref|YP_532353.1| phosphopyruvate hydratase [Rhodopseudomonas palustris BisB18]
 gi|119369381|sp|Q215A2|ENO_RHOPB RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|90105997|gb|ABD88034.1| enolase [Rhodopseudomonas palustris BisB18]
          Length = 430

 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 286/420 (68%), Positives = 338/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA ELRD +K RYFGKG
Sbjct: 4   IVDIIGREILDSRGNPTVEVDVVLEDGAVGRAAVPSGASTGAHEAVELRDGDKERYFGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EI  AL G DA  Q+ ID+IMI LDGTPNKSRLGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVEAVNGEIFDALGGMDAEQQVQIDEIMIGLDGTPNKSRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           ++ ++PLY+Y+GG SA  LPVP+MNI+NGG+HADN +DFQEFMIMP+GA +  EA+RMGA
Sbjct: 124 ESFDMPLYRYVGGTSARTLPVPMMNIINGGVHADNPIDFQEFMIMPIGAPSFSEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKK L  +G++TNVGDEGGF+PNLK+AD AL  I  +IEKAGY  G+D+ +ALD 
Sbjct: 184 EVFHTLKKSLHDEGHNTNVGDEGGFAPNLKSADEALTYIMRAIEKAGYKPGEDIALALDP 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S FFK   Y+ +GE      +  A YLA LV +YPI SIEDGM+EDD+ GWK +T  I
Sbjct: 244 ASSEFFKNGSYVYEGEKKARNIDAQAKYLAELVGRYPIVSIEDGMAEDDFEGWKQVTELI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN ERL  GI    AN+ILIK NQIG+++ETL  IE A  AGY +++
Sbjct: 304 GDKCQLVGDDLFVTNVERLSDGIKNGRANSILIKVNQIGTLTETLAAIEMAYKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVA+NCGQIKTGSLAR+DR AKYNQL+RIE+ LG QAKFAGR+ L
Sbjct: 364 SHRSGETEDSTIADLAVASNCGQIKTGSLARADRTAKYNQLLRIEQELGGQAKFAGRAAL 423


>gi|148560469|ref|YP_001259054.1| phosphopyruvate hydratase [Brucella ovis ATCC 25840]
 gi|166232174|sp|A5VQQ7|ENO_BRUO2 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|148371726|gb|ABQ61705.1| phosphopyruvate hydratase [Brucella ovis ATCC 25840]
          Length = 425

 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 287/419 (68%), Positives = 336/419 (80%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI+ RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIVGREILDSRGNPTVEVDVVLEDGSFGRAAVPSGASTGAHEAVELRDGGSRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN +I  A+ G DA +QLLID+ +IDLDG+ NK  LGANAILGVSLAV+KAAAQ
Sbjct: 64  EKAVEVVNGKIFDAIAGMDAENQLLIDQTLIDLDGSANKGNLGANAILGVSLAVAKAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMI+PVGA +IREA+R G+E
Sbjct: 124 ASGLPLYRYVGGTNAHVLPVPMMNIINGGAHADNPIDFQEFMILPVGATSIREAVRYGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK LK  G++TNVGDEGGF+PNLK A +ALD I  SIEKAG+  G+D+ + LDCA
Sbjct: 184 VFHTLKKRLKDAGHNTNVGDEGGFAPNLKNAQAALDFIMESIEKAGFKPGEDIALGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ FFK   Y+ +GE     P   A YLA L   YPI +IEDGM+EDDW GWK LT+ IG
Sbjct: 244 ATEFFKDGNYVYEGERKTRDPKAQAKYLAKLASDYPIVTIEDGMAEDDWEGWKYLTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  AGY +++S
Sbjct: 304 NKCQLVGDDLFVTNSARLRDGIRLGVANSILVKVNQIGSLSETLDAVETAHKAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQLIRIEE LGKQA++AGRS L
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLIRIEEELGKQARYAGRSAL 422


>gi|209549200|ref|YP_002281117.1| phosphopyruvate hydratase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|238064661|sp|B5ZNA1|ENO_RHILW RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|209534956|gb|ACI54891.1| Phosphopyruvate hydratase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 424

 Score =  582 bits (1501), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 288/419 (68%), Positives = 339/419 (80%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DIIARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD  KRY GKGV
Sbjct: 4   ITDIIAREILDSRGNPTVEVDVYLEDGSMGRAAVPSGASTGAHEAVELRDGGKRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+   N EI  A+ G DA +Q+ ID IMI+LDGTPNKSRLGANAILGVSLAV+KAAAQ
Sbjct: 64  QKAVDAANTEIFDAIGGIDAENQIQIDNIMIELDGTPNKSRLGANAILGVSLAVAKAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG SA +LPVP+MNI+NGG HADN +DFQEFMI+PVGA+ I EA+RMG+E
Sbjct: 124 ASGLPLYRYVGGASACLLPVPMMNIINGGAHADNPIDFQEFMILPVGADTIAEAVRMGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTL+KEL ++G++TNVGDEGGF+P LK+A  ALD I  SIEKAGY  G D+ + LDCA
Sbjct: 184 VFHTLRKELAAQGHNTNVGDEGGFAPGLKSAPEALDFIMKSIEKAGYKPGDDMCLGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+L+GE   L+   MA YLA L  +YPI SIEDGM+EDDW GWK LT+  G
Sbjct: 244 STEFFKDGKYVLEGEGRTLESGAMAEYLAELAAKYPIISIEDGMAEDDWDGWKTLTDLTG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS++ETL+ +  A  A Y +++S
Sbjct: 304 KKTQLVGDDLFVTNSARLRDGIRMGVANSILVKVNQIGSLTETLDAVNTAHKAAYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG QA++AGRSI+
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEGLGPQAQYAGRSII 422


>gi|254714206|ref|ZP_05176017.1| phosphopyruvate hydratase [Brucella ceti M644/93/1]
 gi|254717641|ref|ZP_05179452.1| phosphopyruvate hydratase [Brucella ceti M13/05/1]
 gi|261219480|ref|ZP_05933761.1| enolase [Brucella ceti M13/05/1]
 gi|261321976|ref|ZP_05961173.1| enolase [Brucella ceti M644/93/1]
 gi|260924569|gb|EEX91137.1| enolase [Brucella ceti M13/05/1]
 gi|261294666|gb|EEX98162.1| enolase [Brucella ceti M644/93/1]
          Length = 425

 Score =  582 bits (1501), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 287/419 (68%), Positives = 335/419 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI+ RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIVGREILDSRGNPTVEVDVVLEDGSFGRAAVPSGASTGAHEAVELRDGGSRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN +I  A+ G DA  QLLID+ +IDLDG+ NK  LGANAILGVSLAV+KAAAQ
Sbjct: 64  EKAVEVVNGKIFDAIAGMDAESQLLIDQTLIDLDGSANKGNLGANAILGVSLAVAKAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMI+PVGA +IREA+R G+E
Sbjct: 124 ASGLPLYRYVGGTNAHVLPVPMMNIINGGAHADNPIDFQEFMILPVGATSIREAVRYGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK LK  G++TNVGDEGGF+PNLK A +ALD I  SIEKAG+  G+D+ + LDCA
Sbjct: 184 VFHTLKKRLKDTGHNTNVGDEGGFAPNLKNAQAALDFIMESIEKAGFKPGEDIALGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ FFK   Y+ +GE     P   A YLA L   YPI +IEDGM+EDDW GWK LT+ IG
Sbjct: 244 ATEFFKDGNYVYEGERKTRDPKAQAKYLAKLASDYPIVTIEDGMAEDDWEGWKYLTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  AGY +++S
Sbjct: 304 NKCQLVGDDLFVTNSARLRDGIRLGVANSILVKVNQIGSLSETLDAVETAHKAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQLIRIEE LGKQA++AGRS L
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLIRIEEELGKQARYAGRSAL 422


>gi|241204522|ref|YP_002975618.1| phosphopyruvate hydratase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858412|gb|ACS56079.1| enolase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 424

 Score =  582 bits (1501), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 287/419 (68%), Positives = 340/419 (81%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DIIARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD  KRY GKGV
Sbjct: 4   ITDIIAREILDSRGNPTVEVDVYLEDGSMGRAAVPSGASTGAHEAVELRDGGKRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+   N EI  A+ G DA +Q+ ID IMI+LDGTPNKSRLGANAILGVSLAV+KAAAQ
Sbjct: 64  EKAVEAANTEIFDAIGGIDAENQIQIDNIMIELDGTPNKSRLGANAILGVSLAVAKAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG SA +LPVP+MNI+NGG HADN +DFQEFMI+PVGA++I EA+RMG+E
Sbjct: 124 ASGLPLYRYVGGASASLLPVPMMNIINGGAHADNPIDFQEFMILPVGADSIAEAVRMGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTL+KEL ++G++TNVGDEGGF+P LK+A  ALD I  SIEKAGY  G D+ + LDCA
Sbjct: 184 VFHTLRKELAAQGHNTNVGDEGGFAPGLKSAPEALDFIMKSIEKAGYKPGDDMCLGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+L+GE   L+   MA YLA L  +YPI SIEDGM+EDDW GWK LT+  G
Sbjct: 244 STEFFKDGKYVLEGEGRTLESGAMAEYLAELAAKYPIISIEDGMAEDDWDGWKTLTDLAG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTN  RL  GI   VAN+IL+K NQIG+++ETL+ +  A  A Y +++S
Sbjct: 304 KKTQLVGDDLFVTNSARLRDGIRMGVANSILVKVNQIGTLTETLDAVNTAHKAAYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG QA++AGRSI+
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEGLGPQAQYAGRSIV 422


>gi|23502010|ref|NP_698137.1| phosphopyruvate hydratase [Brucella suis 1330]
 gi|62290045|ref|YP_221838.1| phosphopyruvate hydratase [Brucella abortus bv. 1 str. 9-941]
 gi|82699972|ref|YP_414546.1| phosphopyruvate hydratase [Brucella melitensis biovar Abortus 2308]
 gi|161619084|ref|YP_001592971.1| phosphopyruvate hydratase [Brucella canis ATCC 23365]
 gi|189024286|ref|YP_001935054.1| phosphopyruvate hydratase [Brucella abortus S19]
 gi|225627602|ref|ZP_03785639.1| phosphopyruvate hydratase [Brucella ceti str. Cudo]
 gi|237815555|ref|ZP_04594552.1| phosphopyruvate hydratase [Brucella abortus str. 2308 A]
 gi|254689358|ref|ZP_05152612.1| phosphopyruvate hydratase [Brucella abortus bv. 6 str. 870]
 gi|254693842|ref|ZP_05155670.1| phosphopyruvate hydratase [Brucella abortus bv. 3 str. Tulya]
 gi|254697491|ref|ZP_05159319.1| phosphopyruvate hydratase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254704421|ref|ZP_05166249.1| phosphopyruvate hydratase [Brucella suis bv. 3 str. 686]
 gi|254706683|ref|ZP_05168511.1| phosphopyruvate hydratase [Brucella pinnipedialis M163/99/10]
 gi|254710209|ref|ZP_05172020.1| phosphopyruvate hydratase [Brucella pinnipedialis B2/94]
 gi|254730388|ref|ZP_05188966.1| phosphopyruvate hydratase [Brucella abortus bv. 4 str. 292]
 gi|256031703|ref|ZP_05445317.1| phosphopyruvate hydratase [Brucella pinnipedialis M292/94/1]
 gi|256061216|ref|ZP_05451367.1| phosphopyruvate hydratase [Brucella neotomae 5K33]
 gi|256159862|ref|ZP_05457591.1| phosphopyruvate hydratase [Brucella ceti M490/95/1]
 gi|256255104|ref|ZP_05460640.1| phosphopyruvate hydratase [Brucella ceti B1/94]
 gi|256257604|ref|ZP_05463140.1| phosphopyruvate hydratase [Brucella abortus bv. 9 str. C68]
 gi|256369558|ref|YP_003107068.1| enolase [Brucella microti CCM 4915]
 gi|260168835|ref|ZP_05755646.1| phosphopyruvate hydratase [Brucella sp. F5/99]
 gi|260546598|ref|ZP_05822337.1| enolase [Brucella abortus NCTC 8038]
 gi|260566332|ref|ZP_05836802.1| enolase [Brucella suis bv. 4 str. 40]
 gi|260754875|ref|ZP_05867223.1| 2-phospho-D-glycerate hydro-lyase [Brucella abortus bv. 6 str. 870]
 gi|260758092|ref|ZP_05870440.1| 2-phospho-D-glycerate hydro-lyase [Brucella abortus bv. 4 str. 292]
 gi|260761916|ref|ZP_05874259.1| 2-phospho-D-glycerate hydro-lyase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883887|ref|ZP_05895501.1| enolase [Brucella abortus bv. 9 str. C68]
 gi|261214126|ref|ZP_05928407.1| 2-phospho-D-glycerate hydro-lyase [Brucella abortus bv. 3 str.
           Tulya]
 gi|261222299|ref|ZP_05936580.1| enolase [Brucella ceti B1/94]
 gi|261314144|ref|ZP_05953341.1| enolase [Brucella pinnipedialis M163/99/10]
 gi|261317767|ref|ZP_05956964.1| enolase [Brucella pinnipedialis B2/94]
 gi|261325223|ref|ZP_05964420.1| enolase [Brucella neotomae 5K33]
 gi|261755098|ref|ZP_05998807.1| enolase [Brucella suis bv. 3 str. 686]
 gi|261758323|ref|ZP_06002032.1| enolase [Brucella sp. F5/99]
 gi|265988798|ref|ZP_06101355.1| enolase [Brucella pinnipedialis M292/94/1]
 gi|265998263|ref|ZP_06110820.1| enolase [Brucella ceti M490/95/1]
 gi|294852472|ref|ZP_06793145.1| phosphopyruvate hydratase [Brucella sp. NVSL 07-0026]
 gi|297248446|ref|ZP_06932164.1| phosphopyruvate hydratase [Brucella abortus bv. 5 str. B3196]
 gi|29839247|sp|Q8G0G3|ENO_BRUSU RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|75505274|sp|Q57D07|ENO_BRUAB RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|119369300|sp|Q2YPV0|ENO_BRUA2 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|189037201|sp|A9M5E5|ENO_BRUC2 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|238689372|sp|B2S5Y3|ENO_BRUA1 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|23347962|gb|AAN30052.1| enolase [Brucella suis 1330]
 gi|62196177|gb|AAX74477.1| enolase [Brucella abortus bv. 1 str. 9-941]
 gi|82616073|emb|CAJ11111.1| Enolase [Brucella melitensis biovar Abortus 2308]
 gi|161335895|gb|ABX62200.1| phosphopyruvate hydratase [Brucella canis ATCC 23365]
 gi|189019858|gb|ACD72580.1| Enolase [Brucella abortus S19]
 gi|225617607|gb|EEH14652.1| phosphopyruvate hydratase [Brucella ceti str. Cudo]
 gi|237788853|gb|EEP63064.1| phosphopyruvate hydratase [Brucella abortus str. 2308 A]
 gi|255999720|gb|ACU48119.1| enolase [Brucella microti CCM 4915]
 gi|260095648|gb|EEW79525.1| enolase [Brucella abortus NCTC 8038]
 gi|260155850|gb|EEW90930.1| enolase [Brucella suis bv. 4 str. 40]
 gi|260668410|gb|EEX55350.1| 2-phospho-D-glycerate hydro-lyase [Brucella abortus bv. 4 str. 292]
 gi|260672348|gb|EEX59169.1| 2-phospho-D-glycerate hydro-lyase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674983|gb|EEX61804.1| 2-phospho-D-glycerate hydro-lyase [Brucella abortus bv. 6 str. 870]
 gi|260873415|gb|EEX80484.1| enolase [Brucella abortus bv. 9 str. C68]
 gi|260915733|gb|EEX82594.1| 2-phospho-D-glycerate hydro-lyase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260920883|gb|EEX87536.1| enolase [Brucella ceti B1/94]
 gi|261296990|gb|EEY00487.1| enolase [Brucella pinnipedialis B2/94]
 gi|261301203|gb|EEY04700.1| enolase [Brucella neotomae 5K33]
 gi|261303170|gb|EEY06667.1| enolase [Brucella pinnipedialis M163/99/10]
 gi|261738307|gb|EEY26303.1| enolase [Brucella sp. F5/99]
 gi|261744851|gb|EEY32777.1| enolase [Brucella suis bv. 3 str. 686]
 gi|262552731|gb|EEZ08721.1| enolase [Brucella ceti M490/95/1]
 gi|264660995|gb|EEZ31256.1| enolase [Brucella pinnipedialis M292/94/1]
 gi|294821061|gb|EFG38060.1| phosphopyruvate hydratase [Brucella sp. NVSL 07-0026]
 gi|297175615|gb|EFH34962.1| phosphopyruvate hydratase [Brucella abortus bv. 5 str. B3196]
          Length = 425

 Score =  582 bits (1501), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 287/419 (68%), Positives = 335/419 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI+ RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIVGREILDSRGNPTVEVDVVLEDGSFGRAAVPSGASTGAHEAVELRDGGSRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN +I  A+ G DA  QLLID+ +IDLDG+ NK  LGANAILGVSLAV+KAAAQ
Sbjct: 64  EKAVEVVNGKIFDAIAGMDAESQLLIDQTLIDLDGSANKGNLGANAILGVSLAVAKAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMI+PVGA +IREA+R G+E
Sbjct: 124 ASGLPLYRYVGGTNAHVLPVPMMNIINGGAHADNPIDFQEFMILPVGATSIREAVRYGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK LK  G++TNVGDEGGF+PNLK A +ALD I  SIEKAG+  G+D+ + LDCA
Sbjct: 184 VFHTLKKRLKDAGHNTNVGDEGGFAPNLKNAQAALDFIMESIEKAGFKPGEDIALGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ FFK   Y+ +GE     P   A YLA L   YPI +IEDGM+EDDW GWK LT+ IG
Sbjct: 244 ATEFFKDGNYVYEGERKTRDPKAQAKYLAKLASDYPIVTIEDGMAEDDWEGWKYLTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  AGY +++S
Sbjct: 304 NKCQLVGDDLFVTNSARLRDGIRLGVANSILVKVNQIGSLSETLDAVETAHKAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQLIRIEE LGKQA++AGRS L
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLIRIEEELGKQARYAGRSAL 422


>gi|254719195|ref|ZP_05181006.1| phosphopyruvate hydratase [Brucella sp. 83/13]
 gi|265984192|ref|ZP_06096927.1| enolase [Brucella sp. 83/13]
 gi|306838188|ref|ZP_07471044.1| phosphopyruvate hydratase [Brucella sp. NF 2653]
 gi|306841857|ref|ZP_07474539.1| phosphopyruvate hydratase [Brucella sp. BO2]
 gi|306843996|ref|ZP_07476591.1| phosphopyruvate hydratase [Brucella sp. BO1]
 gi|264662784|gb|EEZ33045.1| enolase [Brucella sp. 83/13]
 gi|306275751|gb|EFM57475.1| phosphopyruvate hydratase [Brucella sp. BO1]
 gi|306288084|gb|EFM59481.1| phosphopyruvate hydratase [Brucella sp. BO2]
 gi|306406778|gb|EFM63001.1| phosphopyruvate hydratase [Brucella sp. NF 2653]
          Length = 425

 Score =  582 bits (1499), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 287/419 (68%), Positives = 335/419 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI+ RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIVGREILDSRGNPTVEVDVVLEDGSFGRAAVPSGASTGAHEAVELRDGGSRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN +I  A+ G DA  QLLID+ +IDLDG+ NK  LGANAILGVSLAV+KAAAQ
Sbjct: 64  EKAVEAVNGKIFDAIAGMDAESQLLIDQTLIDLDGSANKGNLGANAILGVSLAVAKAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMI+PVGA +IREA+R G+E
Sbjct: 124 ASGLPLYRYVGGTNAHVLPVPMMNIINGGAHADNPIDFQEFMILPVGASSIREAVRYGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK LK  G++TNVGDEGGF+PNLK A +ALD I  SIEKAG+  G+D+ + LDCA
Sbjct: 184 VFHTLKKRLKDAGHNTNVGDEGGFAPNLKNAQAALDFIMESIEKAGFKPGEDIALGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ FFK   Y+ +GE     P   A YLA L   YPI +IEDGM+EDDW GWK LT+ IG
Sbjct: 244 ATEFFKDGNYVYEGERKTRDPKAQAKYLAKLASDYPIVTIEDGMAEDDWEGWKYLTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  AGY +++S
Sbjct: 304 NKCQLVGDDLFVTNSARLRDGIRLGVANSILVKVNQIGSLSETLDAVETAHKAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQLIRIEE LGKQA++AGRS L
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLIRIEEELGKQARYAGRSAL 422


>gi|114769389|ref|ZP_01447015.1| enolase [alpha proteobacterium HTCC2255]
 gi|114550306|gb|EAU53187.1| enolase [alpha proteobacterium HTCC2255]
          Length = 425

 Score =  582 bits (1499), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 284/420 (67%), Positives = 339/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA ELRD +K RYFGKG
Sbjct: 4   IIDILAREILDSRGNPTVEVDVILEDGTLGRAAVPSGASTGAHEAVELRDGDKSRYFGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+ FVN EI  AL+G DA +Q+ +D+ MI+LDGT NKSRLGANAILGVSLA++KAAA
Sbjct: 64  VLQAVEFVNGEIADALVGADALEQVELDEAMIELDGTSNKSRLGANAILGVSLAIAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             ++ PLY+Y+GG SA  LPVP+MNI+NGG HADN +D QEFMIMPV AE I  AI+MGA
Sbjct: 124 DFTSQPLYRYIGGTSARTLPVPMMNIINGGEHADNPIDIQEFMIMPVSAETISHAIQMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKKEL + G++T VGDEGGF+PNL +   AL+ I +SIEKAGY  G+D+ +ALDC
Sbjct: 184 EIFHTLKKELSNAGHNTGVGDEGGFAPNLNSTKDALNFIMSSIEKAGYKPGEDVYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS ++    Y  KGE  +L   + A YL +LV+ YPI SIEDGM EDDW GWK LT+ I
Sbjct: 244 AASEYYSDGIYNYKGEGKKLSSKQNAEYLTDLVNNYPIISIEDGMDEDDWEGWKELTDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN ERL KGIN+  AN+IL+K NQIG+++ETL  ++ A  AGY S++
Sbjct: 304 GDKCQLVGDDLFVTNSERLKKGINDGCANSILVKVNQIGTLTETLEAVDVAHRAGYTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEESLG  A +AG SIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEESLGATALYAGTSIL 423


>gi|310816536|ref|YP_003964500.1| enolase [Ketogulonicigenium vulgare Y25]
 gi|308755271|gb|ADO43200.1| enolase [Ketogulonicigenium vulgare Y25]
          Length = 424

 Score =  582 bits (1499), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 283/420 (67%), Positives = 336/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LE G+ GRA VPSGASTG HEA E RD +K RY GKG
Sbjct: 4   IVDIQAREILDSRGNPTVEVDVLLESGAFGRAAVPSGASTGAHEAVEKRDGDKSRYAGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN E+   L+G DA +Q  ID +MI++DGTPNK RLGANAILGVSLAV+KAAA
Sbjct: 64  VLEAVAAVNGELAEELVGLDATEQEDIDALMIEIDGTPNKGRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + +N PLY+Y+GG SA  LPVP+MNI+NGG HADN +DFQEFMIMPV A+NIR+AIRMGA
Sbjct: 124 EFTNQPLYRYIGGTSARTLPVPMMNIINGGEHADNPIDFQEFMIMPVAADNIRDAIRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL   G ST +GDEGGF+PN+ +   ALD I  +IEK GY  G+D+ +ALDC
Sbjct: 184 EVFHTLKKELHQAGLSTGIGDEGGFAPNIASTREALDFILRAIEKTGYTPGRDIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ +FK   Y+L GENL L P + A YLA LV  YPI SIEDGM+EDDW GWK+LT+KI
Sbjct: 244 ASTEYFKDGNYVLSGENLVLTPEQNADYLAKLVADYPIISIEDGMAEDDWAGWKLLTDKI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI + V N++L+K NQIG++SETL  ++ A  A Y +++
Sbjct: 304 GDKVQLVGDDLFVTNPLRLTDGIEQGVGNSMLVKVNQIGTLSETLRAVDIAHRARYTTVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG  A FAGRSIL
Sbjct: 364 SHRSGETEDTTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEMLGAGAVFAGRSIL 423


>gi|260433470|ref|ZP_05787441.1| phosphopyruvate hydratase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417298|gb|EEX10557.1| phosphopyruvate hydratase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 425

 Score =  581 bits (1498), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 282/420 (67%), Positives = 338/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAYEAVEKRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   L+G DA +Q+ ID  MI+LDGTPNK RLGANAILGVSLAV+KAAA
Sbjct: 64  VLEAVAAVNGEIAEELVGFDATEQVAIDAAMIELDGTPNKGRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A NIREA+RMG+
Sbjct: 124 DFTTQPLYRYVGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAASNIREAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G +T VGDEGGF+PN+ +   ALD I  SIEKAGY  G ++ +ALDC
Sbjct: 184 EVFHTLKKELSAAGLATGVGDEGGFAPNIASTREALDFILKSIEKAGYKPGDEIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ +FK  KY+L GE   L  +E  +YLA LV  YPI SIEDGMSEDDW GWK LT+++
Sbjct: 244 AATEYFKDGKYVLAGEGKTLSSDENVAYLAALVKDYPIISIEDGMSEDDWDGWKALTDEL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL +GI +  AN++L+K NQIGS++ETL  ++ A  AGY +++
Sbjct: 304 GGKVQLVGDDLFVTNPARLAEGIEKGCANSMLVKVNQIGSLTETLRAVDMAHRAGYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE+LG+ A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEETLGEVAEYAGRSIL 423


>gi|118589816|ref|ZP_01547220.1| probable enolase protein [Stappia aggregata IAM 12614]
 gi|118437313|gb|EAV43950.1| probable enolase protein [Stappia aggregata IAM 12614]
          Length = 424

 Score =  581 bits (1497), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 285/419 (68%), Positives = 341/419 (81%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I D+I R++ DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   R+ GKGV
Sbjct: 4   IIDVIGRQIFDSRGNPTVEVDVFLEDGSFGRAAVPSGASTGAHEAVELRDGGDRFMGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
             A+  VN EI   + G DA DQL ID+ MIDLDGT NKSRLGANAILGVSLAV++AAAQ
Sbjct: 64  QNAVDAVNGEIFETVGGLDAEDQLQIDQAMIDLDGTHNKSRLGANAILGVSLAVARAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG SA  LPVP+MNI+NGG HADN +DFQEFMIMPVGAE++ +A+RMG+E
Sbjct: 124 ASGLPLYRYVGGTSARTLPVPMMNIINGGAHADNPIDFQEFMIMPVGAESLGDAVRMGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           +FHTLKK L + G++TNVGDEGGF+PNL++ D+A+  +  +IE AGY  G+D+ +ALD A
Sbjct: 184 IFHTLKKALNAAGHNTNVGDEGGFAPNLESTDAAIGFVMKAIETAGYKPGEDVFLALDAA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+L+GE   L P EMA YLA+LV +YPI SIEDG++EDDW GWK  T+ IG
Sbjct: 244 STEFFKDGKYVLEGEGKTLAPEEMAKYLADLVSRYPIISIEDGLAEDDWDGWKATTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN ERL KGI+  VAN+ILIK NQIG++SETL+ +E A  A Y +++S
Sbjct: 304 NKCQLVGDDLFVTNSERLRKGIDLGVANSILIKVNQIGTLSETLDAVETAHKAAYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA +AGRSIL
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGAQAVYAGRSIL 422


>gi|328543850|ref|YP_004303959.1| Enolase [polymorphum gilvum SL003B-26A1]
 gi|326413594|gb|ADZ70657.1| Enolase [Polymorphum gilvum SL003B-26A1]
          Length = 424

 Score =  581 bits (1497), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 284/419 (67%), Positives = 342/419 (81%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IVDITAREILDSRGNPTVEVDVLLEDGAFGRAAVPSGASTGAHEAVELRDGGARYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN EI   + G DA DQ+ ID+ MIDLDGTPNK+RLGANAILGVSLAV+KAAAQ
Sbjct: 64  QKAVDAVNGEIFDTVGGLDAEDQIQIDQAMIDLDGTPNKARLGANAILGVSLAVAKAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
           ++ LPLY+Y+GG SA +LPVP+MNI+NGG HADN +DFQEFMIMPVGA ++ EA+RMGAE
Sbjct: 124 SAGLPLYRYVGGTSARLLPVPMMNIINGGAHADNPIDFQEFMIMPVGASSLAEAVRMGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK L   G++TNVGDEGGF+PNL++ D+A+  +  +IEKAGY  G+D+ +ALD A
Sbjct: 184 VFHTLKKALHDAGHNTNVGDEGGFAPNLESTDAAIGFVMKAIEKAGYTPGEDIHLALDAA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+L GE   L P +MA YL +LV +YPI SIEDG++EDDW GWK  T+ IG
Sbjct: 244 STEFFKDGKYVLAGEGKTLAPEQMARYLEDLVARYPIISIEDGLAEDDWDGWKAATDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL +GI   VAN+IL+K NQIGS++ETL+ +E A  A Y +++S
Sbjct: 304 TKCQLVGDDLFVTNSARLREGIARGVANSILVKVNQIGSLTETLDAVETAHKAAYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIE+ LG QA++AGRSIL
Sbjct: 364 HRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEQELGPQARYAGRSIL 422


>gi|86749895|ref|YP_486391.1| phosphopyruvate hydratase [Rhodopseudomonas palustris HaA2]
 gi|119369380|sp|Q2IWD0|ENO_RHOP2 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|86572923|gb|ABD07480.1| enolase [Rhodopseudomonas palustris HaA2]
          Length = 427

 Score =  580 bits (1496), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 281/420 (66%), Positives = 337/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVEVDVVLEDGSVGRAAVPSGASTGAHEAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN E+  AL G DA  Q+ ID+ MI+LDGTPNKSRLGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVEAVNGELFDALGGMDAEAQVQIDQTMIELDGTPNKSRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + +LPLY+Y+GG SA  LPVP+MNI+NGG HADN +DFQEFMIMP GA +  EA+R G+
Sbjct: 124 SSYDLPLYRYVGGTSARTLPVPMMNIINGGAHADNPIDFQEFMIMPAGAASFSEALRCGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLK ELK  G++TNVGDEGGF+PNL +AD+ALD + ++I KAGY AG+D++IALD 
Sbjct: 184 EIFHTLKGELKKAGHNTNVGDEGGFAPNLPSADAALDFVVSAIGKAGYKAGEDVMIALDP 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY+ + E   L P E A YLA+LV +YPI SIEDGM+EDD  GWK +T  I
Sbjct: 244 ASTEFFKNGKYVYEAEGRSLGPQEQAKYLADLVARYPIVSIEDGMAEDDIEGWKAITGLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN  RL+ GI    AN+ILIK NQIG+++ETL  +E A  AGY +++
Sbjct: 304 GDKCQLVGDDLFVTNVTRLYDGIKNGYANSILIKVNQIGTLTETLAAVEMAHKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLAR+DR +KYNQL+RIE+ LG QA FAG++ L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARADRTSKYNQLLRIEQELGTQAHFAGKAAL 423


>gi|116251995|ref|YP_767833.1| phosphopyruvate hydratase [Rhizobium leguminosarum bv. viciae 3841]
 gi|119369378|sp|Q1MH36|ENO_RHIL3 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|115256643|emb|CAK07731.1| putative enolase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 424

 Score =  580 bits (1496), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 287/419 (68%), Positives = 339/419 (80%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DIIARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD  KRY GKGV
Sbjct: 4   ITDIIAREILDSRGNPTVEVDVYLEDGSMGRAAVPSGASTGAHEAVELRDGGKRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+   N EI  A+ G DA +Q+ ID IMI+LDGTPNKSRLGANAILGVSLAV+KAAAQ
Sbjct: 64  EKAVEAANTEIFDAIGGIDAENQIQIDNIMIELDGTPNKSRLGANAILGVSLAVAKAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG SA +LPVP+MNI+NGG HADN +DFQEFMI+PVGA++I EA+RMG+E
Sbjct: 124 ASGLPLYRYVGGASACLLPVPMMNIINGGAHADNPIDFQEFMILPVGADSIAEAVRMGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTL+KEL ++G++TNVGDEGGF+P LK+A  ALD I  SIEKAGY  G D+ + LDCA
Sbjct: 184 VFHTLRKELAAQGHNTNVGDEGGFAPGLKSAPEALDFIMKSIEKAGYKPGDDMCLGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+L+GE   L+   MA YLA L   YPI SIEDGM+EDDW GWK LT+  G
Sbjct: 244 STEFFKDGKYVLEGEGRTLESGAMAEYLAELAANYPIISIEDGMAEDDWDGWKTLTDLAG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTN  RL  GI   VAN+IL+K NQIG+++ETL+ +  A  A Y +++S
Sbjct: 304 KKTQLVGDDLFVTNSARLRDGIRMGVANSILVKVNQIGTLTETLDAVNTAHKAAYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG QA++AGRSI+
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEGLGPQAQYAGRSII 422


>gi|220926281|ref|YP_002501583.1| phosphopyruvate hydratase [Methylobacterium nodulans ORS 2060]
 gi|219950888|gb|ACL61280.1| enolase [Methylobacterium nodulans ORS 2060]
          Length = 425

 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 284/420 (67%), Positives = 340/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I +I AR+++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K R+ GKG
Sbjct: 4   ITNIAARQILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAVELRDGDKARFGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+A VN EI  A+ G DA DQ+ +D+ MI+LDGTPNK+RLGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVAAVNGEILDAVGGMDAEDQVAVDEAMIELDGTPNKARLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y+GG  A +LPVP+MNI+NGG HADN +DFQEFMIMPVGA +I EA+RMGA
Sbjct: 124 EASGLPLYRYVGGTQARVLPVPMMNIINGGAHADNPIDFQEFMIMPVGAASIAEAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVF TLK  LK  G++TNVGDEGGF+PNL +A++ALD +  SI  AGY  GKD+++ALDC
Sbjct: 184 EVFQTLKGALKKAGHNTNVGDEGGFAPNLPSAEAALDFVMESIRAAGYAPGKDIVLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y+ +GE     P   A+YLA L D YPI SIEDGM+EDDW GWK LT+KI
Sbjct: 244 AATEFFKNGAYVYEGEGQTRDPEAQAAYLAKLADAYPILSIEDGMAEDDWQGWKALTDKI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN  RL +GI +  AN+IL+K NQIGS++ETL  ++ A  AGY +++
Sbjct: 304 GHRCQLVGDDLFVTNVARLSEGIAKGTANSILVKVNQIGSLTETLAAVDMAHRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE L  QA++AGR+ L
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEGLSGQARYAGRAAL 423


>gi|27379905|ref|NP_771434.1| phosphopyruvate hydratase [Bradyrhizobium japonicum USDA 110]
 gi|59797632|sp|Q89KV6|ENO_BRAJA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|27353058|dbj|BAC50059.1| enolase [Bradyrhizobium japonicum USDA 110]
          Length = 427

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 281/420 (66%), Positives = 337/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IIDIIGREILDSRGNPTVEVDVVLEDGALGRAAVPSGASTGAHEAVELRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN EI  AL G D   Q  ID+IMIDLDGTPNKSRLGANAILGVSLA +KAAA
Sbjct: 64  VTKAVGAVNGEIFEALSGLDVEQQAQIDQIMIDLDGTPNKSRLGANAILGVSLACAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + ++PLY+Y+GG SA +LPVP+MNI+NGG+HADN +DFQEFMI+PVGA +  E +R GA
Sbjct: 124 NSLDMPLYRYVGGTSARLLPVPMMNIINGGVHADNPIDFQEFMILPVGASSFAEGLRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLK ELK  G++TNVGDEGGF+PNL +AD+AL+ + N+I KAG+ AG D++I LDC
Sbjct: 184 EVFHTLKSELKKAGHNTNVGDEGGFAPNLPSADAALEFVMNAIGKAGFKAGSDIVIGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY+ +GE      +E A YLA+LV +YPI +IEDGMSEDD  GWK LT+ I
Sbjct: 244 ASTEFFKDGKYVYEGEGKTRSISEQAKYLADLVARYPIVTIEDGMSEDDMDGWKELTDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN +RL +GI    AN+ILIK NQIG+++ETL  +E A  AGY S++
Sbjct: 304 GKKCQLVGDDLFVTNVKRLAEGIKAGRANSILIKVNQIGTLTETLAAVEMAHKAGYTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQL+RIE+ LGKQA + G++ L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLLRIEQQLGKQALYGGKAAL 423


>gi|254462180|ref|ZP_05075596.1| phosphopyruvate hydratase [Rhodobacterales bacterium HTCC2083]
 gi|206678769|gb|EDZ43256.1| phosphopyruvate hydratase [Rhodobacteraceae bacterium HTCC2083]
          Length = 424

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 282/420 (67%), Positives = 335/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAHEAVEKRDGDKARYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   LLG DA +Q LID +MI+LDGTPNK+RLGANAILGVSLAV+KAAA
Sbjct: 64  VLEAVAAVNGEIAEELLGMDATEQELIDAMMIELDGTPNKARLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             S +PL++Y+GG SA  LPVP+MNI+NGG HADN +D QEFMIMPV A NIREA+RMG+
Sbjct: 124 DFSTMPLFRYVGGTSARTLPVPMMNIINGGEHADNPIDIQEFMIMPVSASNIREAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKKEL + G ST +GDEGGF+PN+ +   ALD I  SI KAGY AG+D+ +ALDC
Sbjct: 184 EIFHTLKKELTAAGLSTGIGDEGGFAPNIGSTREALDFIMKSIAKAGYKAGEDVYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ +FK  KY+  GE   L   E A+YL  LV+ YPI SIEDGM EDDW GWK LT+ I
Sbjct: 244 AATEYFKDGKYVYAGEGKSLTSAENAAYLEALVNDYPIISIEDGMDEDDWDGWKALTDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL  GI    AN++L+K NQIG++SETL  ++ A  A + +++
Sbjct: 304 GDRVQLVGDDLFVTNPERLALGIERGSANSMLVKVNQIGTLSETLKAVDMAHRARFTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG+ A++AGRS+L
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGETARYAGRSVL 423


>gi|319404084|emb|CBI77672.1| Enolase [Bartonella rochalimae ATCC BAA-1498]
          Length = 422

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 279/416 (67%), Positives = 328/416 (78%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKG 61
            I  II REV+DSRG+PT+EVDV LEDG+ GRA+VPSGAS G HEA ELRD   RY GKG
Sbjct: 3   IITGIIGREVLDSRGNPTVEVDVHLEDGAFGRAIVPSGASKGAHEAVELRDGGLRYQGKG 62

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V  A+A VN EI   L+G DAR+Q  ID+ MIDLDGTPNKSRLGANAILGVSLAV+KAAA
Sbjct: 63  VKNAVAAVNGEIFEVLIGKDARNQREIDQTMIDLDGTPNKSRLGANAILGVSLAVAKAAA 122

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           ++ NLPLY+Y+GG  AH+LP P+MNI+NGG+HADN +DFQEFMI+P+GA  ++EA+R GA
Sbjct: 123 ESLNLPLYRYIGGTQAHVLPTPMMNIMNGGVHADNPIDFQEFMIIPIGAPTLKEAVRYGA 182

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKK L+S GY+TNVGDEGGF+PNL+ A   +D I +SI   GY  GK++ I LDC
Sbjct: 183 EIFHTLKKHLQSAGYNTNVGDEGGFAPNLRDASQVIDFILDSIISCGYKPGKEIAIGLDC 242

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ F+K   Y  +GEN      E   YL  LVD YPI +IEDGM+EDDW GWK+LT+ I
Sbjct: 243 ASTEFYKNGSYFYEGENKYRNTQEQIKYLTQLVDTYPIITIEDGMAEDDWEGWKLLTSSI 302

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN  RL  GI    AN+ILIK NQIG++SETL  IE A  AGY ++I
Sbjct: 303 GKKCQLVGDDLFVTNSARLRNGIKMGAANSILIKVNQIGTLSETLGAIEIAHKAGYRAVI 362

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED  IADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LGKQA++AG
Sbjct: 363 SHRSGETEDSLIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGKQARYAG 418


>gi|90419619|ref|ZP_01227529.1| Enolase [Aurantimonas manganoxydans SI85-9A1]
 gi|90336556|gb|EAS50297.1| Enolase [Aurantimonas manganoxydans SI85-9A1]
          Length = 426

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 284/419 (67%), Positives = 336/419 (80%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DII RE++DSRG+PT+EVDV LEDG+  RA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIIGREILDSRGNPTVEVDVILEDGTLARAAVPSGASTGAHEAVELRDGGSRYMGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN EI  A+ G +A DQ+ ID  M +LDGTPNKSRLGANAILGVSLAV+KAAA 
Sbjct: 64  QKAVDAVNGEILEAIGGYEAEDQIRIDAAMRELDGTPNKSRLGANAILGVSLAVAKAAAD 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            + LPLY+Y+GG SAH+LPVP+MNI+NGG HADN +DFQEFMIMPVGAE   +A+RMGAE
Sbjct: 124 AAALPLYRYVGGASAHVLPVPMMNIINGGAHADNPIDFQEFMIMPVGAERFSDALRMGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK LK  G++TNVGDEGGF+P L +A   LD +  +IEKAGY  G+D+ +ALDCA
Sbjct: 184 VFHTLKKMLKDAGHNTNVGDEGGFAPGLASAKDGLDFVMRAIEKAGYKPGEDMFLALDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK + Y L+GE  +L P++MA YLA L   YPI SIEDGM+EDDW GWK LT K G
Sbjct: 244 STEFFKNDVYDLEGEGRKLSPDDMAGYLAELAGAYPIISIEDGMAEDDWAGWKTLTEKTG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           +  QLVGDDLFVTN ERL  GI + VAN+IL+K NQIG+++ETL+ +  A  AGY +++S
Sbjct: 304 ATVQLVGDDLFVTNSERLRDGIAKGVANSILVKVNQIGTLTETLDAVSVAHRAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQL+RIEE LG QA +AGRSIL
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLLRIEEELGDQAVYAGRSIL 422


>gi|17987134|ref|NP_539768.1| phosphopyruvate hydratase [Brucella melitensis bv. 1 str. 16M]
 gi|225852632|ref|YP_002732865.1| phosphopyruvate hydratase [Brucella melitensis ATCC 23457]
 gi|256044789|ref|ZP_05447693.1| phosphopyruvate hydratase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113695|ref|ZP_05454499.1| phosphopyruvate hydratase [Brucella melitensis bv. 3 str. Ether]
 gi|256263875|ref|ZP_05466407.1| phosphopyruvate hydratase [Brucella melitensis bv. 2 str. 63/9]
 gi|260565608|ref|ZP_05836092.1| phosphopyruvate hydratase [Brucella melitensis bv. 1 str. 16M]
 gi|265991213|ref|ZP_06103770.1| phosphopyruvate hydratase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995049|ref|ZP_06107606.1| phosphopyruvate hydratase [Brucella melitensis bv. 3 str. Ether]
 gi|21263581|sp|Q8YHF0|ENO_BRUME RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|254783236|sp|C0RJA3|ENO_BRUMB RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|17982798|gb|AAL52032.1| enolase [Brucella melitensis bv. 1 str. 16M]
 gi|225640997|gb|ACO00911.1| phosphopyruvate hydratase [Brucella melitensis ATCC 23457]
 gi|260151676|gb|EEW86770.1| phosphopyruvate hydratase [Brucella melitensis bv. 1 str. 16M]
 gi|262766162|gb|EEZ11951.1| phosphopyruvate hydratase [Brucella melitensis bv. 3 str. Ether]
 gi|263001997|gb|EEZ14572.1| phosphopyruvate hydratase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094006|gb|EEZ17940.1| phosphopyruvate hydratase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409151|gb|ADZ66216.1| phosphopyruvate hydratase [Brucella melitensis M28]
 gi|326538860|gb|ADZ87075.1| phosphopyruvate hydratase [Brucella melitensis M5-90]
          Length = 425

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 286/419 (68%), Positives = 334/419 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI+ RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIVGREILDSRGNPTVEVDVVLEDGSFGRAAVPSGASTGAHEAVELRDGGSRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN +I  A+ G DA  QLLID+ +IDLDG+ NK  LGANAILGVSLAV+KAAAQ
Sbjct: 64  EKAVEVVNGKIFDAIAGMDAESQLLIDQTLIDLDGSANKGNLGANAILGVSLAVAKAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMI+PVGA +IREA+R G+E
Sbjct: 124 ASGLPLYRYVGGTNAHVLPVPMMNIINGGAHADNPIDFQEFMILPVGATSIREAVRYGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK LK  G++TNVGDEGGF+PNLK A +ALD I  SIEKAG+  G+D+ + LDCA
Sbjct: 184 VFHTLKKRLKDAGHNTNVGDEGGFAPNLKNAQAALDFIMESIEKAGFKPGEDIALGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ FFK   Y+ +GE     P   A YLA L   YPI +IEDGM+EDDW GWK LT+ IG
Sbjct: 244 ATEFFKDGNYVYEGERKTRDPKAQAKYLAKLASDYPIVTIEDGMAEDDWEGWKYLTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  AGY +++S
Sbjct: 304 NKCQLVGDDLFVTNSARLRDGIRLGVANSILVKVNQIGSLSETLDAVETAHKAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQLIRIEE L KQA++AGRS L
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLIRIEEELDKQARYAGRSAL 422


>gi|254701875|ref|ZP_05163703.1| phosphopyruvate hydratase [Brucella suis bv. 5 str. 513]
 gi|261752438|ref|ZP_05996147.1| enolase [Brucella suis bv. 5 str. 513]
 gi|261742191|gb|EEY30117.1| enolase [Brucella suis bv. 5 str. 513]
          Length = 425

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 286/419 (68%), Positives = 334/419 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI+ RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIVGREILDSRGNPTVEVDVVLEDGSFGRAAVPSGASTGAHEAVELRDGGSRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN +I  A+ G DA  QLLID+ +I LDG+ NK  LGANAILGVSLAV+KAAAQ
Sbjct: 64  EKAVEVVNGKIFDAIAGMDAESQLLIDQTLIGLDGSANKGNLGANAILGVSLAVAKAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMI+PVGA +IREA+R G+E
Sbjct: 124 ASGLPLYRYVGGTNAHVLPVPMMNIINGGAHADNPIDFQEFMILPVGATSIREAVRYGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK LK  G++TNVGDEGGF+PNLK A +ALD I  SIEKAG+  G+D+ + LDCA
Sbjct: 184 VFHTLKKRLKDAGHNTNVGDEGGFAPNLKNAQAALDFIMESIEKAGFKPGEDIALGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ FFK   Y+ +GE     P   A YLA L   YPI +IEDGM+EDDW GWK LT+ IG
Sbjct: 244 ATEFFKDGNYVYEGERKTRDPKAQAKYLAKLASDYPIVTIEDGMAEDDWEGWKYLTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  AGY +++S
Sbjct: 304 NKCQLVGDDLFVTNSARLRDGIRLGVANSILVKVNQIGSLSETLDAVETAHKAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQLIRIEE LGKQA++AGRS L
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLIRIEEELGKQARYAGRSAL 422


>gi|254474870|ref|ZP_05088256.1| phosphopyruvate hydratase [Ruegeria sp. R11]
 gi|214029113|gb|EEB69948.1| phosphopyruvate hydratase [Ruegeria sp. R11]
          Length = 424

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 281/420 (66%), Positives = 337/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD +  RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVILEDGTLGRAAVPSGASTGAHEAVEKRDGDASRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI  AL+G D  +Q+ ID  MI+LDGTPNK RLGANAILGVSLAV+KAAA
Sbjct: 64  VLEAVAAVNGEIAEALVGFDVTEQVAIDAAMIELDGTPNKGRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PL++Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV AEN++EAIRMGA
Sbjct: 124 DFTAQPLFRYVGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVSAENVKEAIRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + GY+T +GDEGGF+P L++   ALD +  SIEKAGY  G+D+ +ALDC
Sbjct: 184 EVFHTLKKELSAAGYNTGIGDEGGFAPALESTRKALDFVMTSIEKAGYKPGEDIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ ++   KY +KGE   L   E A YLA L   YPI SIEDGM+EDDW GWK+LT+KI
Sbjct: 244 ASTEYYVDGKYEMKGEGASLSSAENADYLAALCADYPIISIEDGMAEDDWEGWKLLTDKI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL  GI + VAN++L+K NQIGS+SETL  ++ A  A Y +++
Sbjct: 304 GDKVQLVGDDLFVTNPERLADGIRQGVANSMLVKVNQIGSLSETLKAVDMAHRARYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG+ A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEELLGETAEYAGRSIL 423


>gi|163843399|ref|YP_001627803.1| phosphopyruvate hydratase [Brucella suis ATCC 23445]
 gi|189037202|sp|B0CGT2|ENO_BRUSI RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|163674122|gb|ABY38233.1| phosphopyruvate hydratase [Brucella suis ATCC 23445]
          Length = 425

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 286/419 (68%), Positives = 334/419 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI+ RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIVGREILDSRGNPTVEVDVVLEDGSFGRAAVPSGASTGAHEAVELRDGGSRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN +I  A+ G DA  QLLID+ +IDLDG+ NK  LGANAILGVSLAV+KAAAQ
Sbjct: 64  EKAVEVVNGKIFDAIAGMDAESQLLIDQTLIDLDGSANKGNLGANAILGVSLAVAKAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMI+PVGA +IREA+R G+E
Sbjct: 124 ASGLPLYRYVGGTNAHVLPVPMMNIINGGAHADNPIDFQEFMILPVGATSIREAVRYGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK LK  G++TNVGDEGGF+PNLK A +ALD I  SIEKAG+  G+D+ + LDCA
Sbjct: 184 VFHTLKKRLKDAGHNTNVGDEGGFAPNLKNAQAALDFIMESIEKAGFKPGEDIALGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ FFK   Y+ +GE     P   A YLA L   Y I +IEDGM+EDDW GWK LT+ IG
Sbjct: 244 ATEFFKDGNYVYEGERKTRDPKAQAKYLAKLASDYSIVTIEDGMAEDDWEGWKYLTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  AGY +++S
Sbjct: 304 NKCQLVGDDLFVTNSARLRDGIRLGVANSILVKVNQIGSLSETLDAVETAHKAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQLIRIEE LGKQA++AGRS L
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLIRIEEELGKQARYAGRSAL 422


>gi|239832021|ref|ZP_04680350.1| phosphopyruvate hydratase [Ochrobactrum intermedium LMG 3301]
 gi|239824288|gb|EEQ95856.1| phosphopyruvate hydratase [Ochrobactrum intermedium LMG 3301]
          Length = 425

 Score =  579 bits (1492), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 285/419 (68%), Positives = 335/419 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI+ RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIVGREILDSRGNPTVEVDVVLEDGSFGRAAVPSGASTGAHEAVELRDGGGRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN +I  A+ G DA  QLLID+ MI+LDG+ NK  LGANAILGVSLAV+KAAAQ
Sbjct: 64  EKAVEAVNGKIFDAIAGMDAESQLLIDQAMIELDGSANKGNLGANAILGVSLAVAKAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            + LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMI+PVGA ++REA+R G+E
Sbjct: 124 AAGLPLYRYVGGANAHVLPVPMMNIINGGAHADNPIDFQEFMILPVGASSVREAVRYGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK LK  G++TNVGDEGGF+PNLK A +ALD I  SIEKAG+  G+D+ + LDCA
Sbjct: 184 VFHTLKKRLKDAGHNTNVGDEGGFAPNLKNAQAALDFIMESIEKAGFKPGEDIALGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ FFK   Y+ +GE     P   A YLA L   YPI +IEDGM+EDDW GWK LT+ IG
Sbjct: 244 ATEFFKDGNYVYEGERKTRDPKAQAKYLAKLASDYPIVTIEDGMAEDDWEGWKYLTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  AGY +++S
Sbjct: 304 NKCQLVGDDLFVTNSARLRDGIRMGVANSILVKVNQIGSLSETLDAVETAHKAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQLIRIEE LGKQA++AGRS L
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLIRIEEELGKQARYAGRSAL 422


>gi|91977286|ref|YP_569945.1| phosphopyruvate hydratase [Rhodopseudomonas palustris BisB5]
 gi|119369382|sp|Q136E5|ENO_RHOPS RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|91683742|gb|ABE40044.1| enolase [Rhodopseudomonas palustris BisB5]
          Length = 427

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 281/420 (66%), Positives = 336/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVEVDVVLEDGSVGRAAVPSGASTGAHEAVELRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN E+  AL G DA  Q+ ID+ MI+LDGTPNK RLGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVEAVNGELFDALGGMDAEQQVQIDQTMIELDGTPNKGRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + +LPLY+Y+GG SA  LPVP+MNI+NGG HADN +DFQEFMIMPVGA +  EA+R G+
Sbjct: 124 SSYDLPLYRYVGGTSARTLPVPMMNIINGGAHADNPIDFQEFMIMPVGAASFSEALRCGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLK ELK  G++TNVGDEGGF+PNL +AD+ALD +  +I KAGY AG+D++IALD 
Sbjct: 184 EIFHTLKGELKKAGHNTNVGDEGGFAPNLPSADAALDFVMAAIGKAGYKAGEDVMIALDP 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY+ + E   L P E A YLA+LV +YPI SIEDGM+EDD  GWK +T+ I
Sbjct: 244 ASTEFFKNGKYVYEAEGRSLGPQEQAKYLADLVARYPIVSIEDGMAEDDIEGWKAITDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN  RL  GI    AN+ILIK NQIG+++ETL  +E A  AGY +++
Sbjct: 304 GDKCQLVGDDLFVTNVTRLADGIKNGYANSILIKVNQIGTLTETLAAVEMAHKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLAR+DR AKYNQL+RIE+ LG QA +AG++ L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARADRTAKYNQLLRIEQELGAQAHYAGKAAL 423


>gi|153009386|ref|YP_001370601.1| phosphopyruvate hydratase [Ochrobactrum anthropi ATCC 49188]
 gi|166232213|sp|A6X0L8|ENO_OCHA4 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|151561274|gb|ABS14772.1| Phosphopyruvate hydratase [Ochrobactrum anthropi ATCC 49188]
          Length = 425

 Score =  578 bits (1489), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 283/419 (67%), Positives = 334/419 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI+ RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIVGREILDSRGNPTVEVDVVLEDGSFGRAAVPSGASTGAHEAVELRDGGSRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN +I  A+ G DA  QLLID+ MI+LDG+ NK  +GANAILGVSLAV+KAAAQ
Sbjct: 64  EKAVEAVNGKIFDAIAGMDAESQLLIDQTMIELDGSANKGNIGANAILGVSLAVAKAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            + LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMI+PVGA ++REA+R G+E
Sbjct: 124 ATGLPLYRYVGGANAHVLPVPMMNIINGGAHADNPIDFQEFMILPVGASSVREAVRYGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK LK  G++TNVGDEGGF+PNLK A +ALD I  SIEKAG+  G+D+ + LDCA
Sbjct: 184 VFHTLKKRLKDAGHNTNVGDEGGFAPNLKNAQAALDFIMESIEKAGFKPGEDIALGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ FFK   Y+ +GE     P   A YLA L   YPI +IEDGM+EDDW GWK LT+ IG
Sbjct: 244 ATEFFKDGNYVYEGERKTRDPKAQAKYLAKLASDYPIVTIEDGMAEDDWEGWKYLTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
             CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS+SETL+ +E A  AGY +++S
Sbjct: 304 DKCQLVGDDLFVTNSARLRDGIRMGVANSILVKVNQIGSLSETLDAVETAHKAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQLIRIEE LGKQA++AGR+ L
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLIRIEEELGKQARYAGRNAL 422


>gi|170743958|ref|YP_001772613.1| phosphopyruvate hydratase [Methylobacterium sp. 4-46]
 gi|168198232|gb|ACA20179.1| Phosphopyruvate hydratase [Methylobacterium sp. 4-46]
          Length = 425

 Score =  578 bits (1489), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 283/420 (67%), Positives = 341/420 (81%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I +I AR+++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K R+ GKG
Sbjct: 4   ITNIAARQILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAVELRDGDKGRFGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+A VN EI  A+ G DA DQ+ +D+ MI+LDGTPNK+RLGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVAAVNGEILDAIGGMDAEDQVAVDEAMIELDGTPNKARLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y+GG  A +LPVP+MNI+NGG+HADN +DFQEFMIMPVGA +I EA+RMGA
Sbjct: 124 EASGLPLYRYVGGTQARVLPVPMMNIINGGVHADNPIDFQEFMIMPVGAASIAEAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVF TLK  LK  G++TNVGDEGGF+PNL +A++ALD +  SI  AGY  G+D+++ALDC
Sbjct: 184 EVFQTLKGALKKAGHNTNVGDEGGFAPNLPSAEAALDFVMESIRAAGYAPGEDIVLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y  +GE     P   A+YLA LV+ YPI SIEDGM+EDDW GWK LT++I
Sbjct: 244 AATEFFKNGAYAYEGEGQTRDPEAQAAYLAKLVNAYPIRSIEDGMAEDDWLGWKALTDRI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN  RL +GI +  AN+IL+K NQIGS++ETL  ++ A  AGY +++
Sbjct: 304 GDRCQLVGDDLFVTNVARLSEGIAKGTANSILVKVNQIGSLTETLAAVDMAHRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA++AGR  L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEGLGAQARYAGRGAL 423


>gi|146341023|ref|YP_001206071.1| phosphopyruvate hydratase [Bradyrhizobium sp. ORS278]
 gi|166232173|sp|A4YVC0|ENO_BRASO RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|146193829|emb|CAL77846.1| Enolase (2-phosphoglycerate dehydratase) (2-phospho-D-glycerate
           hydro-lyase) [Bradyrhizobium sp. ORS278]
          Length = 427

 Score =  578 bits (1489), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 282/420 (67%), Positives = 338/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKR-YFGKG 61
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +KR Y GKG
Sbjct: 4   IVDIIGREILDSRGNPTVEVDVVLEDGSVGRAAVPSGASTGAHEAVELRDGDKRRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  +NDEI  AL     +DQ+ ID+I+I+LDGT NKSRLGANAILGVSLA +KAAA
Sbjct: 64  VQKAVEAINDEIYEALSDMSVQDQVQIDQILIELDGTENKSRLGANAILGVSLACAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + ++PLY+Y+GG SA  LPVP+MNI+NGG+HADN +DFQEFMIMPVGA +  EA+R G+
Sbjct: 124 ISYDMPLYRYVGGTSARTLPVPMMNIVNGGVHADNPIDFQEFMIMPVGAPSFAEALRCGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLK ELK  G++TNVGDEGGF+PNL +AD+ALD +  +I KAGY AG+D+++ALDC
Sbjct: 184 EIFHTLKGELKKAGHNTNVGDEGGFAPNLPSADAALDFVMAAIGKAGYTAGEDVMLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK  KY+ +GEN     +E A YLA+LV +YPI SIEDGMSEDD  GWK LT+ I
Sbjct: 244 AATEFFKDGKYVYEGENKSRSRSEQAKYLADLVARYPICSIEDGMSEDDMDGWKELTDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN  RL  GI    AN+ILIK NQIG+++ETL  +E A  AGY +++
Sbjct: 304 GHKCQLVGDDLFVTNVTRLEDGIRNGRANSILIKVNQIGTLTETLAAVEMAYKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQL+RIE+ L  QAK+AGR+ L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLLRIEQELDAQAKYAGRAAL 423


>gi|319407096|emb|CBI80733.1| Enolase [Bartonella sp. 1-1C]
          Length = 422

 Score =  577 bits (1488), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 278/416 (66%), Positives = 328/416 (78%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKG 61
            I  II REV+DSRG+PT+EVDV LEDG+ GRA+VPSGAS G HEA ELRD   RY GKG
Sbjct: 3   IITGIIGREVLDSRGNPTVEVDVHLEDGAFGRAIVPSGASKGAHEAVELRDGGLRYQGKG 62

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V  A+A VN EI   L+G DAR+Q  ID+ MIDLDGTPNKSRLGANAILGVSLAV+KAAA
Sbjct: 63  VESAVAAVNGEIFEVLIGKDARNQREIDQTMIDLDGTPNKSRLGANAILGVSLAVAKAAA 122

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           ++ NLPLY+Y+GG  AH+LP P+MNI+NGG+HADN +DFQEFMI+P+GA  ++EA+R GA
Sbjct: 123 ESLNLPLYRYIGGTQAHVLPTPMMNIMNGGVHADNPIDFQEFMIIPIGAPTLKEAVRYGA 182

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKK L+S GY+TNVGDEGGF+PNL+ A   +D I +SI   GY  G+++ I LDC
Sbjct: 183 EIFHTLKKHLQSAGYNTNVGDEGGFAPNLRDASQVIDFILDSIISCGYKPGEEIAIGLDC 242

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ F+K   Y  +GEN      E   YL  LVD YPI +IEDGM+EDDW GWK+LT  I
Sbjct: 243 ASTEFYKDGSYFYEGENKYRNTQEQIKYLTQLVDTYPIITIEDGMAEDDWEGWKLLTGSI 302

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN  RL  GI    AN+ILIK NQIG++SETL+ IE A  AGY ++I
Sbjct: 303 GKKCQLVGDDLFVTNSARLRNGIKMGAANSILIKVNQIGTLSETLDAIEIAHKAGYRAVI 362

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED  IADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LGKQA++AG
Sbjct: 363 SHRSGETEDSLIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGKQARYAG 418


>gi|99080772|ref|YP_612926.1| phosphopyruvate hydratase [Ruegeria sp. TM1040]
 gi|119369397|sp|Q1GI52|ENO_SILST RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|99037052|gb|ABF63664.1| enolase [Ruegeria sp. TM1040]
          Length = 425

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 280/420 (66%), Positives = 340/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVVLEDGTMGRAAVPSGASTGAYEAVEKRDGDKSRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   L+G DA +Q+ ID+ MI+LDGT NK RLGANAILGVS+AV+KAAA
Sbjct: 64  VLEAVAAVNGEIADELVGFDATEQVSIDRAMIELDGTENKGRLGANAILGVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PLY+Y+GG +A ILPVP+MNI+NGG HADN +D QEFMIMPV AENIR+A+RMG+
Sbjct: 124 DFTTQPLYRYVGGAAARILPVPMMNIINGGEHADNPIDIQEFMIMPVAAENIRDAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+PN+ ++  ALD I  SIEKAGY  G+++ +ALDC
Sbjct: 184 EVFHTLKKELSAAGLSTGIGDEGGFAPNIASSREALDFILKSIEKAGYKPGEEIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ ++K  KY+L GE   L   E A+YLA LV+ YPI SIEDGMSEDDW GWK LT++I
Sbjct: 244 AATEYYKDGKYVLSGEGKTLTSEENAAYLAALVNDYPIISIEDGMSEDDWDGWKALTDQI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL +GI    AN++L+K NQIGS++ETL  ++ A  A Y +++
Sbjct: 304 GDKVQLVGDDLFVTNPVRLAEGIERGCANSMLVKVNQIGSLTETLQAVDMAHRARYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE+LG+ A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEETLGEIAEYAGRSIL 423


>gi|300023281|ref|YP_003755892.1| enolase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525102|gb|ADJ23571.1| enolase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 428

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 288/420 (68%), Positives = 339/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA ELRD +K RYFGKG
Sbjct: 4   IVDIIGREILDSRGNPTVEVDVLLEDGAEGRAAVPSGASTGAHEAIELRDGDKDRYFGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EI  AL G DA DQ  ID  +I LDGT NKSRLGANAILGVSLA +KAAA
Sbjct: 64  VLKAVDAVNGEIFDALAGMDAEDQRGIDAALIKLDGTANKSRLGANAILGVSLAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            ++NLPLY+YLGG +AH+LPVP+MNI+NGG HADN +D QEFMIMP+ AE   +AIR+GA
Sbjct: 124 ISNNLPLYRYLGGVNAHVLPVPMMNIINGGAHADNPIDIQEFMIMPIAAETCADAIRIGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKK LK  G+ST+VGDEGGF+PNLK+A+ AL  I  SIEKAGY  G+D+ +ALDC
Sbjct: 184 EVFHTLKKNLKDAGHSTSVGDEGGFAPNLKSAEEALSFIVKSIEKAGYKPGEDVALALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ +FK  KY L GE   L     A YL NLV+++PI SIEDGM+EDDW GWK+LT  +
Sbjct: 244 ASTEYFKNGKYELAGEGKTLDSAGNAKYLENLVNKFPIISIEDGMAEDDWAGWKLLTELL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+ CQLVGDDLFVTN +RL  GI +  AN+IL+K NQIGS+SETL+ +  AQ AGY +++
Sbjct: 304 GNRCQLVGDDLFVTNTKRLADGIAKSTANSILVKVNQIGSLSETLDAVSMAQRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG  A +AGRSIL
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEELGDVAVYAGRSIL 423


>gi|83953763|ref|ZP_00962484.1| enolase [Sulfitobacter sp. NAS-14.1]
 gi|83841708|gb|EAP80877.1| enolase [Sulfitobacter sp. NAS-14.1]
          Length = 425

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 282/420 (67%), Positives = 335/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGKG 61
           I DI ARE+IDSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD  +KRY GKG
Sbjct: 4   IIDIHAREIIDSRGNPTVEVDVTLEDGTMGRAAVPSGASTGAYEAVERRDGDQKRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A A VN EI  AL+G DA +Q+ ID  MI+LDGT NKSRLGANAILGVSLA +KAAA
Sbjct: 64  VLEACASVNGEIADALVGIDATEQVEIDGTMIELDGTDNKSRLGANAILGVSLATAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
              + PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV AENIR+A+RMG+
Sbjct: 124 DYCSQPLYRYVGGTSARMLPVPMMNIINGGEHADNPIDIQEFMIMPVAAENIRDAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+PN+ +   ALD I  SIEKAGY  G+++ +ALDC
Sbjct: 184 EVFHTLKKELSAAGLSTGIGDEGGFAPNISSTRDALDFILKSIEKAGYKPGEEIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ +FK   Y+L GE   L   E   YLA L   YPI SIEDGMSEDDW GWK+LT+++
Sbjct: 244 AATEYFKDGSYVLSGEGKTLTSAENVDYLAALCADYPIISIEDGMSEDDWDGWKLLTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI    AN++L+K NQIG++SETL  ++ A  AG+ +++
Sbjct: 304 GDKIQLVGDDLFVTNPERLAEGIKRGSANSMLVKVNQIGTLSETLQAVDMAHRAGFTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEESLG  A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEESLGVTAEYAGRSIL 423


>gi|86138676|ref|ZP_01057249.1| enolase [Roseobacter sp. MED193]
 gi|85824736|gb|EAQ44938.1| enolase [Roseobacter sp. MED193]
          Length = 425

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 277/420 (65%), Positives = 336/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAHEAVERRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   L+G DA +Q+ +D  MI+LDGTPNK+RLGANAILGVS+AV+KAAA
Sbjct: 64  VLEAVAAVNGEIAEELVGFDATEQVAVDSAMIELDGTPNKARLGANAILGVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PL++Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A+NIREA+RMGA
Sbjct: 124 DFTTQPLFRYVGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAADNIREAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+PN+ +   ALD +  SIEKAGY  G+++ +ALDC
Sbjct: 184 EVFHTLKKELSAAGLSTGIGDEGGFAPNIASTREALDFVLKSIEKAGYRPGEEIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ ++K  KY+L GE   L   E   YLA LV+ YPI SIEDGM EDDW GWK LT+ I
Sbjct: 244 AATEYYKDGKYVLSGEGKVLSSAENVDYLAALVNDYPIISIEDGMGEDDWDGWKALTDAI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL +GI    AN++L+K NQIG+++ETL  ++ A  AG+ +++
Sbjct: 304 GDKVQLVGDDLFVTNPARLAEGIQRGSANSMLVKVNQIGTLTETLKAVDMAHRAGFTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG+ A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEVLGEVAEYAGRSIL 423


>gi|259418806|ref|ZP_05742723.1| phosphopyruvate hydratase [Silicibacter sp. TrichCH4B]
 gi|259345028|gb|EEW56882.1| phosphopyruvate hydratase [Silicibacter sp. TrichCH4B]
          Length = 439

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 280/420 (66%), Positives = 339/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +  RY GKG
Sbjct: 18  IIDIHAREILDSRGNPTVEVDVVLEDGTMGRAAVPSGASTGAYEAVEKRDGDTSRYMGKG 77

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   L+G DA +Q+ ID+ MI+LDGT NKSRLGANAILGVSLAV+KAAA
Sbjct: 78  VLEAVAAVNGEIADELVGFDATEQVSIDRAMIELDGTENKSRLGANAILGVSLAVAKAAA 137

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PLY+Y+GG +A +LPVP+MNI+NGG HADN +D QEFMIMPV AENIR+A+RMG+
Sbjct: 138 DFTTQPLYRYVGGAAARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAAENIRDAVRMGS 197

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+PN+ +   ALD I  SIEKAGY  G+++ +ALDC
Sbjct: 198 EVFHTLKKELSAAGLSTGIGDEGGFAPNIASTREALDFILKSIEKAGYKPGEEIYLALDC 257

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ ++K  KY+L GE   L   E A+YLA LV+ YPI SIEDGMSEDDW GWK LT++I
Sbjct: 258 AATEYYKDGKYVLSGEGKTLTSEENAAYLAALVNDYPIISIEDGMSEDDWDGWKALTDQI 317

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL +GI    AN++L+K NQIGS++ETL  ++ A  A Y +++
Sbjct: 318 GDKVQLVGDDLFVTNPVRLAEGIERGCANSMLVKVNQIGSLTETLQAVDMAHRARYTNVM 377

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE+LG+ A++AGRSIL
Sbjct: 378 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEETLGEIAEYAGRSIL 437


>gi|163868053|ref|YP_001609257.1| phosphopyruvate hydratase [Bartonella tribocorum CIP 105476]
 gi|189037200|sp|A9IS50|ENO_BART1 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|161017704|emb|CAK01262.1| Enolase [Bartonella tribocorum CIP 105476]
          Length = 422

 Score =  575 bits (1483), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 279/416 (67%), Positives = 328/416 (78%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKG 61
            I DII REV+DSRG+PT+EVDV LE+G+ GRA+VPSGASTG HEA ELRD + RY GKG
Sbjct: 3   IIVDIIGREVLDSRGNPTVEVDVYLENGAFGRALVPSGASTGAHEAIELRDGDLRYQGKG 62

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+A VN EI   L G DARDQ+ ID+ MI LDGTPNK+RLGANA+LGVSLAV+KAAA
Sbjct: 63  VEKAVAAVNGEILEELGGRDARDQIAIDQAMIALDGTPNKARLGANALLGVSLAVAKAAA 122

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + NLPLY+Y+GG  AHILP P+MNI+NGG+HADN +DFQEFMI+PVGA +++EAIR GA
Sbjct: 123 DSLNLPLYRYIGGTQAHILPTPMMNIINGGVHADNLIDFQEFMIIPVGAPSVKEAIRYGA 182

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK LK  GY+TNVGDEGGF+P  K+AD A+D I  SI   GY  G+ + I LDC
Sbjct: 183 EIFHALKKRLKDAGYNTNVGDEGGFAPQFKSADQAIDFIMESIIACGYKPGEQIAIGLDC 242

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ F+K   Y  KGE       E   YLA LV  YPI +IEDGM+EDDW GWK+LT+ I
Sbjct: 243 ASTEFYKNGSYFYKGEGKCRNIAEQVDYLAQLVKSYPIVTIEDGMAEDDWEGWKLLTDTI 302

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+ CQ+VGDDLFVTN  RL  GI   V N+ILIK NQIG++SETL+ +E A  AGY +II
Sbjct: 303 GTKCQMVGDDLFVTNSARLRDGIKMGVGNSILIKVNQIGTLSETLDAVEVAHKAGYRAII 362

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED  IADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA++AG
Sbjct: 363 SHRSGETEDSFIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGSQARYAG 418


>gi|56697325|ref|YP_167691.1| phosphopyruvate hydratase [Ruegeria pomeroyi DSS-3]
 gi|68053528|sp|Q5LQL4|ENO_SILPO RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|56679062|gb|AAV95728.1| enolase [Ruegeria pomeroyi DSS-3]
          Length = 425

 Score =  575 bits (1483), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 279/420 (66%), Positives = 336/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVVLEDGTMGRAAVPSGASTGAYEAVERRDGDKSRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   L+G DA +Q+ ID  MI+LDGT NK RLGANAILGVSLAV+KAAA
Sbjct: 64  VLEAVAAVNGEIAEELVGFDATEQVAIDAAMIELDGTENKGRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV AE+IR+A+RMGA
Sbjct: 124 DFTAQPLYRYVGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAAEDIRDAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+PN+ +   ALD +  SIEKAGY  G+D+ +ALDC
Sbjct: 184 EVFHTLKKELSAAGLSTGIGDEGGFAPNIASTREALDFVLKSIEKAGYKPGEDIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ +FK  KY+L GE   L  +E   YLA LV  YPI SIEDGM+EDDW GWK LT+++
Sbjct: 244 AATEYFKDGKYVLSGEGKTLSSDENVDYLAALVADYPIISIEDGMAEDDWAGWKALTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL +GI    AN++L+K NQIGS++ETL  ++ A  A Y +++
Sbjct: 304 GGKVQLVGDDLFVTNPARLAEGITRGCANSMLVKVNQIGSLTETLKAVDMAHRARYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE+LG+ A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEALGEVAEYAGRSIL 423


>gi|83942542|ref|ZP_00955003.1| enolase [Sulfitobacter sp. EE-36]
 gi|83846635|gb|EAP84511.1| enolase [Sulfitobacter sp. EE-36]
          Length = 425

 Score =  575 bits (1482), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 282/420 (67%), Positives = 335/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE+IDSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREIIDSRGNPTVEVDVTLEDGTMGRAAVPSGASTGAYEAVERRDGDKNRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A A VN EI  AL+G DA +Q+ ID  MI+LDGT NKSRLGANAILGVSLA +KAAA
Sbjct: 64  VLEACASVNGEIADALVGIDATEQVEIDGTMIELDGTDNKSRLGANAILGVSLATAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
              + PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV AENIR+A+RMG+
Sbjct: 124 DYCSQPLYRYVGGTSARMLPVPMMNIINGGEHADNPIDIQEFMIMPVAAENIRDAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+PN+ +   ALD I  SIEKAGY  G+++ +ALDC
Sbjct: 184 EVFHTLKKELSAAGLSTGIGDEGGFAPNISSTRDALDFILKSIEKAGYKPGEEIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ +FK   Y+L GE   L   E   YLA L   YPI SIEDGMSEDDW GWK+LT+++
Sbjct: 244 AATEYFKDGSYVLSGEGKTLTSAENVDYLAALCADYPIISIEDGMSEDDWDGWKLLTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI    AN++L+K NQIG++SETL  ++ A  AG+ +++
Sbjct: 304 GDKIQLVGDDLFVTNPERLAEGIKRGSANSMLVKVNQIGTLSETLQAVDMAHRAGFTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEESLG  A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEESLGVTAEYAGRSIL 423


>gi|115524614|ref|YP_781525.1| phosphopyruvate hydratase [Rhodopseudomonas palustris BisA53]
 gi|122296142|sp|Q07ND9|ENO_RHOP5 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|115518561|gb|ABJ06545.1| enolase [Rhodopseudomonas palustris BisA53]
          Length = 427

 Score =  575 bits (1482), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 276/420 (65%), Positives = 339/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVEVDVVLEDGAVGRAAVPSGASTGAHEAVELRDGDKGRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  +N E+  AL G DA  Q+ ID++MI LDGTPNK+RLGANAILG+SLAV+KAAA
Sbjct: 64  VQKAVEAINGELFDALGGMDAESQVQIDEVMIALDGTPNKARLGANAILGISLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           ++ ++PLY+Y+GG SA +LPVP+MNI+NGG+HADN +DFQEFMIMPVGA++  EA+R GA
Sbjct: 124 ESYDMPLYRYVGGTSARMLPVPMMNIINGGMHADNPIDFQEFMIMPVGADSFSEALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLK ELK  G++TNVGDEGGF+PNL +AD+ALD +  +I KAGY  G+D+++ALDC
Sbjct: 184 EIFHTLKSELKKAGHNTNVGDEGGFAPNLPSADAALDFVMAAITKAGYKPGEDVMLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y+  GEN     +E A YLA+L  +YPI SIEDGMSEDD  GWK LT+ +
Sbjct: 244 AATEFFKDGAYVYGGENKTRSVSEQAKYLADLAARYPIVSIEDGMSEDDMDGWKELTDIV 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS CQLVGDDLFVTN  RL  GI    AN+ILIK NQIG+++ETL  +E A  AGY +++
Sbjct: 304 GSKCQLVGDDLFVTNVTRLADGIKNGRANSILIKVNQIGTLTETLAAVEMAHKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLAR+DR +KYNQL+RIE+ LG QA +AG++ L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARADRTSKYNQLLRIEQELGSQALYAGKAAL 423


>gi|84515610|ref|ZP_01002972.1| enolase [Loktanella vestfoldensis SKA53]
 gi|84510893|gb|EAQ07348.1| enolase [Loktanella vestfoldensis SKA53]
          Length = 424

 Score =  575 bits (1481), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 277/420 (65%), Positives = 337/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAHEAVERRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI  A+LG DA +Q+ ID  MI+LDGTPNKSRLGANAILGVS+AV+KAAA
Sbjct: 64  VLEAVAAVNGEIAEAILGFDATEQVGIDMSMIELDGTPNKSRLGANAILGVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             ++ PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A NIREA+RMG+
Sbjct: 124 DFTSQPLYRYIGGTSARMLPVPMMNIINGGEHADNPIDIQEFMIMPVAASNIREAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G+ST++GDEGGF+P + +   ALD I  +IEKAGY  G D+ +ALDC
Sbjct: 184 EVFHTLKKELSAAGFSTSIGDEGGFAPAIGSTREALDFIMKAIEKAGYAPGADIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ ++K  KY + GE   L   + A+YLA L   YPI SIEDGM+EDDW GWK+LT+ I
Sbjct: 244 AATEYYKGGKYEMAGEGASLSSEQNATYLAKLAADYPIISIEDGMAEDDWDGWKLLTDMI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL +GI    AN++L+K NQIG+++ETL  ++ A  A Y +++
Sbjct: 304 GDKVQLVGDDLFVTNPARLAEGIKRGCANSMLVKVNQIGTLTETLQAVDMAHRARYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE+LG+ A +AGRSIL
Sbjct: 364 SHRSGETEDVTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEALGETATYAGRSIL 423


>gi|77463052|ref|YP_352556.1| phosphopyruvate hydratase [Rhodobacter sphaeroides 2.4.1]
 gi|126461927|ref|YP_001043041.1| phosphopyruvate hydratase [Rhodobacter sphaeroides ATCC 17029]
 gi|221638910|ref|YP_002525172.1| phosphopyruvate hydratase [Rhodobacter sphaeroides KD131]
 gi|332557928|ref|ZP_08412250.1| enolase [Rhodobacter sphaeroides WS8N]
 gi|119369384|sp|Q3J3H9|ENO_RHOS4 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|166232224|sp|A3PIV3|ENO_RHOS1 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|254783265|sp|B9KQU4|ENO_RHOSK RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|77387470|gb|ABA78655.1| enolase [Rhodobacter sphaeroides 2.4.1]
 gi|126103591|gb|ABN76269.1| enolase [Rhodobacter sphaeroides ATCC 17029]
 gi|221159691|gb|ACM00671.1| Enolase [Rhodobacter sphaeroides KD131]
 gi|332275640|gb|EGJ20955.1| enolase [Rhodobacter sphaeroides WS8N]
          Length = 425

 Score =  574 bits (1480), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 277/420 (65%), Positives = 340/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LE G+ GRA VPSGASTG HEA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVTLESGAFGRAAVPSGASTGAHEAVEKRDGDKSRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   L+G DA +Q+ ID+ MI++DGTPNK RLGANAILGVSLAV+KAAA
Sbjct: 64  VLEAVAAVNGEIAEMLVGFDATEQVGIDRTMIEMDGTPNKGRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + +N PL++Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A+N+REAIRMG+
Sbjct: 124 EFTNQPLFRYVGGSSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAAQNVREAIRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G++T +GDEGGF+PN+ +   ALD I  SIEKAGY  G+D+ +ALDC
Sbjct: 184 EVFHTLKKELAAGGFNTGIGDEGGFAPNISSTREALDYILRSIEKAGYKPGEDIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ +FK  KY +KGE   L   E   YLA L   YPI SIEDG +EDDW GWK+LT+K+
Sbjct: 244 ASTEYFKGGKYEMKGEGKSLTSAENVDYLAALCADYPIISIEDGCAEDDWEGWKLLTDKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTNP+RL +GI   VAN++L+K NQIGS++ETL  ++ A  A Y +++
Sbjct: 304 GAKVQLVGDDLFVTNPKRLEQGIKAGVANSMLVKVNQIGSLTETLMAVDMAHRARYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG+ A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEMLGEVAEYAGRSIL 423


>gi|110633984|ref|YP_674192.1| enolase [Mesorhizobium sp. BNC1]
 gi|119369344|sp|Q11HU8|ENO_MESSB RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|110284968|gb|ABG63027.1| enolase [Chelativorans sp. BNC1]
          Length = 424

 Score =  574 bits (1480), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 280/419 (66%), Positives = 335/419 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI+ RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IVDIVGREILDSRGNPTVEVDVVLEDGSIGRAAVPSGASTGAHEAVELRDGGPRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            +A+  VN EI  A+ G +A DQ+ ID+ MI+LDGTPNKSRLGANAILGVSLAV+KA A 
Sbjct: 64  ARAVEAVNGEIFEAIGGLEAEDQIHIDRTMIELDGTPNKSRLGANAILGVSLAVAKATAA 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG SAHILPVP+MNILNGG HADN +DFQEFMIMPVGA  +R+A+R G+E
Sbjct: 124 ASGLPLYRYVGGASAHILPVPMMNILNGGAHADNPIDFQEFMIMPVGAPTLRDAVRWGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           +FHTLK  LK+ G++TNVGDEGGF+PNLK A++ALD I  SIEKAG+  G ++ IALDCA
Sbjct: 184 IFHTLKSGLKAAGHNTNVGDEGGFAPNLKDANAALDFIMASIEKAGFKPGDEVAIALDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ FFK  KY+ +GE         A YL+ L  +YPI SIEDGM+EDD+ GWK LT+  G
Sbjct: 244 ATEFFKDGKYVYEGEGQTRDAQAQAEYLSKLAGEYPIISIEDGMAEDDFEGWKALTDLAG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           S  QLVGDDLFVTN  RL  GIN  +AN+IL+K NQIGS++ETL  +E A  A Y +++S
Sbjct: 304 SKVQLVGDDLFVTNAARLKDGINMGIANSILVKVNQIGSLTETLEAVETAHKAAYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG+ A++AGR+++
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEQLGRAARYAGRTVV 422


>gi|13470615|ref|NP_102184.1| phosphopyruvate hydratase [Mesorhizobium loti MAFF303099]
 gi|21263602|sp|Q98MZ3|ENO_RHILO RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|14021357|dbj|BAB47970.1| enolase [Mesorhizobium loti MAFF303099]
          Length = 424

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 336/419 (80%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI+ RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIVGREILDSRGNPTVEVDVVLEDGSMGRAAVPSGASTGAHEAVELRDGGARYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
           LKA+  VN E+  A+ G +A +Q+ ID+ MI+LDGTPNKSRLGANAILGVSLAV+KAAA 
Sbjct: 64  LKAVEAVNGELFEAIGGMEAENQIHIDQTMIELDGTPNKSRLGANAILGVSLAVAKAAAD 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            + LPLY+Y+GG  AHILPVP+MNI+NGG HADN +DFQEFMI+PVGA  +RE +R G+E
Sbjct: 124 AAGLPLYRYVGGTKAHILPVPMMNIINGGAHADNPIDFQEFMILPVGAPTLREGVRWGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           +FHTL+K+LK  G++TNVGDEGGF+PNLK+A  ALD I  SIEKAG+  G+++ + LDCA
Sbjct: 184 IFHTLRKKLKDAGHNTNVGDEGGFAPNLKSAPVALDFIMESIEKAGFKPGEEIALGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ FFK   Y+ +GE     P   A YLA L   YPI SIEDG++EDDW GWK LT+ IG
Sbjct: 244 ATEFFKDGNYVYEGEKKTRDPKAQAKYLAKLAADYPIVSIEDGLAEDDWEGWKYLTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS++ETL+ +E A  AGY +++S
Sbjct: 304 KKTQLVGDDLFVTNTARLRDGIRMGVANSILVKVNQIGSLTETLDAVETAHKAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LGKQA++AG+S++
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLSRSDRMAKYNQLIRIEEELGKQARYAGKSVI 422


>gi|254465559|ref|ZP_05078970.1| phosphopyruvate hydratase [Rhodobacterales bacterium Y4I]
 gi|206686467|gb|EDZ46949.1| phosphopyruvate hydratase [Rhodobacterales bacterium Y4I]
          Length = 424

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 276/420 (65%), Positives = 337/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAYEAVEKRDGDKSRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   L+G DA +Q+ +D+ MI+LDGT NK RLGANAILGVS+AV+KAAA
Sbjct: 64  VLEAVAAVNGEIAEELVGFDATEQVAVDQAMIELDGTENKGRLGANAILGVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV AENIR+A+RMG+
Sbjct: 124 DFTTQPLYRYIGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAAENIRDAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+PN+ +   ALD +  SIEKAGY  G+++ +ALDC
Sbjct: 184 EVFHTLKKELSAAGLSTGIGDEGGFAPNIASTREALDFVLKSIEKAGYKPGEEIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ ++K  KY+L GE   L   E  +YLA LV  YPI SIEDGMSEDDW GWK LT+++
Sbjct: 244 AATEYYKDGKYVLSGEGKTLSSEENVAYLAALVKDYPIISIEDGMSEDDWDGWKALTDEL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL +GI    AN++L+K NQIGS++ETL  ++ A  A Y +++
Sbjct: 304 GGKVQLVGDDLFVTNPARLAEGIERGCANSMLVKVNQIGSLTETLKAVDMAHRARYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE+LG+ A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEALGEVAEYAGRSIL 423


>gi|316933966|ref|YP_004108948.1| enolase [Rhodopseudomonas palustris DX-1]
 gi|315601680|gb|ADU44215.1| enolase [Rhodopseudomonas palustris DX-1]
          Length = 427

 Score =  573 bits (1477), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 277/420 (65%), Positives = 335/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVEVDVVLEDGSVGRAAVPSGASTGAHEAVELRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN E+  AL G DA  Q+ ID+ MI+LDGTPNK R+GANAILGVSLAV+KAAA
Sbjct: 64  VLKAVEAVNGELFDALGGMDAEQQVQIDQTMIELDGTPNKGRIGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + +LPLY+Y+GG SA  LPVP+MNI+NGG HADN +DFQEFMIMPVGA +  EA+R G+
Sbjct: 124 SSYDLPLYRYVGGTSARTLPVPMMNIINGGAHADNPIDFQEFMIMPVGAPSFAEALRYGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLK ELK  G++TNVGDEGGF+PNL +AD+ALD + ++I KAG+ AG+D++IALD 
Sbjct: 184 EIFHTLKGELKKAGHNTNVGDEGGFAPNLPSADAALDFVLSAIGKAGFKAGEDVMIALDP 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY+ + E   L P E A YLA+LV +YPI SIEDGM+EDD  GWK +T+ I
Sbjct: 244 ASTEFFKDGKYVYEAEGRSLGPQEQAKYLADLVSRYPIVSIEDGMAEDDMEGWKAITDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN  RL  GI    AN+ILIK NQIG+++ETL  +E A  AGY +++
Sbjct: 304 GDKCQLVGDDLFVTNVSRLADGIKAGRANSILIKVNQIGTLTETLAAVEMAHKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLAR+DR +KYNQL+RIE+ LG  A F G++ L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARADRTSKYNQLLRIEQELGTSAYFPGKAAL 423


>gi|240850258|ref|YP_002971651.1| enolase [Bartonella grahamii as4aup]
 gi|240267381|gb|ACS50969.1| enolase [Bartonella grahamii as4aup]
          Length = 423

 Score =  573 bits (1477), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 280/416 (67%), Positives = 324/416 (77%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKG 61
            I DII REV+DSRG+PT+EVDV LE+G+ GRA+VPSGASTG HEA ELRD   RY GKG
Sbjct: 3   IIVDIIGREVLDSRGNPTVEVDVHLENGAFGRALVPSGASTGAHEAIELRDGGLRYQGKG 62

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KAIA VN EI   L G DA +Q+ ID+ MI LDGTPNK+RLGANA+LGVSLAV+KAAA
Sbjct: 63  VEKAIAAVNGEILEELGGRDATNQIAIDQAMIALDGTPNKARLGANALLGVSLAVAKAAA 122

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + NLPLY+Y+GG  AHILP P+MNI+NGG+HADN +DFQEFMI+P+GA  +REAIR GA
Sbjct: 123 DSLNLPLYRYIGGTQAHILPTPMMNIINGGVHADNLIDFQEFMIIPIGAPTVREAIRYGA 182

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK LK  GY+TNVGDEGGF+P  K+AD A+D I  SI   GY  G+ + I LDC
Sbjct: 183 EIFHALKKRLKDAGYNTNVGDEGGFAPQFKSADQAIDFIMESITTCGYKLGEQIAIGLDC 242

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ F+K   Y  KGE       E   YLA LV  YPI +IEDGM+EDDW GWK+LT+ I
Sbjct: 243 ASTEFYKNGSYFYKGEGKCRDIQEQVDYLAQLVKNYPIITIEDGMAEDDWEGWKLLTDTI 302

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN  RL  GI   V N+ILIK NQIG++SETLN +E A  AGY +II
Sbjct: 303 GGKCQLVGDDLFVTNSARLRDGIKMGVGNSILIKVNQIGTLSETLNAVEVAHKAGYRAII 362

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED  IADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA++AG
Sbjct: 363 SHRSGETEDSFIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGAQARYAG 418


>gi|126725362|ref|ZP_01741204.1| enolase [Rhodobacterales bacterium HTCC2150]
 gi|126704566|gb|EBA03657.1| enolase [Rhodobacterales bacterium HTCC2150]
          Length = 424

 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 280/420 (66%), Positives = 331/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +  RY GKG
Sbjct: 4   IIDIFAREILDSRGNPTVEVDVTLEDGTMGRAAVPSGASTGAYEAVEKRDGDMARYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VN EI  ALLG DA DQ  ID +MI+LDGT NK++LGANAILGVS+A++KAAA
Sbjct: 64  VLEAVEAVNGEIAEALLGMDATDQTGIDNLMIELDGTANKAKLGANAILGVSMALAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             ++ PLY+Y+GG SAH+LPVP+MNI+NGG HADN +D QEFMIMPV A+NIREA+RMGA
Sbjct: 124 DFTSQPLYRYVGGTSAHVLPVPMMNIINGGEHADNPIDIQEFMIMPVAADNIREAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL   G ST +GDEGGF+PNL +   ALD I  SI+KAGY  G+D+ +ALDC
Sbjct: 184 EVFHTLKKELSDAGLSTGIGDEGGFAPNLSSTRDALDFILKSIKKAGYTPGEDIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS +F    Y  KGE+  L P E   YLA LVD YPI SIEDG  EDDW GWK+LT+KI
Sbjct: 244 AASEYFSDGNYHFKGEDKVLTPAENVDYLAALVDDYPIISIEDGCDEDDWDGWKMLTDKI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL  GI+   AN++L+K NQIG+++ETL  ++ A       ++
Sbjct: 304 GDKIQLVGDDLFVTNPERLQMGIDMGAANSLLVKVNQIGTLTETLQAVDNAHRNRMTCVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG+ A +AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGETAVYAGRSIL 423


>gi|296284025|ref|ZP_06862023.1| phosphopyruvate hydratase [Citromicrobium bathyomarinum JL354]
          Length = 428

 Score =  572 bits (1475), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 281/420 (66%), Positives = 333/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ ARE++DSRG+PT+EVD  LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IIDLHAREILDSRGNPTVEVDCLLEDGSFGRAAVPSGASTGAHEAVELRDGDKDRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KAI  VN++I  ALLG DA DQ  ID ++I LDGT NKSRLGANA+LG SLAV+KA A
Sbjct: 64  VTKAIDAVNNDIADALLGVDAEDQRDIDTMLIALDGTENKSRLGANALLGTSLAVAKAGA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY Y+GG SAH+LPVP+MNI+NGG HADN +D QEFMIMPVGA  + EA+R GA
Sbjct: 124 NARGLPLYSYVGGVSAHVLPVPMMNIINGGEHADNPIDIQEFMIMPVGAPTLAEAVRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL +KG ST+VGDEGGF+PN+ +   ALDLI  SIEKAG+  G D+++ALDC
Sbjct: 184 EVFHTLKKELSAKGLSTSVGDEGGFAPNIGSTRDALDLIMQSIEKAGFAPGSDIVLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY+L GE+  L   EMA YLA L + YPI SIEDGM+EDD+ GWK LT+KI
Sbjct: 244 ASTEFFKDGKYVLAGEDATLSGVEMADYLAALCNDYPIRSIEDGMAEDDFEGWKALTDKI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTNP RL  GI   +AN++L+K NQIG++SETL+ ++ A  AGY +++
Sbjct: 304 GNKVQLVGDDLFVTNPARLRDGIARGLANSLLVKVNQIGTLSETLDAVDIAHRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A +AG +  
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGDSAHYAGHACF 423


>gi|114707413|ref|ZP_01440309.1| probable enolase protein [Fulvimarina pelagi HTCC2506]
 gi|114536972|gb|EAU40100.1| probable enolase protein [Fulvimarina pelagi HTCC2506]
          Length = 426

 Score =  572 bits (1475), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 280/419 (66%), Positives = 333/419 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG +EA ELRD ++RY GKGV
Sbjct: 4   IIDIIGREILDSRGNPTVEVDVVLEDGSMGRAAVPSGASTGAYEAVELRDADERYMGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN+EI   ++G +A DQL++D  + DLDGT NKSR+GANAILGVSLA++KAAA+
Sbjct: 64  QKAVYAVNNEIAEEIVGMEAEDQLMVDAALSDLDGTDNKSRIGANAILGVSLAIAKAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
           ++ LPLY+Y+GG SAH+LPVP+MNI+NGG HADN +DFQEFMIMPVGAE   +A+RMGAE
Sbjct: 124 SAGLPLYRYVGGPSAHVLPVPMMNIINGGAHADNPIDFQEFMIMPVGAERFSDALRMGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
            FH LKK LK  G++TNVGDEGGF+P+L +   ALD I  ++EKAGY AG D+ IALDCA
Sbjct: 184 TFHVLKKMLKDAGHNTNVGDEGGFAPSLGSPKEALDFIMKAVEKAGYKAGDDMFIALDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ FFK   Y L GE  +L  ++M  YL  L D YPI SIEDG+ EDDW GW  LT  IG
Sbjct: 244 ATEFFKDGTYDLAGEGRKLSSDDMGGYLKELSDAYPIISIEDGLDEDDWDGWTKLTKTIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           S  QLVGDDLFVTN  RL KGI    AN+IL+K NQIGS+SETL+ +  A  AGY +++S
Sbjct: 304 SKVQLVGDDLFVTNSRRLKKGIEMGAANSILVKVNQIGSLSETLDAVSVAHRAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQL+RIEE LG QA +AGRSIL
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLARSDRVAKYNQLLRIEEELGSQADYAGRSIL 422


>gi|260459504|ref|ZP_05807759.1| enolase [Mesorhizobium opportunistum WSM2075]
 gi|259035058|gb|EEW36314.1| enolase [Mesorhizobium opportunistum WSM2075]
          Length = 424

 Score =  572 bits (1474), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 277/419 (66%), Positives = 336/419 (80%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI+ RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIVGREILDSRGNPTVEVDVVLEDGSMGRAAVPSGASTGAHEAVELRDGGARYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
           LKA+  VN E+  A+ G +A +Q+ ID+ MI+LDGTPNKSRLGANAILGVSLAV+KAAA 
Sbjct: 64  LKAVEAVNGELFEAIGGMEAENQIHIDQTMIELDGTPNKSRLGANAILGVSLAVAKAAAD 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            + LPLY+Y+GG  AHILPVP+MNI+NGG HADN +DFQEFMI+P+GA  +RE +R G+E
Sbjct: 124 AAGLPLYRYVGGTKAHILPVPMMNIINGGAHADNPIDFQEFMILPIGAPTLREGVRWGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           +FHTL+K+LK  G++TNVGDEGGF+PNLK+A  ALD I  SIEKAG+  G+++ + LDCA
Sbjct: 184 IFHTLRKKLKDAGHNTNVGDEGGFAPNLKSAPVALDFIMESIEKAGFKPGEEIALGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ FFK   Y+ +GE     P   A YLA L   YPI SIEDG++EDDW GWK LT+ IG
Sbjct: 244 ATEFFKDGNYVYEGEKKTRDPKAQAKYLAKLAADYPIISIEDGLAEDDWEGWKYLTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS++ETL+ +E A  AGY +++S
Sbjct: 304 KKTQLVGDDLFVTNTARLRDGIRMGVANSILVKVNQIGSLTETLDAVETAHKAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LGKQA++AG+S++
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLSRSDRMAKYNQLIRIEEELGKQARYAGKSVI 422


>gi|332185164|ref|ZP_08386913.1| phosphopyruvate hydratase [Sphingomonas sp. S17]
 gi|332014888|gb|EGI56944.1| phosphopyruvate hydratase [Sphingomonas sp. S17]
          Length = 426

 Score =  571 bits (1472), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 285/422 (67%), Positives = 333/422 (78%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI AR+++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA E RD +K R+ GKG
Sbjct: 4   IIDIHARQILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAVEKRDGDKSRWMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V  A+  VNDEI  A+LG DA DQ  +D+ MI+LDGT NK RLGANAILGVSLA +KAAA
Sbjct: 64  VEAAVEAVNDEITDAILGMDAEDQADLDRAMIELDGTENKGRLGANAILGVSLAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLYKY+GG SAH+LPVP+MNI+NGG HADN +DFQEFMIMPVGA NI EA+R G+
Sbjct: 124 EARGLPLYKYVGGVSAHLLPVPMMNIINGGEHADNPIDFQEFMIMPVGAANIMEAVRCGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKK L  KG +T VGDEGGF+PN+ +   ALD I  S+EKAGY  G D++IALDC
Sbjct: 184 EIFHTLKKALHEKGLATGVGDEGGFAPNIASTTEALDFIMASVEKAGYKPGGDVMIALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK  KY + GE   L   EMA YLANL  QYPI SIEDGM+EDDW GWK LT+ I
Sbjct: 244 AATEFFKDGKYNISGEGKILSSQEMAEYLANLTRQYPILSIEDGMAEDDWEGWKALTDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+RL KGI    AN++L+K NQIG+++ETL  +  AQ + Y +++
Sbjct: 304 GDKVQLVGDDLFVTNPKRLKKGIEGGYANSLLVKVNQIGTLTETLEAVSLAQRSRYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A++AGR IL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGDSARYAGRDIL 423

Query: 422 IH 423
           I 
Sbjct: 424 IR 425


>gi|158424685|ref|YP_001525977.1| phosphopyruvate hydratase [Azorhizobium caulinodans ORS 571]
 gi|172047990|sp|A8IBF3|ENO_AZOC5 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|158331574|dbj|BAF89059.1| enolase [Azorhizobium caulinodans ORS 571]
          Length = 427

 Score =  570 bits (1470), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 275/420 (65%), Positives = 332/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ RE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA ELRD +  RY GKG
Sbjct: 4   IVDIVGREILDSRGNPTVEVDVLLEDGALGRAAVPSGASTGAHEAVELRDGDTGRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN EI  A+ G DA +Q  ID +MI+LDGTPNK+RLGANAILGVSLAV+KAAA
Sbjct: 64  VEKAVEAVNGEIFDAIGGLDAEEQAQIDAVMIELDGTPNKARLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            ++NLPLY+Y+GG +A  LPVP+MNI+NGG HADN +DFQEFMI+P GA    E +R GA
Sbjct: 124 ISNNLPLYRYVGGVNARTLPVPMMNIINGGAHADNPIDFQEFMILPAGAPTFAEGLRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKK LK  G++TNVGDEGGF+PNL +A++ALD +  +IEKAG+  G+D+ + LDC
Sbjct: 184 EIFHTLKKGLKDAGHNTNVGDEGGFAPNLASAEAALDFVLKAIEKAGFKPGEDVFLGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y  +GE      +    YLA LV  YPI +IEDGMSEDDW GWK LT+ I
Sbjct: 244 AATEFFKDGAYHYEGEGKVRDIDAQVKYLAQLVGNYPIVTIEDGMSEDDWAGWKQLTDAI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+ CQLVGDDLFVTN ERL +GI E   NAIL+K NQIGS++ETL T+E A  +GY +++
Sbjct: 304 GAKCQLVGDDLFVTNVERLGRGIKEATGNAILVKVNQIGSLTETLETVELAHKSGYRAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQL+RIE+ LG QAK+AG++ L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLLRIEQELGAQAKYAGKAAL 423


>gi|260428531|ref|ZP_05782510.1| phosphopyruvate hydratase [Citreicella sp. SE45]
 gi|260423023|gb|EEX16274.1| phosphopyruvate hydratase [Citreicella sp. SE45]
          Length = 424

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 281/420 (66%), Positives = 330/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG+HEA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVTLEDGSMGRAAVPSGASTGVHEAHERRDGDKDRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI  AL+G DA +Q  ID  MI+LDGT NK RLGANAILGVSLA +KAAA
Sbjct: 64  VLEAVAAVNGEIAEALVGFDATEQEAIDGAMIELDGTDNKGRLGANAILGVSLATAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +    PLY+Y+GG +A +LPVP+MNI+NGG HADN +D QEFMIMPV AENIREA+RMG+
Sbjct: 124 EYCGQPLYRYVGGTAARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAAENIREAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+P L +   ALD I  SIEKAGY  G D+++ALD 
Sbjct: 184 EVFHTLKKELSAAGMSTGLGDEGGFAPELASTRDALDFILKSIEKAGYTPGDDIMLALDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ +FK  KY +KGE L L   E  +YL  L   YPI SIEDG +EDDW GWKILT+ +
Sbjct: 244 ASTEYFKDGKYEMKGEGLSLTSAENVAYLEKLCADYPILSIEDGCAEDDWEGWKILTDTL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI + VAN++L+K NQIGS+SETL  ++ A  A Y +++
Sbjct: 304 GDKVQLVGDDLFVTNPARLSMGIEQGVANSMLVKVNQIGSLSETLKAVDMAHRARYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A FAG+SIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGDVAVFAGKSIL 423


>gi|254510680|ref|ZP_05122747.1| phosphopyruvate hydratase [Rhodobacteraceae bacterium KLH11]
 gi|221534391|gb|EEE37379.1| phosphopyruvate hydratase [Rhodobacteraceae bacterium KLH11]
          Length = 438

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 277/420 (65%), Positives = 334/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 17  IIDIHAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAYEAVEKRDGDKARYLGKG 76

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   L+G DA +Q+ ID+ MI+LDGT NK RLGANAILGVSLA +KAAA
Sbjct: 77  VLEAVAAVNGEIAEELMGFDATEQVAIDQAMIELDGTENKGRLGANAILGVSLATAKAAA 136

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMP  A NIREA+RMG+
Sbjct: 137 DFTTQPLYRYVGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPTAAANIREAVRMGS 196

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G +T VGDEGGF+PN+ +   ALD I  SIEKAGY  G+++ +ALDC
Sbjct: 197 EVFHTLKKELSAAGLATGVGDEGGFAPNIASTREALDFILKSIEKAGYKPGEEIHLALDC 256

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ ++K  KY+L GE   L  +E A+YL+ LV+ YPI SIEDGMSEDDW GWK LT+ I
Sbjct: 257 AATEYYKDGKYVLAGEGTTLTSDENAAYLSALVNDYPIISIEDGMSEDDWDGWKALTDAI 316

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI    AN++L+K NQIGS++ETL  ++ A  A Y +++
Sbjct: 317 GDKVQLVGDDLFVTNPARLADGIARGCANSMLVKVNQIGSLTETLRAVDMAHRARYTNVM 376

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE+LG+ A++AG SIL
Sbjct: 377 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEETLGEVAEYAGASIL 436


>gi|149914627|ref|ZP_01903157.1| enolase [Roseobacter sp. AzwK-3b]
 gi|149811420|gb|EDM71255.1| enolase [Roseobacter sp. AzwK-3b]
          Length = 424

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 281/421 (66%), Positives = 332/421 (78%), Gaps = 1/421 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD +  RY GK
Sbjct: 3   IIIDIHAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAHEAVERRDGDSARYMGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVL+A A VN EI   L+G DA +Q+ ID  MI++DGTPNK+RLGANAILGVSLAV+KAA
Sbjct: 63  GVLEACAAVNGEIAEELVGMDATEQVGIDLTMIEMDGTPNKARLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A  ++ PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A NIR+A+RMG
Sbjct: 123 ADFTSQPLYRYVGGTSARMLPVPMMNIINGGEHADNPIDIQEFMIMPVSAGNIRDAVRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFHTLKKEL +KG ST +GDEGGF+P L +   ALDLI  SIEKAGY  G+D+ +ALD
Sbjct: 183 AEVFHTLKKELTAKGLSTGLGDEGGFAPELGSTREALDLILASIEKAGYTPGEDIHLALD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           CAA+ +FK  KY   GE L L   E   YL  L   YPI SIEDGMSEDDW GWK+LT+ 
Sbjct: 243 CAATEYFKNGKYEFSGEGLSLSSAENVEYLKALCADYPIISIEDGMSEDDWDGWKMLTDA 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG   QLVGDDLFVTNP RL +GI+   AN++L+K NQIG+++ETL  ++ A  A   ++
Sbjct: 303 IGDKVQLVGDDLFVTNPARLAEGISRGAANSMLVKVNQIGTLTETLRAVDMAHRARMTNV 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           +SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEESLG  A++AGRSI
Sbjct: 363 MSHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEESLGDTAEYAGRSI 422

Query: 421 L 421
           L
Sbjct: 423 L 423


>gi|126735677|ref|ZP_01751422.1| Phosphopyruvate hydratase [Roseobacter sp. CCS2]
 gi|126714864|gb|EBA11730.1| Phosphopyruvate hydratase [Roseobacter sp. CCS2]
          Length = 425

 Score =  569 bits (1466), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 276/420 (65%), Positives = 335/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAHEAVEKRDGDKGRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI  A+LG DA +Q+ ID  MI+LDGT NK RLGANAILGVS+AV+KAAA
Sbjct: 64  VLEAVAAVNGEIAEAILGFDATEQVAIDMAMIELDGTHNKGRLGANAILGVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PL++Y+GG SA  LPVP+MNI+NGG HADN +D QEFMIMPV A+NIREA+RMG+
Sbjct: 124 DFTAQPLFRYIGGTSARTLPVPMMNIINGGEHADNPIDIQEFMIMPVSADNIREAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G++T +GDEGGF+PNL +   ALD I  SI+KAGY  GKD+ +ALDC
Sbjct: 184 EVFHTLKKELSAAGHNTGIGDEGGFAPNLASTRDALDFIMTSIKKAGYAPGKDIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ ++K  KY + GE + L   E A+YLA L + YPI SIEDGMSEDDW GWK LT+ I
Sbjct: 244 AATEYYKNGKYEMAGEGVSLTSEENAAYLAKLAEDYPIISIEDGMSEDDWDGWKALTDMI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI +  AN++L+K NQIG+++ETL  ++ A  A + +++
Sbjct: 304 GDKVQLVGDDLFVTNPTRLADGIAKGSANSMLVKVNQIGTLTETLQAVDMAHRAQFTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG+ A +AGRS+L
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEELLGETAVYAGRSVL 423


>gi|182678446|ref|YP_001832592.1| phosphopyruvate hydratase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|238691246|sp|B2IKR4|ENO_BEII9 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|182634329|gb|ACB95103.1| Phosphopyruvate hydratase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 427

 Score =  569 bits (1466), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 278/420 (66%), Positives = 342/420 (81%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PTIEVDV LEDGS GRA VPSGASTG HEA ELRD +K R+ GKG
Sbjct: 4   IVDIAAREILDSRGNPTIEVDVTLEDGSQGRAAVPSGASTGAHEAVELRDGDKSRFGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  V+ +I  AL G DA DQ+ ID++M++LDGTPNK RLGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVENVDRDIFDALSGLDAEDQVHIDQVMLELDGTPNKGRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPLY+Y+GG  A +LPVP+MNI+NGG HADN +DFQEFMI+PVGA N++EA+R GA
Sbjct: 124 EASSLPLYRYVGGVQARVLPVPMMNIINGGAHADNPIDFQEFMILPVGAPNLKEAVRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LK  LK  G++TNVGDEGGF+PNL +A+++L+ I  +I  AG+  G+D+ + LDC
Sbjct: 184 EVFHVLKGALKKAGHNTNVGDEGGFAPNLPSAEASLEFIVKAITDAGFKPGEDIYLGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY+ +GE       E A+YL  LV+ +PI +IEDGMSEDDW GWKILT+ I
Sbjct: 244 ASTEFFKDGKYVYEGEGKTRNLEEQAAYLGKLVESFPIVTIEDGMSEDDWEGWKILTDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN  RL +GI++ +AN+IL+K NQIGS++ETL  ++ AQ AGY +++
Sbjct: 304 GKKCQLVGDDLFVTNVSRLSQGISKGIANSILVKVNQIGSLTETLAAVDMAQRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA +AGR+ L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGSQAVYAGRAAL 423


>gi|84684859|ref|ZP_01012759.1| enolase [Maritimibacter alkaliphilus HTCC2654]
 gi|84667194|gb|EAQ13664.1| enolase [Rhodobacterales bacterium HTCC2654]
          Length = 424

 Score =  569 bits (1466), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 282/421 (66%), Positives = 337/421 (80%), Gaps = 1/421 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD +K RY GK
Sbjct: 3   IIIDIFAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAHEAVEKRDGDKSRYMGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVL+A+  VN EI   L G DA +Q ++D+ MI+LDGTPNK+RLGANAILGVSLA ++AA
Sbjct: 63  GVLEAVNAVNGEIAEELAGMDATEQEMLDRAMIELDGTPNKARLGANAILGVSLAAARAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A  S LPLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A NIR+A+RMG
Sbjct: 123 ADFSMLPLYRYVGGSSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVSAGNIRDAVRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           +EVFHTLKKEL + G ST +GDEGGF+P L + + ALD I  SIEKAGY  G+D+ +ALD
Sbjct: 183 SEVFHTLKKELSAAGLSTGLGDEGGFAPALGSTNEALDFILKSIEKAGYKPGEDIYLALD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           CA++ ++K  KY + GE   L   E A YLA L D YPI SIEDGMSEDDW GWK+LT+K
Sbjct: 243 CASTEYYKNGKYEMVGEGKSLTSEENADYLAALCDAYPIISIEDGMSEDDWDGWKLLTDK 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG   QLVGDDLFVTNP RL  GI + VAN++L+K NQIGS+SETL  ++ A  A Y ++
Sbjct: 303 IGDKVQLVGDDLFVTNPARLADGIKKGVANSMLVKVNQIGSLSETLKAVDMAHRARYTNV 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           +SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE+LG+ A++AGRSI
Sbjct: 363 MSHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEALGETAEYAGRSI 422

Query: 421 L 421
           L
Sbjct: 423 L 423


>gi|146276978|ref|YP_001167137.1| phosphopyruvate hydratase [Rhodobacter sphaeroides ATCC 17025]
 gi|166232225|sp|A4WR18|ENO_RHOS5 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|145555219|gb|ABP69832.1| enolase [Rhodobacter sphaeroides ATCC 17025]
          Length = 425

 Score =  569 bits (1466), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 274/420 (65%), Positives = 338/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DI ARE++DSRG+PT+EVDV LE G+ GRA VPSGASTG HEA E RD +  RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVTLESGAFGRAAVPSGASTGAHEAVEKRDGDTSRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   L+G DA DQ+ ID+ MI++DGTPNK RLGANAILGVSLAV+KAAA
Sbjct: 64  VLEAVAAVNGEIAEMLVGFDATDQVGIDRTMIEMDGTPNKGRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + +N PL++Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A+N+R+AIRMG+
Sbjct: 124 EFTNQPLFRYVGGASARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAAKNVRDAIRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G++T +GDEGGF+PN+ +   ALD I  SIEKAGY  G+D+ +ALDC
Sbjct: 184 EVFHTLKKELAAGGFNTGIGDEGGFAPNISSTRQALDYILRSIEKAGYKPGEDIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ +FK  KY +KGE   L   E   YLA L   YPI SIEDG +EDDW GWK+LT+++
Sbjct: 244 ASTEYFKGGKYEMKGEGKSLTSAENVDYLAALCADYPIISIEDGCAEDDWDGWKLLTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTNP+RL +GI   V N++L+K NQIGS++ETL  ++ A  A Y +++
Sbjct: 304 GAKVQLVGDDLFVTNPKRLEQGIKAGVGNSMLVKVNQIGSLTETLMAVDMAHRARYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG+ A++AGRSIL
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEMLGEVAEYAGRSIL 423


>gi|114767117|ref|ZP_01445998.1| Enolase [Pelagibaca bermudensis HTCC2601]
 gi|114540720|gb|EAU43787.1| Enolase [Roseovarius sp. HTCC2601]
          Length = 424

 Score =  568 bits (1465), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 281/420 (66%), Positives = 330/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG+HEA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVMLEDGTLGRAAVPSGASTGVHEAHERRDGDKGRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+A VN EI  AL+G DA +Q  ID  MI+LDGT NK RLGANAILGVSLA +KAAA
Sbjct: 64  VLDAVAAVNGEIAEALVGFDATEQEAIDGAMIELDGTDNKGRLGANAILGVSLATAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + +  PLY+Y+GG +A +LPVP+MNI+NGG HADN +D QEFMIMPV AENIREA+RMG+
Sbjct: 124 EFTAQPLYRYVGGTAARVLPVPMMNIINGGEHADNPIDIQEFMIMPVSAENIREAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+P L     ALD I  SIEKAGY  G+D+ +ALD 
Sbjct: 184 EVFHTLKKELSAAGMSTGLGDEGGFAPELGGTREALDFILKSIEKAGYKPGEDIYLALDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ ++K  KY +KGE L L   E   YLA L   YPI SIEDG +EDDW GWK+LT K+
Sbjct: 244 ASTEYYKDGKYEMKGEGLSLSSAENVDYLAKLCADYPIISIEDGCAEDDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G + QLVGDDLFVTNP RL  GI + VAN++L+K NQIGS+SETL  +E A  A Y +++
Sbjct: 304 GDSVQLVGDDLFVTNPARLSMGIEQGVANSMLVKVNQIGSLSETLRAVEMAHRARYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A +AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGDTAIYAGRSIL 423


>gi|170747417|ref|YP_001753677.1| phosphopyruvate hydratase [Methylobacterium radiotolerans JCM 2831]
 gi|238688882|sp|B1LZU6|ENO_METRJ RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|170653939|gb|ACB22994.1| Phosphopyruvate hydratase [Methylobacterium radiotolerans JCM 2831]
          Length = 429

 Score =  568 bits (1464), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 280/420 (66%), Positives = 337/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I +I ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K R+ GKG
Sbjct: 4   ITNISAREILDSRGNPTVEVDVILEDGSFGRAAVPSGASTGAHEAVELRDGDKNRFLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+     EI  A+ G +A DQ+ +D+ MI+LDGTPNK+RLGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVEAAQTEILDAIGGMEAEDQVAVDEAMIELDGTPNKARLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y+GG    +LPVP+MNI+NGG HADN +DFQEFMIMPVGA+++ EA+RMG+
Sbjct: 124 EASGLPLYRYVGGVQGRVLPVPMMNIINGGAHADNPIDFQEFMIMPVGADSLAEAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLK +LK  G++TNVGDEGGF+PNL +A++ALD + ++I  AG+  G+D+ +ALDC
Sbjct: 184 EVFHTLKGKLKKAGHNTNVGDEGGFAPNLPSAEAALDFVMDAISAAGFKPGQDMALALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y  +GE           YLA LV  YPI SIEDGMSEDDW GWK+LT+KI
Sbjct: 244 AATEFFKDGAYAYEGEGKTRTIEAQVDYLAQLVATYPIVSIEDGMSEDDWAGWKLLTDKI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN ERL +GI E  AN+ILIK NQIGS++ETL  ++ AQ AGY +++
Sbjct: 304 GDRCQLVGDDLFVTNVERLSRGIAEGTANSILIKVNQIGSLTETLAAVDMAQRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA +AG S L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEGLGPQALYAGPSAL 423


>gi|319783386|ref|YP_004142862.1| enolase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169274|gb|ADV12812.1| enolase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 424

 Score =  568 bits (1464), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 275/419 (65%), Positives = 334/419 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI+ RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IVDIVGREILDSRGNPTVEVDVILEDGSMGRAAVPSGASTGAHEAVELRDGGARYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
           LKA+  VN E+  A+ G +A +Q+ ID+ MI+LDGTPNKSRLGANAILGVSLAV+KAAA 
Sbjct: 64  LKAVEAVNGELFEAIGGMEAENQIHIDQTMIELDGTPNKSRLGANAILGVSLAVAKAAAD 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            + LPLY+Y+GG  AH+LPVP+MNI+NGG HADN +DFQEFMI+P+GA  +RE +R G+E
Sbjct: 124 AAGLPLYRYVGGTKAHLLPVPMMNIINGGAHADNPIDFQEFMILPIGAPTLREGVRWGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           +FHTL+K+LK  G++TNVGDEGGF+PNLK+A  ALD I  SIE+AG+  G ++ + LDCA
Sbjct: 184 IFHTLRKKLKDAGHNTNVGDEGGFAPNLKSAPVALDFIMESIEQAGFKPGDEIALGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ FFK   Y+ +GE     P   A YLA L   YPI SIEDG++EDDW GWK LT+ IG
Sbjct: 244 ATEFFKDGNYVYEGEKKTRDPKAQAKYLAKLAADYPIISIEDGLAEDDWEGWKYLTDLIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTN  RL  GI   VAN+IL+K NQIGS++ETL+ +E A  AGY +++S
Sbjct: 304 KKTQLVGDDLFVTNTARLRDGIRMGVANSILVKVNQIGSLTETLDAVETAHKAGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LGKQA +AG+S++
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLSRSDRMAKYNQLIRIEEELGKQASYAGKSVV 422


>gi|319408346|emb|CBI81999.1| Enolase [Bartonella schoenbuchensis R1]
          Length = 422

 Score =  568 bits (1463), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 275/415 (66%), Positives = 325/415 (78%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DII REV+DSRG+PT+EVDV LEDG  GRAMVPSGASTG HEA ELRD   RY GKG+
Sbjct: 4   IVDIIGREVLDSRGNPTVEVDVYLEDGVFGRAMVPSGASTGTHEAVELRDGGTRYQGKGI 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
             AIA +N EI   L G DAR+Q+ ID+ MI LDGTPNK+RLGANAILGVSLA++KAAA 
Sbjct: 64  QNAIAAINGEILQELGGRDARNQMAIDQAMIALDGTPNKARLGANAILGVSLAIAKAAAT 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
           +  LPLY+Y+GG  AH+LP P+MNI+NGG+HADN +DFQEFMI+PVGA  ++EA+R GAE
Sbjct: 124 SLGLPLYRYIGGTQAHLLPTPMMNIINGGVHADNPIDFQEFMIIPVGAPTLKEAVRYGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           +FHTLKK L+  GY+TNVGDEGGF+P+ K+A+ A+D I  SI   GY  G+ + I LDCA
Sbjct: 184 IFHTLKKRLQDAGYNTNVGDEGGFAPHFKSAEQAIDFIMESIAACGYKPGEQIAIGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++  +K   Y  +GE      ++   YLA LVD YPI +IEDGM+EDDW GWK+LT+ IG
Sbjct: 244 STELYKNGSYFYEGEGKCRNVHQQVEYLAQLVDAYPIITIEDGMAEDDWEGWKLLTDSIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
             CQLVGDDLFVTN  RL  GI   VAN+ILIK NQIG++SETL+ IE A  AGY +IIS
Sbjct: 304 KKCQLVGDDLFVTNSVRLRDGIKMGVANSILIKVNQIGTLSETLDAIETAHKAGYRAIIS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           HRSGETED  IADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA +AG
Sbjct: 364 HRSGETEDSFIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGTQALYAG 418


>gi|326387380|ref|ZP_08208989.1| enolase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208036|gb|EGD58844.1| enolase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 428

 Score =  567 bits (1462), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 282/418 (67%), Positives = 332/418 (79%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAVELRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V+KA+  VN EI  AL+G DA DQ  ID  +I+LDGT NK+RLGANAILG SLAV+KAAA
Sbjct: 64  VMKAVTAVNSEIAEALVGVDAEDQRDIDLALIELDGTENKARLGANAILGTSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY Y+GG SAH+LPVP+MNI+NGG HADN +DFQEFMIMPVGA  + EA+R GA
Sbjct: 124 DARGLPLYSYVGGVSAHVLPVPMMNIINGGEHADNPIDFQEFMIMPVGAPTLAEAVRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKK L  KG +T VGDEGGF+PNL +   ALD I  S+EKAG+  G+D+++ALDC
Sbjct: 184 EVFHTLKKGLHEKGLATAVGDEGGFAPNLSSTRDALDFILASVEKAGFKPGQDIVLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY + GE L L P   A YLA L + YPI SIEDGMSEDD+ GW  LT+KI
Sbjct: 244 ASTEFFKNGKYEISGEGLSLNPEAFADYLAALTEAYPIVSIEDGMSEDDFEGWAALTSKI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTNP RL  GI + +AN++L+K NQIG+++ETL  +  AQ AGY +++
Sbjct: 304 GNRVQLVGDDLFVTNPRRLTMGIGKGLANSLLVKVNQIGTLTETLEAVSIAQRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  AK+AGR+
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGASAKYAGRA 421


>gi|209885413|ref|YP_002289270.1| phosphopyruvate hydratase [Oligotropha carboxidovorans OM5]
 gi|229463769|sp|B6JFY2|ENO_OLICO RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|209873609|gb|ACI93405.1| phosphopyruvate hydratase [Oligotropha carboxidovorans OM5]
          Length = 427

 Score =  567 bits (1461), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 274/420 (65%), Positives = 335/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVEVDVVLEDGSMGRAAVPSGASTGAHEAVELRDGDKGRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V+ EI  A+ G DA +Q+ ID  MI LDGTPNKSRLGANAILGVSLAV+KAAA
Sbjct: 64  VEKAVEAVSGEIFDAIGGMDAENQVQIDNAMIALDGTPNKSRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           ++ ++PLY+Y+GG SA +LPVP+MNI+NGG+HADN +DFQE M+MPVGA++  EA+R GA
Sbjct: 124 ESCDMPLYRYVGGTSARVLPVPMMNIVNGGVHADNPIDFQEIMVMPVGAQSFAEALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLK ELK  G++TNVGDEGGF+PNL +AD+ALD + ++I KAGY AG D+++ALDC
Sbjct: 184 EIFHTLKGELKKAGHNTNVGDEGGFAPNLPSADAALDFVMSAIGKAGYKAGDDVMLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY+ +GE      +E A YLA+L  +YPI SIEDGM+EDD  GWK LT+ I
Sbjct: 244 ASTEFFKDGKYVYEGEKKTRSRSEQAKYLADLTSRYPIVSIEDGMAEDDMDGWKELTDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN  RL  GI   + N+IL+K NQIG+++ETL  +E A  A Y +++
Sbjct: 304 GGKVQLVGDDLFVTNVTRLADGIKRGIGNSILVKVNQIGTLTETLAAVEMAHKAAYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR +KYNQL+RIE+ L  QA +AGRS L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRTSKYNQLLRIEQQLDDQALYAGRSAL 423


>gi|294677252|ref|YP_003577867.1| phosphopyruvate hydratase [Rhodobacter capsulatus SB 1003]
 gi|294476072|gb|ADE85460.1| phosphopyruvate hydratase [Rhodobacter capsulatus SB 1003]
          Length = 424

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 279/420 (66%), Positives = 332/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVTLEDGTMGRAAVPSGASTGAHEAVERRDGDKSRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VN EI   L+G D  DQ  IDK+MI+LDGT NK RLGANAILGVSLA +KAAA
Sbjct: 64  VLEAVMAVNGEIAENLVGEDVTDQEGIDKLMIELDGTHNKGRLGANAILGVSLACAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A NIR+A+RMG+
Sbjct: 124 DFTAQPLYRYVGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVSAGNIRDAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL +KG ST +GDEGGF+P L +   ALD I  +IEKAGY  G+D+ +ALDC
Sbjct: 184 EVFHTLKKELSAKGLSTGLGDEGGFAPMLASTRDALDFILKAIEKAGYKPGEDIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ +FK  KY +KGE L L   E   YLA L  +YPI SIEDG +EDDW GWK+LT+ +
Sbjct: 244 ASTEYFKGGKYEMKGEGLSLTSAENVDYLAKLCTEYPIISIEDGCAEDDWEGWKLLTDAL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL +GI + VANA+L+K NQIGS+SETL  +E A  A Y +++
Sbjct: 304 GDKVQLVGDDLFVTNPARLAEGIKKGVANAMLVKVNQIGSLSETLKAVEMAHRARYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG+ A++ GR+IL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGETAEYMGRAIL 423


>gi|298291784|ref|YP_003693723.1| enolase [Starkeya novella DSM 506]
 gi|296928295|gb|ADH89104.1| enolase [Starkeya novella DSM 506]
          Length = 427

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 278/420 (66%), Positives = 334/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IVDIVGREILDSRGNPTVEVDVVLEDGSMGRAAVPSGASTGAHEAVELRDGDKGRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN EI  A+ G DA DQ  ID+I+I+LDGTPNK+RLGANAILGVSLA++KAAA
Sbjct: 64  VTKAVDAVNGEIFDAIGGMDAEDQAAIDRILIELDGTPNKARLGANAILGVSLALAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
              +LPLY+Y+GG +A +LPVP+MNI+NGG HADN +DFQEFMI+PVGA    E +R GA
Sbjct: 124 AARDLPLYRYVGGVNARVLPVPMMNIVNGGAHADNPIDFQEFMILPVGAPTFAEGLRTGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKK LK  G++TNVGDEGGF+PNL +AD+AL  +  +IE AGY  G+D+ I LDC
Sbjct: 184 EIFHTLKKALKDAGHNTNVGDEGGFAPNLPSADAALAFVVKAIESAGYKPGEDVYIGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY  +GE           YLA+LV +YPI +IEDGM+EDDW GWK+LT+ I
Sbjct: 244 ASTEFFKNGKYDYEGEGAVRDIEAQVKYLADLVSRYPIATIEDGMAEDDWEGWKLLTDAI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS CQLVGDDLFVTN  RL  GI + VAN+IL+K NQIGS++ETLN +E A  AGY +++
Sbjct: 304 GSKCQLVGDDLFVTNVTRLEAGIKQGVANSILVKVNQIGSLTETLNAVEMAHKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQL+RIE+ LG QA +AGR+ L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLLRIEQELGPQAIYAGRAAL 423


>gi|163739633|ref|ZP_02147042.1| Phosphopyruvate hydratase [Phaeobacter gallaeciensis BS107]
 gi|161387092|gb|EDQ11452.1| enolase [Phaeobacter gallaeciensis BS107]
          Length = 424

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 274/420 (65%), Positives = 333/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVMLEDGTMGRAAVPSGASTGAYEAVEKRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   L+G DA +Q+ +D  MI+LDGT NK RLGANAILGVS+AV+KAAA
Sbjct: 64  VLEAVAAVNGEIAEELVGFDACEQVAVDMAMIELDGTENKGRLGANAILGVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV AENIR+A+RMG+
Sbjct: 124 DFTTQPLYRYIGGTSARMLPVPMMNIINGGEHADNPIDIQEFMIMPVAAENIRDAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+PN+ +   ALD +  SIEKAGY  G+++ +ALDC
Sbjct: 184 EVFHTLKKELSAAGLSTGIGDEGGFAPNIASTREALDFVLKSIEKAGYKPGEEIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ ++K  KY+L GE   L   E  +YLA LV  YPI SIEDGM EDDW GWK LT+++
Sbjct: 244 AATEYYKDGKYVLSGEGKTLSSAENVAYLAALVKDYPIISIEDGMGEDDWDGWKALTDEL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI    AN++L+K NQIG+++ETL  ++ A  A Y +++
Sbjct: 304 GDKVQLVGDDLFVTNPARLATGIERGCANSMLVKVNQIGTLTETLKAVDMAHRARYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG+ A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGEVAEYAGRSIL 423


>gi|49475365|ref|YP_033406.1| enolase [Bartonella henselae str. Houston-1]
 gi|29839252|sp|Q8L202|ENO_BARHE RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|20465193|gb|AAL74281.1| enolase [Bartonella henselae str. Houston-1]
 gi|49238171|emb|CAF27380.1| Enolase [Bartonella henselae str. Houston-1]
          Length = 422

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 275/416 (66%), Positives = 326/416 (78%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKG 61
            I DII REV+DSRG+PT+EV+V LE+G+ GRA+VPSGASTG HEA ELRD   RY GKG
Sbjct: 3   IIVDIIGREVLDSRGNPTVEVEVHLENGALGRALVPSGASTGAHEAVELRDGGTRYQGKG 62

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KAIA +N EI   L G DAR+Q+ ID+ MI LDGTPNK+RLGANA+LGVSLAV+KAAA
Sbjct: 63  VKKAIAAINGEILEELGGRDARNQIGIDQAMIALDGTPNKARLGANALLGVSLAVAKAAA 122

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           ++ +LPLY+Y+GG  AHILP P+MNI+NGG+HADN +DFQEFMI+PVGA  ++EAIR GA
Sbjct: 123 ESLSLPLYRYIGGTQAHILPTPMMNIINGGVHADNPIDFQEFMIIPVGASTLKEAIRYGA 182

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKK LK  GY+TNVGDEGGF+P  K+A+ A+D I  SI   GY  G+ + + LDC
Sbjct: 183 EIFHTLKKRLKDAGYNTNVGDEGGFAPQFKSAEQAIDFIMESIIACGYKPGEQIALGLDC 242

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ F+K   Y  +GE       E   YLA L+  YPI +IEDGM+EDDW GWK+LT+ I
Sbjct: 243 AATEFYKNGSYFYEGEGKYRDVGEQVDYLAQLIKTYPIITIEDGMAEDDWEGWKLLTDSI 302

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN  RL  GI    AN+ILIK NQIG++SETL+ +E A  AGY +II
Sbjct: 303 GKKCQLVGDDLFVTNSARLRDGIKMGAANSILIKVNQIGTLSETLDAVETAHKAGYRAII 362

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED  IADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA +AG
Sbjct: 363 SHRSGETEDSFIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGLQACYAG 418


>gi|103486016|ref|YP_615577.1| phosphopyruvate hydratase [Sphingopyxis alaskensis RB2256]
 gi|119369399|sp|Q1GVS8|ENO_SPHAL RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|98976093|gb|ABF52244.1| enolase [Sphingopyxis alaskensis RB2256]
          Length = 424

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 281/420 (66%), Positives = 333/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI  RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IIDIHGREILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAVELRDGDKGRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+A VN +I  AL+G DA DQ  ID  MIDLDGTPNKSRLGANAILGVSLA +KAAA
Sbjct: 64  VTKAVAAVNGDIAEALVGLDAEDQREIDMAMIDLDGTPNKSRLGANAILGVSLAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+Y+GG SA  LPVP+MNI+NGG HADN +D QEFMIMPVGA +I EA+R G+
Sbjct: 124 DARGLPLYRYVGGVSARTLPVPMMNIINGGEHADNPIDVQEFMIMPVGAGSIAEAVRWGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKK L  KG +T VGDEGGF+PNL +   ALD IA S+++AG+  G D+++ALDC
Sbjct: 184 EIFHTLKKGLSQKGLATAVGDEGGFAPNLASTRDALDFIAASVDQAGFKLGTDVVLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FF+  KY + GE L L P +MA YLA LV  YPI SIEDGMSEDD+ GWK LT+ I
Sbjct: 244 AATEFFRNGKYEISGEGLSLSPEQMAEYLAALVKDYPIKSIEDGMSEDDFAGWKALTDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTNP RL +GI + +AN++L+K NQIG++SETL+ ++ A  A Y +++
Sbjct: 304 GGTCQLVGDDLFVTNPARLEQGIKDGLANSLLVKVNQIGTLSETLDAVDMAHRARYSAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A++ G +I 
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGDMARYPGAAIF 423


>gi|163852203|ref|YP_001640246.1| phosphopyruvate hydratase [Methylobacterium extorquens PA1]
 gi|240139533|ref|YP_002964009.1| enolase [Methylobacterium extorquens AM1]
 gi|238687357|sp|A9W6G9|ENO_METEP RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|27902665|gb|AAO24625.1| enolase [Methylobacterium extorquens]
 gi|163663808|gb|ABY31175.1| Phosphopyruvate hydratase [Methylobacterium extorquens PA1]
 gi|240009506|gb|ACS40732.1| enolase [Methylobacterium extorquens AM1]
          Length = 429

 Score =  565 bits (1457), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 278/420 (66%), Positives = 336/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I +I ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   ITNIAAREILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAVELRDGDKSRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  V  EI  A+ G DA DQ+ +D+ MI LDGTPNK+RLGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVDAVQSEILDAIGGMDAEDQVAVDEAMIALDGTPNKARLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +T+ LPLY+Y+GG    +LPVP+MNI+NGG HADN +DFQEFM+MPVGA ++ +A+RMGA
Sbjct: 124 ETAGLPLYRYVGGVQGRVLPVPMMNIVNGGAHADNPIDFQEFMVMPVGATSLSDAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLK  LK  G++TNVGDEGGF+PNL +A++ALD +  SI  AG+  G D+++ALDC
Sbjct: 184 EIFHTLKSALKKAGHNTNVGDEGGFAPNLPSAEAALDFVMESINAAGFKPGSDVVLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y  +GE       +   YLA L + YPI SIEDGMSEDDW GWK+LT++I
Sbjct: 244 AATEFFKDGAYRYEGEGQTRSIEQQVDYLAKLTEAYPILSIEDGMSEDDWEGWKLLTDRI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  QLVGDDLFVTN ERL +GI    AN+IL+K NQIGS++ETL  ++ AQ AGY +++
Sbjct: 304 GSRVQLVGDDLFVTNVERLARGIETGTANSILVKVNQIGSLTETLAAVDMAQRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA +AGRS +
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEGLGAQALYAGRSAI 423


>gi|218530962|ref|YP_002421778.1| phosphopyruvate hydratase [Methylobacterium chloromethanicum CM4]
 gi|254783258|sp|B7KRB4|ENO_METC4 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|218523265|gb|ACK83850.1| Phosphopyruvate hydratase [Methylobacterium chloromethanicum CM4]
          Length = 429

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 278/420 (66%), Positives = 336/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I +I ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   ITNIAAREILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAVELRDGDKSRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  V  EI  A+ G DA DQ+ +D+ MI LDGTPNK+RLGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVDAVQSEILDAIGGMDAEDQVAVDEAMIALDGTPNKARLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +T+ LPLY+Y+GG    +LPVP+MNI+NGG HADN +DFQEFM+MPVGA ++ +A+RMGA
Sbjct: 124 ETAGLPLYRYVGGVQGRVLPVPMMNIVNGGAHADNPIDFQEFMVMPVGATSLSDAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLK  LK  G++TNVGDEGGF+PNL +A++ALD +  SI  AG+  G D+++ALDC
Sbjct: 184 EIFHTLKSALKKAGHNTNVGDEGGFAPNLPSAEAALDFVMESINAAGFKPGSDVVLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y  +GE       +   YLA L + YPI SIEDGMSEDDW GWK+LT++I
Sbjct: 244 AATEFFKDGAYRYEGEGQTRSIEQQVDYLAKLTEAYPILSIEDGMSEDDWDGWKLLTDRI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  QLVGDDLFVTN ERL +GI    AN+IL+K NQIGS++ETL  ++ AQ AGY +++
Sbjct: 304 GSRVQLVGDDLFVTNVERLARGIETGTANSILVKVNQIGSLTETLAAVDMAQRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA +AGRS +
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEGLGAQALYAGRSAI 423


>gi|163746472|ref|ZP_02153830.1| enolase [Oceanibulbus indolifex HEL-45]
 gi|161380357|gb|EDQ04768.1| enolase [Oceanibulbus indolifex HEL-45]
          Length = 425

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 280/420 (66%), Positives = 335/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAYEANERRDGDKSRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A A VN EI  AL+G DA +Q+ ID++MI+LDGT NKSRLGANAILGVS+A +KAAA
Sbjct: 64  VLEACAAVNGEIAEALVGIDATEQVEIDEMMIELDGTENKSRLGANAILGVSMAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
                PLY+Y+GG +A +LPVP+MNI+NGG HADN +D QEFMIMPV A+NIREA+RMGA
Sbjct: 124 DYCTQPLYRYIGGTTARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAADNIREAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL   G ST +GDEGGF+PN+ ++  ALD I  SIEKAGY  G+D+ +ALDC
Sbjct: 184 EVFHTLKKELSDAGLSTGIGDEGGFAPNISSSRDALDFILKSIEKAGYKPGEDMYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ ++K  KY+L GE   L   E A YLA LV+ YPI SIEDGM+EDDW GWK LT  +
Sbjct: 244 AATEYYKDGKYVLSGEGKTLSSEENADYLAALVNDYPIISIEDGMAEDDWDGWKALTEIL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI    AN++L+K NQIG+++ETL  ++ A  AGY +++
Sbjct: 304 GDKVQLVGDDLFVTNPARLSDGIKRGCANSMLVKVNQIGTLTETLKAVDMAHRAGYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG+ A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEVLGETAQYAGRSIL 423


>gi|163741381|ref|ZP_02148772.1| enolase [Phaeobacter gallaeciensis 2.10]
 gi|161385115|gb|EDQ09493.1| enolase [Phaeobacter gallaeciensis 2.10]
          Length = 424

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 273/420 (65%), Positives = 333/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVMLEDGTMGRAAVPSGASTGAYEAVEKRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   L+G DA +Q+ +D  MI+LDGT NK RLGANAILGVS+AV+KAAA
Sbjct: 64  VLEAVAAVNGEIAEELVGFDACEQVAVDMAMIELDGTENKGRLGANAILGVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A+NIR+A+RMG+
Sbjct: 124 DFTTQPLYRYIGGTSARMLPVPMMNIINGGEHADNPIDIQEFMIMPVAADNIRDAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+PN+ +   ALD +  SIEKAGY  G+++ +ALDC
Sbjct: 184 EVFHTLKKELSAAGLSTGIGDEGGFAPNIASTREALDFVLKSIEKAGYKPGEEIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ ++K  KY+L GE   L   E  +YLA LV  YPI SIEDGM EDDW GWK LT+++
Sbjct: 244 AATEYYKDGKYVLSGEGKTLTSAENVAYLAALVKDYPIISIEDGMGEDDWDGWKALTDEL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI    AN++L+K NQIG+++ETL  ++ A  A Y +++
Sbjct: 304 GDKVQLVGDDLFVTNPARLADGIARGCANSMLVKVNQIGTLTETLKAVDMAHRARYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG+ A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGEVAEYAGRSIL 423


>gi|254561949|ref|YP_003069044.1| enolase [Methylobacterium extorquens DM4]
 gi|254269227|emb|CAX25193.1| enolase [Methylobacterium extorquens DM4]
          Length = 429

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 277/420 (65%), Positives = 335/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I +I ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   ITNIAAREILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAVELRDGDKSRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  V  EI  A+ G DA DQ+ +D+ MI LDGTPNK+RLGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVDAVQSEILDAIGGMDAEDQVAVDEAMIALDGTPNKARLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +T+ LPLY+Y+GG    +LPVP+MNI+NGG HADN +DFQEFM+MPVGA ++ +A+RMGA
Sbjct: 124 ETAGLPLYRYVGGVQGRVLPVPMMNIVNGGAHADNPIDFQEFMVMPVGATSLSDAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLK  LK  G++TNVGDEGGF+PNL +A++ALD +  SI  AG+  G D+++ALDC
Sbjct: 184 EIFHTLKSALKKAGHNTNVGDEGGFAPNLPSAEAALDFVMESINAAGFKPGSDVVLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y  +GE       +   YLA L + YPI SIEDGMSEDDW GWK+LT++I
Sbjct: 244 AATEFFKDGAYRYEGEGQTRSIEQQVDYLAKLTEAYPILSIEDGMSEDDWEGWKLLTDRI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN ERL +GI    AN+IL+K NQIGS++ETL  ++ AQ AGY +++
Sbjct: 304 GGRVQLVGDDLFVTNVERLARGIETGTANSILVKVNQIGSLTETLAAVDMAQRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA +AGRS +
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEGLGAQALYAGRSAI 423


>gi|329113363|ref|ZP_08242144.1| Enolase [Acetobacter pomorum DM001]
 gi|326697188|gb|EGE48848.1| Enolase [Acetobacter pomorum DM001]
          Length = 474

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 268/420 (63%), Positives = 331/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DIIARE++DSRG+PT+EVDV L  G+ GRA VPSGASTG HEA ELRD + KR+ GKG
Sbjct: 52  IVDIIAREILDSRGNPTVEVDVELASGARGRAAVPSGASTGAHEAVELRDGDPKRFGGKG 111

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  + +EI   L G ++ DQ+ ID  MIDLDGTPNKSR+GANAILGVSLA++KA A
Sbjct: 112 VLKAVENIENEILPTLQGAESADQIDIDNAMIDLDGTPNKSRMGANAILGVSLAIAKATA 171

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
              ++PLY+Y+GG  AH+LPVP+MNI+NGG HADN +D QEFM+ PVGA  + +AIR G+
Sbjct: 172 AELHVPLYRYIGGVFAHVLPVPMMNIVNGGEHADNPIDIQEFMVQPVGAPTVADAIRWGS 231

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+F  LKK L + GY+TNVGDEGGF+P LK+AD AL  I  ++E AGY  G+D+  ALDC
Sbjct: 232 EIFAQLKKALSAAGYNTNVGDEGGFAPALKSADEALGFITRAVEAAGYRPGEDVTFALDC 291

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY LKGE  E     M SYL++LV +YPI SIEDGM+EDDW GW +LT ++
Sbjct: 292 ASTEFFKNGKYNLKGEGKEFDSAGMVSYLSDLVSRYPIVSIEDGMAEDDWEGWALLTQEL 351

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI   VAN++L+K NQIG+++ETL  ++ AQ AGY +++
Sbjct: 352 GKKVQLVGDDLFVTNPERLRRGIQAGVANSLLVKVNQIGTLTETLEAVQMAQRAGYTAVM 411

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR AKYNQLIRIE+ L   A++AGR+IL
Sbjct: 412 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRTAKYNQLIRIEQELATAARYAGRTIL 471


>gi|83593220|ref|YP_426972.1| phosphopyruvate hydratase [Rhodospirillum rubrum ATCC 11170]
 gi|119369383|sp|Q2RT60|ENO_RHORT RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|83576134|gb|ABC22685.1| enolase [Rhodospirillum rubrum ATCC 11170]
          Length = 425

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 280/420 (66%), Positives = 336/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV L+ G+ GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVLLDSGAFGRAAVPSGASTGAHEAVELRDGDKTRYAGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN E+ +AL G DA DQLLID+ MIDLDGTPNK+RLGANAILGVSLA +KAAA
Sbjct: 64  VLKAVEAVNGELFSALSGLDATDQLLIDQAMIDLDGTPNKARLGANAILGVSLACAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y+GG  +HILPVP+MNI+NGG HADN +D QEFMIMPV A  + +A+RMGA
Sbjct: 124 EEAELPLYRYIGGARSHILPVPMMNIINGGQHADNPIDVQEFMIMPVSAPTVADAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK+LK  G++TNVGDEGGF+PNL +AD AL  I  +IE AGY AG+D+++ALD 
Sbjct: 184 EVFHALKKKLKDAGHNTNVGDEGGFAPNLASADEALAFIVKAIEAAGYKAGEDIVLALDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY+L GE   L    M  Y A L  +YPI SIEDG +EDDW GW +LT ++
Sbjct: 244 ASSEFYKDGKYVLAGEGKTLDAEGMVKYYAELCKRYPILSIEDGCAEDDWAGWSLLTAEL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTNP RL +GI + VAN+IL+K NQIG++SETL  +E A  AGY S++
Sbjct: 304 GAKVQLVGDDLFVTNPLRLAEGIRKGVANSILVKVNQIGTLSETLEAVEMAHKAGYTSVL 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIAD+AVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG  A +AG SIL
Sbjct: 364 SHRSGETEDSTIADIAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEELGPVAVYAGASIL 423


>gi|163760089|ref|ZP_02167172.1| probable enolase protein [Hoeflea phototrophica DFL-43]
 gi|162282488|gb|EDQ32776.1| probable enolase protein [Hoeflea phototrophica DFL-43]
          Length = 424

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 277/419 (66%), Positives = 332/419 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI  REV+DSRG+PT+EVDV LEDGS GRAMVPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIAGREVLDSRGNPTVEVDVHLEDGSMGRAMVPSGASTGAHEAVELRDGGSRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            +A+A VN  +R  + G DA  Q+ +DK MI LDG+ NK  LGANAILGVSLA ++AAAQ
Sbjct: 64  QRAVAAVNGTLRDNICGMDAEGQIALDKAMIALDGSANKGTLGANAILGVSLAAARAAAQ 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
           +S LPLY+Y+GG +A +LPVP+MNI+NGG HADN +DFQEFMIMPVGA +  +A+R+G+E
Sbjct: 124 SSGLPLYRYVGGANARLLPVPMMNIINGGSHADNPIDFQEFMIMPVGAASFSDAVRIGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKKEL + G++TNVGDEGGF+P+LK+A  ALD I  SIEKAGY  G+D+ +ALD A
Sbjct: 184 VFHTLKKELAAGGHNTNVGDEGGFAPDLKSAPEALDFIMKSIEKAGYRPGEDIYLALDPA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY L GE   L+  EMA+Y A L  +YPI SIEDGM+EDDW GWK+LT  IG
Sbjct: 244 STEFFKDGKYDLAGEGRILESAEMAAYYAELAAKYPIISIEDGMAEDDWDGWKVLTEMIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
             CQLVGDDLFVTN  RL  GI   VAN+IL+K NQIG+++ETL  +E AQ A Y +++S
Sbjct: 304 DKCQLVGDDLFVTNTARLRDGIKMGVANSILVKVNQIGTLTETLEAVETAQKARYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG +  +AG S+L
Sbjct: 364 HRSGETEDSTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEELGVEGFYAGTSVL 422


>gi|94498557|ref|ZP_01305112.1| Phosphopyruvate hydratase [Sphingomonas sp. SKA58]
 gi|94422000|gb|EAT07046.1| Phosphopyruvate hydratase [Sphingomonas sp. SKA58]
          Length = 424

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 281/420 (66%), Positives = 336/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI AR+++DSRG+PT+EVDV LEDGS GRA VPSGASTG +EA E RD +K +Y GKG
Sbjct: 4   ILDIHARQILDSRGNPTVEVDVMLEDGSFGRAAVPSGASTGAYEAVEKRDGDKTKYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VNDEI   L+G DA DQ  +D  MIDLDGT NKSRLGANAILGVSLAV+KAAA
Sbjct: 64  VLQAVAAVNDEIAEQLIGLDAEDQGEVDAAMIDLDGTDNKSRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+Y+GG SAH+LPVP+MNI+NGG HADN +DFQEFMIMPVGA++I +A+R+G+
Sbjct: 124 DARGLPLYRYVGGVSAHVLPVPMMNIINGGEHADNPIDFQEFMIMPVGADSIADAVRIGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKK L  KG +T+VGDEGGF+PN+ +   ALD I  S+EKAGY  G D+++ALDC
Sbjct: 184 EIFHTLKKGLHDKGLATSVGDEGGFAPNIASTRDALDFIMLSVEKAGYKPGDDVVLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK  KY + GE L L P EMA YLA L   YPI SIEDGM EDD+ GWK LT+KI
Sbjct: 244 AATEFFKNGKYEISGEGLSLSPVEMADYLAALCADYPIRSIEDGMGEDDFEGWKALTDKI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI + +AN++L+K NQIG+++ETL  ++ A  + Y +++
Sbjct: 304 GDKVQLVGDDLFVTNPARLAMGIGKGLANSLLVKVNQIGTLTETLAAVDLAHRSRYSAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A +AGRSI 
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGDMAVYAGRSIF 423


>gi|87200238|ref|YP_497495.1| enolase [Novosphingobium aromaticivorans DSM 12444]
 gi|119369362|sp|Q2G662|ENO_NOVAD RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|87135919|gb|ABD26661.1| enolase [Novosphingobium aromaticivorans DSM 12444]
          Length = 428

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 281/418 (67%), Positives = 330/418 (78%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAVELRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN +I   +LG DA DQ  ID  MI+LDGT NKSRLGANAILG SLAV+KAAA
Sbjct: 64  VTKAVTAVNSDIAECILGLDAEDQRDIDLAMIELDGTENKSRLGANAILGTSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY Y+GG SAH+LPVP+MNI+NGG HADN +DFQEFMIMPVGA ++ EA+R GA
Sbjct: 124 DARGLPLYSYVGGVSAHVLPVPMMNIINGGEHADNPIDFQEFMIMPVGAPSLAEAVRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKK L  KG +T VGDEGGF+PNL +   ALD +  SIEKAG+  G+D+++ALDC
Sbjct: 184 EVFHTLKKGLHEKGLATAVGDEGGFAPNLASTRDALDFVMASIEKAGFKPGEDMMLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK  KY + GE L L P+ MA YLA L D YPI SIEDGM EDD+ GW  LT K+
Sbjct: 244 AATEFFKNGKYEISGEGLSLSPDAMADYLAALCDAYPIISIEDGMGEDDFEGWAALTAKV 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+RL  GI + +AN++L+K NQIGS++ETL  +  AQ  GY +++
Sbjct: 304 GKRVQLVGDDLFVTNPKRLEMGIGKGLANSLLVKVNQIGSLTETLEAVSIAQRNGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A++AG++
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGVSARYAGKT 421


>gi|217976702|ref|YP_002360849.1| phosphopyruvate hydratase [Methylocella silvestris BL2]
 gi|254783259|sp|B8EJT3|ENO_METSB RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|217502078|gb|ACK49487.1| Phosphopyruvate hydratase [Methylocella silvestris BL2]
          Length = 427

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 282/420 (67%), Positives = 332/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IIDIAAREILDSRGNPTVEVDVTLEDGSHGRAAVPSGASTGAHEAVELRDGDKSRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKAI  VN +I  AL G +A DQ  ID+IMI LDGTPNKS+LGANAILGVSLAV+KAAA
Sbjct: 64  VLKAIENVNRDIFEALSGLEAEDQGRIDEIMISLDGTPNKSKLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             S LPLY+Y+GG  AH+LPVP+MNI+NGG+HADN +DFQEFMI+PVGA +I EA+R G+
Sbjct: 124 DASALPLYRYVGGVQAHVLPVPMMNIINGGVHADNPIDFQEFMILPVGAPSIAEAVRWGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVF  LK  LK  G++TNVGDEGGF+PNL +A++ALD    +IE AG+  G D+ + LDC
Sbjct: 184 EVFQLLKSSLKKAGHNTNVGDEGGFAPNLPSAEAALDFCVQAIEAAGFKPGVDIFLGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y+  GE +   P E A+YLA L   YPI SIEDGMSEDDW GWK +T  I
Sbjct: 244 AATEFFKDGAYVYSGEGVTRSPEEQANYLAKLSASYPIASIEDGMSEDDWAGWKAVTELI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  QLVGDDLFVTN  RL +GI + +AN+IL+K NQIGS++ETL  ++ AQ AGY +++
Sbjct: 304 GSKIQLVGDDLFVTNVTRLEEGIKKGIANSILVKVNQIGSLTETLAAVDMAQRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQLIRIEE LG QA++AG   L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLIRIEEELGSQARYAGLKAL 423


>gi|188582152|ref|YP_001925597.1| phosphopyruvate hydratase [Methylobacterium populi BJ001]
 gi|238692883|sp|B1ZEJ8|ENO_METPB RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|179345650|gb|ACB81062.1| Phosphopyruvate hydratase [Methylobacterium populi BJ001]
          Length = 429

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 276/420 (65%), Positives = 335/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I +I ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   ITNIAAREILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAVELRDGDKGRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  V  EI  A+ G DA DQ+ +D+ MI LDGTPNK+RLGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVDAVQTEILDAIGGMDAEDQVAVDEAMITLDGTPNKARLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +T+ LPLY+Y+GG    +LPVP+MNI+NGG HADN +DFQEFM+MPVGA ++ +A+RMGA
Sbjct: 124 ETAGLPLYRYVGGVQGRVLPVPMMNIVNGGAHADNPIDFQEFMVMPVGATSLSDAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLK  LK  G++TNVGDEGGF+PNL +A++ALD +  SI  AG+  G D+++ALDC
Sbjct: 184 EIFHTLKSALKKAGHNTNVGDEGGFAPNLPSAEAALDFVMESINAAGFKPGSDVVLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y  +GE       +   YLA L + YPI SIEDGMSEDDW GWK+LT++I
Sbjct: 244 AATEFFKDGAYHYEGEGQTRSIEQQVEYLAKLTEAYPILSIEDGMSEDDWEGWKLLTDRI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTN ERL +GI     N+IL+K NQIGS++ETL  ++ AQ AGY +++
Sbjct: 304 GNRVQLVGDDLFVTNVERLARGIETGTGNSILVKVNQIGSLTETLAAVDMAQRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA +AGRS +
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEGLGAQALYAGRSAI 423


>gi|192291589|ref|YP_001992194.1| phosphopyruvate hydratase [Rhodopseudomonas palustris TIE-1]
 gi|238692564|sp|B3Q6L0|ENO_RHOPT RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|192285338|gb|ACF01719.1| Phosphopyruvate hydratase [Rhodopseudomonas palustris TIE-1]
          Length = 427

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 278/420 (66%), Positives = 333/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVEVDVVLEDGSVGRAAVPSGASTGAHEAVELRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN E+  AL G DA  Q+ ID+ MI+LDGTPNK R+GANAILGVSLA +KAAA
Sbjct: 64  VQKAVEAVNGELFDALGGMDAEQQVQIDQTMIELDGTPNKGRIGANAILGVSLAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + ++PLY+Y+GG SA  LPVP+MNI+NGG+HADN +DFQEFMIMPVGA    +A+R G+
Sbjct: 124 ASYDMPLYRYVGGTSARTLPVPMMNIVNGGVHADNPIDFQEFMIMPVGAPTFADALRCGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLK ELK  G++TNVGDEGGF+PNL +AD+ALD +  +I KAGY AG D+++ALDC
Sbjct: 184 EIFHTLKGELKKAGHNTNVGDEGGFAPNLPSADAALDFVMAAIGKAGYKAGDDVMLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y+  GEN     +E A YLA+LV +YPI SIEDGMSEDD  GWK LT+ I
Sbjct: 244 AATEFFKDGAYVYGGENKTRSRSEQAKYLADLVARYPIVSIEDGMSEDDMDGWKELTDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS CQLVGDDLFVTN  RL  GI    AN+ILIK NQIG+++ETL  +E A  AGY +++
Sbjct: 304 GSKCQLVGDDLFVTNVTRLADGIKNGRANSILIKVNQIGTLTETLAAVEMAHKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLAR+DR AKYNQL+RIE+ LG  A +AG++ L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARADRTAKYNQLLRIEQELGAHAHYAGKAAL 423


>gi|39935939|ref|NP_948215.1| phosphopyruvate hydratase [Rhodopseudomonas palustris CGA009]
 gi|59797572|sp|Q6N5U6|ENO_RHOPA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|39649793|emb|CAE28315.1| enolase [Rhodopseudomonas palustris CGA009]
          Length = 427

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 278/420 (66%), Positives = 333/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVEVDVVLEDGSVGRAAVPSGASTGAHEAVELRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN E+  AL G DA  Q+ ID+ MI+LDGTPNK R+GANAILGVSLA +KAAA
Sbjct: 64  VQKAVEAVNGELFDALGGMDAEQQVQIDQTMIELDGTPNKGRIGANAILGVSLAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + ++PLY+Y+GG SA  LPVP+MNI+NGG+HADN +DFQEFMIMPVGA    +A+R G+
Sbjct: 124 ASYDMPLYRYVGGTSARTLPVPMMNIVNGGVHADNPIDFQEFMIMPVGAPTFADALRCGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLK ELK  G++TNVGDEGGF+PNL +AD+ALD +  +I KAGY AG D+++ALDC
Sbjct: 184 EIFHTLKGELKKAGHNTNVGDEGGFAPNLPSADAALDFVMAAIGKAGYKAGGDVMLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y+  GEN     +E A YLA+LV +YPI SIEDGMSEDD  GWK LT+ I
Sbjct: 244 AATEFFKDGSYVYGGENKTRSRSEQAKYLADLVARYPIVSIEDGMSEDDMDGWKELTDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS CQLVGDDLFVTN  RL  GI    AN+ILIK NQIG+++ETL  +E A  AGY +++
Sbjct: 304 GSKCQLVGDDLFVTNVTRLADGIKNGRANSILIKVNQIGTLTETLAAVEMAHKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLAR+DR AKYNQL+RIE+ LG  A +AG++ L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARADRTAKYNQLLRIEQELGAHAHYAGKAAL 423


>gi|83952177|ref|ZP_00960909.1| enolase [Roseovarius nubinhibens ISM]
 gi|83837183|gb|EAP76480.1| enolase [Roseovarius nubinhibens ISM]
          Length = 424

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 277/420 (65%), Positives = 325/420 (77%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAYEAVERRDGDKSRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   LLG DA +Q+ ID+ MI+LDGT NKSRLGANAILGVSLA +KAAA
Sbjct: 64  VLEAVAAVNGEIADTLLGFDAAEQVAIDEAMIELDGTDNKSRLGANAILGVSLATAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
                PL++Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMP  AENIR+A+RMGA
Sbjct: 124 DFCAQPLFRYVGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPTSAENIRDAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+PN+ +   ALD +  SIEKAGY  G D+ +ALDC
Sbjct: 184 EVFHTLKKELSAAGLSTGIGDEGGFAPNIASTREALDFVLKSIEKAGYKPGDDIHLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ +FK  KY+L GE   L   E   YL  LV  YPI SIEDGM+EDDW GW  LT  +
Sbjct: 244 AATEYFKDGKYVLSGEGKTLSSQENVDYLKALVADYPIISIEDGMAEDDWDGWIALTEAL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL +GI    AN++L+K NQIGS++ETL  +E A  A   +++
Sbjct: 304 GDKVQLVGDDLFVTNPTRLAEGIERGAANSMLVKVNQIGSLTETLRAVEMAHRARMTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A +AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGDTAIYAGRSIL 423


>gi|92117289|ref|YP_577018.1| phosphopyruvate hydratase [Nitrobacter hamburgensis X14]
 gi|119369358|sp|Q1QMI9|ENO_NITHX RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|91800183|gb|ABE62558.1| enolase [Nitrobacter hamburgensis X14]
          Length = 427

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 272/420 (64%), Positives = 331/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA ELRD ++ RYFGKG
Sbjct: 4   IVDIIGREILDSRGNPTVEVDVALEDGAMGRAAVPSGASTGAHEAVELRDDDQTRYFGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  +N EI  A+ G DA  Q  ID+I+I LDGT NKSRLGANAILGVSLA+++AAA
Sbjct: 64  VRKAVDAINGEIFDAIGGMDAEQQAQIDEILIGLDGTANKSRLGANAILGVSLALARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + ++PLY+Y+GG SA  LPVP+MNI+NGG+HADN +DFQEFMIMPVGA+   E +R G+
Sbjct: 124 DSLDMPLYRYVGGVSARTLPVPMMNIVNGGVHADNPIDFQEFMIMPVGAKTFSEGLRCGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTL+ ELK  G++TNVGDEGGF+PNL +A +ALD I  +I KAGY  G D+ +ALD 
Sbjct: 184 EIFHTLRAELKKAGHNTNVGDEGGFAPNLPSASAALDFIMGAIVKAGYKPGDDVALALDP 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS FFK  KY+  GE       E A YLA L   YPI SIEDGM+EDD+ GWK+LT+ I
Sbjct: 244 AASEFFKDGKYVYAGEGKTRSIEEQARYLAKLASDYPIVSIEDGMAEDDFEGWKLLTDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G +CQLVGDDLFVTN  RL  GI + +AN+ILIK NQIG+++ETL  +E A  AGY +++
Sbjct: 304 GKSCQLVGDDLFVTNVTRLADGIGKGLANSILIKVNQIGTLTETLAAVEMAYKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR AKYNQL+RIE+ LG QA++ GR+ L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRAAKYNQLLRIEQQLGAQARYGGRAAL 423


>gi|319405526|emb|CBI79145.1| Enolase [Bartonella sp. AR 15-3]
          Length = 425

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 271/416 (65%), Positives = 325/416 (78%)

Query: 6   IIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGVLKA 65
           II REV+DSRG+PT+EVDV LEDG+ GRA+VPSGAS G HEA ELRD   RY GKGV  A
Sbjct: 7   IIGREVLDSRGNPTVEVDVHLEDGAFGRAIVPSGASRGSHEAVELRDGGLRYQGKGVENA 66

Query: 66  IAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTSN 125
           IA VN EI  AL+G DAR+Q  ID+ MI LDGTPNK+RLGANAILGVSLAV+KAAA++ N
Sbjct: 67  IAAVNGEIFEALIGQDARNQRAIDQTMIALDGTPNKARLGANAILGVSLAVAKAAAESLN 126

Query: 126 LPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVFH 185
           LPLY+Y+GG  AH+LP P+MNI+NGG+HADN +DFQEFMI+P+GA  ++EA+R GAEVFH
Sbjct: 127 LPLYRYIGGTQAHVLPTPMMNIMNGGVHADNPIDFQEFMIIPIGAPTLKEAVRYGAEVFH 186

Query: 186 TLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAASA 245
            LKK L++ GY+TNVGDEGGF+P+L+ +   +D I +SI   GY  G+ + I LDCA++ 
Sbjct: 187 MLKKHLQNAGYNTNVGDEGGFAPHLRNSSQVIDFIVDSIISCGYKPGEQIAIGLDCASTE 246

Query: 246 FFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGSNC 305
           F+K   Y   GE+      E   YL  LVD YPI +IEDGM+EDDW GWK+LT+ IG  C
Sbjct: 247 FYKDGSYFYTGESKYRNTQEQIKYLTQLVDTYPIITIEDGMAEDDWEGWKLLTDSIGKKC 306

Query: 306 QLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISHRS 365
           QLVGDDLF TN  RL  GI    AN+ILIK NQIG++SETL+ IE A  AGY +IISHRS
Sbjct: 307 QLVGDDLFATNSARLRNGIKMGAANSILIKVNQIGTLSETLDAIEIAHKAGYRAIISHRS 366

Query: 366 GETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           G+TED  IADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA+++G  I+
Sbjct: 367 GDTEDSLIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGTQARYSGNFII 422


>gi|23015298|ref|ZP_00055078.1| COG0148: Enolase [Magnetospirillum magnetotacticum MS-1]
          Length = 425

 Score =  561 bits (1447), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 280/420 (66%), Positives = 333/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGKG 61
           I DI  RE++DSRG+PT+EVDV LE G  GRA VPSGASTG+HEA ELRD  +KRY GKG
Sbjct: 4   IIDIHGREILDSRGNPTVEVDVVLETGVIGRAAVPSGASTGVHEACELRDGDKKRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA   VN EI  AL G D  DQ+LIDK MIDLDGTPNKSRLGANAILGVSLA +KAAA
Sbjct: 64  VQKACDSVNGEIYDALSGMDVEDQILIDKTMIDLDGTPNKSRLGANAILGVSLAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y+GG  A ILPVP+MNI+NGG HADN +D QEFMIMPVGA +  EAIRMGA
Sbjct: 124 EESGLPLYRYVGGAFASILPVPMMNIINGGAHADNPIDIQEFMIMPVGASSCSEAIRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK LK  G++TNVGDEGGF+PNLK+A+ ALD I  SIE AGY  G D+++ALDC
Sbjct: 184 EVFHALKKTLKDAGHNTNVGDEGGFAPNLKSAEMALDFIMKSIETAGYKPGDDIMLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S FFK+ KY++ G         +  + A LV  YPI SIEDG +EDD  GW++LT+ +
Sbjct: 244 ASSEFFKEGKYVMAGAKKTYDQKGLVKFYAKLVGSYPIISIEDGCAEDDLVGWELLTDAL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTNPERL  GI++ +AN+IL+K NQIG++SETL  ++ A  AGY +++
Sbjct: 304 GAKVQLVGDDLFVTNPERLSMGIDKGLANSILVKVNQIGTLSETLEAVDMAHKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDRIAKYNQLIRIEE LG  A++AG++I+
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRIAKYNQLIRIEELLGSAARYAGQTIM 423


>gi|85703404|ref|ZP_01034508.1| enolase [Roseovarius sp. 217]
 gi|85672332|gb|EAQ27189.1| enolase [Roseovarius sp. 217]
          Length = 424

 Score =  561 bits (1447), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/420 (65%), Positives = 329/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD +  RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVTLEDGTMGRAAVPSGASTGAHEAVERRDGDTARYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI  AL G DA +Q+ +D  MI+LDGTPNK+RLGANAILGVSLA +KAAA
Sbjct: 64  VLEAVAAVNGEIAEALAGMDATEQVSLDMAMIELDGTPNKARLGANAILGVSLACAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             S  PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMI+PV AENIR+A+RMG+
Sbjct: 124 DFSGQPLYRYVGGTSARVLPVPMMNIINGGEHADNPIDIQEFMILPVAAENIRDAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G +T VGDEGGF+PNL +   ALD I  SIEKAGY  G+++ + LDC
Sbjct: 184 EVFHTLKKELSAAGLATGVGDEGGFAPNLSSTRDALDFILKSIEKAGYRPGEEIYLGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ ++K  KY + GE L L   E  +YL  LV  YPI SIEDGM+EDDW GW+ LT+ +
Sbjct: 244 AATEYYKGGKYEISGEGLSLSSAENVAYLQALVADYPIISIEDGMAEDDWDGWRALTDAL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI    AN++L+K NQIG+++ETL  ++ A  A   +++
Sbjct: 304 GDKVQLVGDDLFVTNPVRLAMGIERGCANSMLVKVNQIGTLTETLQAVDMAHRARMTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG+ A +AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGETAIYAGRSIL 423


>gi|319898760|ref|YP_004158853.1| Enolase [Bartonella clarridgeiae 73]
 gi|319402724|emb|CBI76271.1| Enolase [Bartonella clarridgeiae 73]
          Length = 422

 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 276/415 (66%), Positives = 330/415 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DII REV+DSRG+PT+EVDV LEDG  GRA+VPSGAS G +EA ELRD   RY GKGV
Sbjct: 4   IVDIIGREVLDSRGNPTVEVDVHLEDGVFGRAIVPSGASRGAYEAVELRDGNLRYQGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
             A+A VN EI  AL+G DAR+Q  ID+ MI LDGTPNK+RLGANAILGVSLAV+KAAA+
Sbjct: 64  ENAVAAVNGEIFEALIGQDARNQRAIDQAMIALDGTPNKARLGANAILGVSLAVAKAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
           + NLPLY+Y+GG  AH+LP P+MNI+NGGIHADN +DFQEFMI+PVGA  ++EA+R GAE
Sbjct: 124 SLNLPLYRYIGGTQAHVLPTPMMNIMNGGIHADNPIDFQEFMIIPVGAPTLKEAVRYGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           +FH LKK L++ GY+TN+GDEGGF+P+L++++  +D I +SI   GY  G+ + I LDCA
Sbjct: 184 IFHMLKKHLQNAGYNTNIGDEGGFAPHLRSSEQVIDFIIDSIISCGYKPGEQIAIGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ F+K   Y+ KGEN      E   YL  LVD YPI +IEDGM+EDDW GWK+LT+ IG
Sbjct: 244 STEFYKDGSYLYKGENKCRNTQEQIEYLTQLVDSYPIITIEDGMAEDDWEGWKLLTDSIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
             CQLVGDDLFVTN  RL  GI   VAN+ILIK NQIG++SETL+ IE A  AGY +IIS
Sbjct: 304 KKCQLVGDDLFVTNSARLRNGIKMGVANSILIKVNQIGTLSETLDAIETAHKAGYRAIIS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           HRSGETED  IADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA++AG
Sbjct: 364 HRSGETEDSLIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGTQARYAG 418


>gi|163735819|ref|ZP_02143248.1| enolase [Roseobacter litoralis Och 149]
 gi|161390905|gb|EDQ15245.1| enolase [Roseobacter litoralis Och 149]
          Length = 424

 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 280/420 (66%), Positives = 334/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAYEAVERRDGDKARYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A A VN EI  AL+G DA +Q+ ID  MI+LDGT NKSRLGANAILGVSLA +KAAA
Sbjct: 64  VLEACAAVNGEIADALVGLDATEQVDIDASMIELDGTANKSRLGANAILGVSLAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
                PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A+NIREA+RMG+
Sbjct: 124 DYCTQPLYRYVGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAADNIREAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+PN+ +   ALD I  SIEKAGY  G+++ +A+DC
Sbjct: 184 EVFHTLKKELSAAGLSTGIGDEGGFAPNINSTRDALDFILKSIEKAGYKPGEEIYLAMDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ +FK  KY L GE   L   E  +YLA LV  YPI SIEDGMSEDDW GWK LT+ +
Sbjct: 244 AATEYFKNGKYELAGEGKSLTSEENVAYLAALVADYPIISIEDGMSEDDWDGWKALTDAL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL  GI    AN++L+K NQIG+++ETL  ++ A  AG+ +++
Sbjct: 304 GDKIQLVGDDLFVTNPERLAMGIERGSANSMLVKVNQIGTLTETLKAVDMAHRAGFTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE+LG+ A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEALGETAEYAGRSIL 423


>gi|119386767|ref|YP_917822.1| phosphopyruvate hydratase [Paracoccus denitrificans PD1222]
 gi|134034121|sp|A1B9D2|ENO_PARDP RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|119377362|gb|ABL72126.1| enolase [Paracoccus denitrificans PD1222]
          Length = 425

 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 277/420 (65%), Positives = 335/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD +K RY GKG
Sbjct: 4   IIDIFAREILDSRGNPTVEVDVTLEDGTMGRAAVPSGASTGAHEAVEKRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   L+G DA +Q+ ID++MI+LDGTPNK RLGANAILGVSLAV+KAAA
Sbjct: 64  VLEAVAAVNGEIAENLIGEDATEQVAIDRMMIELDGTPNKGRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +  + PLY+Y+GG  A +LPVP+MNI+NGG HADN +D QEFMIMPV AENIREA+RMG+
Sbjct: 124 EACSQPLYRYVGGAGARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAAENIREAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL S G +T VGDEGGF+PNL +   ALD I  +IEKAGY  G D+++ALDC
Sbjct: 184 EVFHTLKKELSSAGLATGVGDEGGFAPNLSSTRDALDFILKAIEKAGYQPGDDIMLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ +FK  KY + GE   L P E  +YL  L + YPI SIEDG +EDDW GWK+LT+ +
Sbjct: 244 ASTEYFKGGKYEMAGEGKSLSPAENVAYLEALCNDYPILSIEDGCAEDDWDGWKLLTDTL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL +GI +   N++L+K NQIG+++ETL+ +  A  A Y S++
Sbjct: 304 GGRVQLVGDDLFVTNPARLAEGIAKGCGNSLLVKVNQIGTLTETLDAVRMADRARYTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A++AG+SIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGATAEYAGKSIL 423


>gi|114797139|ref|YP_760680.1| phosphopyruvate hydratase [Hyphomonas neptunium ATCC 15444]
 gi|119369336|sp|Q0C0R3|ENO_HYPNA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|114737313|gb|ABI75438.1| enolase [Hyphomonas neptunium ATCC 15444]
          Length = 426

 Score =  561 bits (1445), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 277/416 (66%), Positives = 328/416 (78%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PTIEVDV L+DGSTGRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTIEVDVTLDDGSTGRAAVPSGASTGAYEAHEQRDGDKARYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EI   L G DA +Q L+D +MIDLDGT NKSRLGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVDAVNGEICNELAGMDATEQRLVDTLMIDLDGTENKSRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           ++S LPLY+YLGG +A ILP P+MNI+NGG HADN +D QEFMIMPV AE+I EA+RMGA
Sbjct: 124 ESSALPLYRYLGGANARILPTPMMNIINGGAHADNPVDIQEFMIMPVSAESISEAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L   G++TNVGDEGGF+PNL +AD A+  I  SIEKAGY  G+D+ +ALD 
Sbjct: 184 EVFHALKKTLHDAGHNTNVGDEGGFAPNLASADEAIGFIMKSIEKAGYRPGEDIALALDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ F+K  KY L GE   L   +   YLA+L  +YPI SIEDGM+EDDW GW  LT  +
Sbjct: 244 ASTEFYKNGKYELAGEGKSLSSEQFGQYLADLCGRYPILSIEDGMAEDDWDGWVALTELL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+RL  G+ +  AN+IL+K NQIG++SETL+ +E A + GY +++
Sbjct: 304 GDRVQLVGDDLFVTNPDRLAIGLQKGAANSILVKVNQIGTLSETLDAVELAHLHGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDRIAKYNQLIRIEE LG    +AG
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRIAKYNQLIRIEEELGPIGMYAG 419


>gi|58040704|ref|YP_192668.1| phosphopyruvate hydratase [Gluconobacter oxydans 621H]
 gi|68053521|sp|Q5FNN5|ENO_GLUOX RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|58003118|gb|AAW62012.1| Enolase [Gluconobacter oxydans 621H]
          Length = 426

 Score =  560 bits (1443), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 270/420 (64%), Positives = 326/420 (77%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI +RE++DSRG+PT+EV+V L  G+ GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IVDITSREILDSRGNPTVEVEVELSSGARGRAAVPSGASTGAHEAVELRDGDKSRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA + V ++I   L G ++ DQ+ ID  MIDLDGTPNKSRLGANAILGVSLAV+KA A
Sbjct: 64  VLKACSHVENDILEVLQGAESEDQIAIDNAMIDLDGTPNKSRLGANAILGVSLAVAKATA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+Y+GG  AH+LPVP+MNI+NGG HADN +D QEFMI PVGA  + +AIRMG+
Sbjct: 124 EELELPLYRYVGGAYAHLLPVPMMNIVNGGEHADNPIDIQEFMIQPVGAPTVADAIRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+F  LKK L   GY+TNVGDEGGF+PNLK+AD AL  IA S+E AGY  G+D+  ALDC
Sbjct: 184 EIFARLKKGLSEAGYNTNVGDEGGFAPNLKSADEALGFIAKSVEAAGYKLGEDVTFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ F+   +Y LKGE  E   + M SYL +L ++YPI SIEDG++EDDW GW  LT ++
Sbjct: 244 AATEFYADGRYNLKGEGKEFDASGMISYLEDLANRYPIVSIEDGLAEDDWEGWAELTTRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI     NA+L+K NQIG+++ETL  +E A  AGY  ++
Sbjct: 304 GKKLQLVGDDLFVTNPERLRRGIKAGTGNALLVKVNQIGTLTETLEAVETAHKAGYACVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED  IADLAVATNCGQIKTGSL+RSDR AKYNQLIRIE+ LG  A++AGRSIL
Sbjct: 364 SHRSGETEDSVIADLAVATNCGQIKTGSLSRSDRTAKYNQLIRIEQQLGSAARYAGRSIL 423


>gi|85708563|ref|ZP_01039629.1| enolase [Erythrobacter sp. NAP1]
 gi|85690097|gb|EAQ30100.1| enolase [Erythrobacter sp. NAP1]
          Length = 429

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 278/418 (66%), Positives = 328/418 (78%), Gaps = 2/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI  RE++DSRG+PT+EVDV L+DGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IIDIHGREILDSRGNPTVEVDVLLDDGSFGRAAVPSGASTGAHEAVELRDGDKDRYKGKG 63

Query: 62  VLKAIAFVNDEIRTALLGC-DARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           VLKA+  VN EIR  L+G  DA DQ  ID  +I LDGT NK RLGANAILG SLAVSKAA
Sbjct: 64  VLKAVEAVNTEIRDLLIGAFDAEDQRDIDLSLIALDGTANKGRLGANAILGTSLAVSKAA 123

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    LPLY YLGG +AH+LPVP+MNI+NGG HADN +D QEFM+MPVGAE+I EA+R G
Sbjct: 124 ANARGLPLYSYLGGVAAHVLPVPMMNIINGGEHADNPIDIQEFMVMPVGAESIAEAVRWG 183

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           +EVFHTLKK L  KG +T+VGDEGGF+P+L +  +ALD I  SIE+AG+  G+D+++ALD
Sbjct: 184 SEVFHTLKKGLSDKGLATSVGDEGGFAPDLASTRAALDFIMASIEQAGFKPGEDIVLALD 243

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           CAA+ FF+  KY + GE L L    MA YLA L D YPI SIEDGMSEDD+ GW  +T  
Sbjct: 244 CAATEFFRDGKYEISGEGLSLDGQGMADYLAKLCDDYPIRSIEDGMSEDDFEGWAAVTKA 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG   QLVGDDLFVTNPERL  GI + +AN++L+K NQIG+++ETL  ++ A  A Y S+
Sbjct: 304 IGDRVQLVGDDLFVTNPERLSDGIAKGLANSLLVKVNQIGTLTETLAAVDMATRARYTSV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           +SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A++AGR
Sbjct: 364 MSHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGDSAEYAGR 421


>gi|323136666|ref|ZP_08071747.1| enolase [Methylocystis sp. ATCC 49242]
 gi|322397983|gb|EFY00504.1| enolase [Methylocystis sp. ATCC 49242]
          Length = 427

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 276/417 (66%), Positives = 331/417 (79%), Gaps = 1/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDGS+GRA VPSGASTG HEA E RD + KRY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVTLEDGSSGRAAVPSGASTGAHEAVEKRDGDPKRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VNDEI  ALLG DA DQ+ ID+ MI LDGTPNK+RLGANAILGVSLAV+KAAA
Sbjct: 64  VLQAVDNVNDEIAGALLGLDAEDQVSIDETMIKLDGTPNKARLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y+GG  A +LP P+MNI+NGG+HADN +DFQEFMIMP GA+++RE IR GA
Sbjct: 124 EASALPLYRYVGGVQARVLPTPMMNIVNGGVHADNPIDFQEFMIMPTGADSVREGIRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLK  LK  G +T+VGDEGGF+PNL +A++ALD I  +IE AG+  G D+ +A DC
Sbjct: 184 EIFHTLKSALKKAGLATSVGDEGGFAPNLPSAEAALDFIMKAIETAGFKPGIDVHLASDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK  KY+ +GE +    +E  +YLA L   YPI SIEDGMSEDDW GWK LT+ I
Sbjct: 244 AATEFFKDGKYVYEGEGVTRTIDEQVAYLAKLASAYPIVSIEDGMSEDDWEGWKKLTDAI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN  RL +G+    AN+IL+K NQIGS++ET++ ++ A  AGY S++
Sbjct: 304 GKKVQLVGDDLFVTNVSRLSQGVKTGTANSILVKVNQIGSLTETISAVDMAHRAGYTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           SHRSGETED TIADLAVA NCGQIKTGSLARSDR AKYNQLIRIEE LG  A +AG+
Sbjct: 364 SHRSGETEDSTIADLAVALNCGQIKTGSLARSDRTAKYNQLIRIEEELGDAAVYAGK 420


>gi|254453710|ref|ZP_05067147.1| phosphopyruvate hydratase [Octadecabacter antarcticus 238]
 gi|198268116|gb|EDY92386.1| phosphopyruvate hydratase [Octadecabacter antarcticus 238]
          Length = 424

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 272/420 (64%), Positives = 328/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG+HEA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVTLEDGTMGRAAVPSGASTGVHEAVEKRDGDKSRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VN EI   ++G DA +Q+ ID  MI+LDGT NK RLGANAIL VSLAV+KAAA
Sbjct: 64  VLQAVDSVNGEIADTIVGFDATEQVAIDMAMIELDGTDNKGRLGANAILSVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
                PL++Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A NIR+A+RMG+
Sbjct: 124 DYMGQPLFRYIGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVSATNIRDAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLK EL + G ST +GDEGGF+PN+ +   ALD I  SIEKAGY  G+D+ +ALDC
Sbjct: 184 EVFHTLKGELTAAGLSTGIGDEGGFAPNISSTRDALDFILKSIEKAGYKPGEDIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ ++K  KY +KGE   L   E   YL  LV+ YPI SIEDGMSEDDW GW  LT ++
Sbjct: 244 AATEYYKGGKYEMKGEGKSLTSAENVDYLEALVNDYPIISIEDGMSEDDWDGWNALTQRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI ++ AN++L+K NQIG+++ETL  ++ A  A + +++
Sbjct: 304 GDKIQLVGDDLFVTNPARLAMGIEQKSANSMLVKVNQIGTLTETLTAVDMAHRARFTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG+ A FAGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGETAIFAGRSIL 423


>gi|110680329|ref|YP_683336.1| phosphopyruvate hydratase [Roseobacter denitrificans OCh 114]
 gi|119369386|sp|Q164E3|ENO_ROSDO RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|109456445|gb|ABG32650.1| enolase [Roseobacter denitrificans OCh 114]
          Length = 424

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 279/420 (66%), Positives = 333/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAYEAVERRDGDKTRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A A VN EI  AL+G DA +Q+ ID  MI+LDGT NKSRLGANAILGVSLA +KAAA
Sbjct: 64  VLEACAAVNGEIADALVGLDATEQVDIDASMIELDGTANKSRLGANAILGVSLAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
                PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A+NIR+A+RMG+
Sbjct: 124 DYCTQPLYRYVGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAADNIRDAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+PN+ +   ALD I  SIEKAGY  G+++ +ALDC
Sbjct: 184 EVFHTLKKELSAAGLSTGIGDEGGFAPNINSTRDALDFILKSIEKAGYKPGEEIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ +FK  KY L GE   L   E  +YLA LV  YPI SIED MSEDDW GWK LT+ +
Sbjct: 244 AATEYFKNGKYELSGEGKSLTSEENVAYLAALVADYPIISIEDAMSEDDWDGWKALTDAL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL  GI    AN++L+K NQIG+++ETL  ++ A  AG+ +++
Sbjct: 304 GHKVQLVGDDLFVTNPERLATGIERGSANSMLVKVNQIGTLTETLKAVDMAHRAGFTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE+LG+ A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEALGETAEYAGRSIL 423


>gi|121602117|ref|YP_988847.1| phosphopyruvate hydratase [Bartonella bacilliformis KC583]
 gi|166232171|sp|A1US94|ENO_BARBK RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|120614294|gb|ABM44895.1| phosphopyruvate hydratase [Bartonella bacilliformis KC583]
          Length = 423

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 273/415 (65%), Positives = 323/415 (77%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI+ REV+DSRG+PT+EVDV LE+G  GR+ VPSGASTG HEA ELRD  KRY GKGV
Sbjct: 4   IVDIVGREVLDSRGNPTVEVDVYLENGVFGRSAVPSGASTGAHEAVELRDGGKRYQGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+A +N EI   L G DAR+QL ID+ MI LDGT NK RLGANAILGVSL+V+KAAA+
Sbjct: 64  EKAVAAINGEIFKELGGRDARNQLAIDQAMIALDGTSNKERLGANAILGVSLSVAKAAAK 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
           +  LPLY+Y+GG  AH+LP P+MNI+NGG HADN +DFQEFMI+PVGA   +EA+R GAE
Sbjct: 124 SFGLPLYRYIGGTQAHLLPTPMMNIINGGAHADNPIDFQEFMIIPVGAPTFKEAVRYGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           +FHTLK+ L+  GY+TNVGDEGGF+PNLK+A+ A++LI  SI   GY  G+ + I LDCA
Sbjct: 184 IFHTLKRYLQDAGYNTNVGDEGGFAPNLKSAEQAINLIMESITSCGYKPGEQIAIGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ F+K   Y  +GE       E   YLA+LVD YPI +IEDGM+EDDW GWK LT  IG
Sbjct: 244 STEFYKNSLYAYEGEGKCRDVKEQVEYLAHLVDSYPIITIEDGMAEDDWAGWKQLTQAIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN  RL  GI    AN+ILIK NQIG++SETL+ IE A  AGY +IIS
Sbjct: 304 NKCQLVGDDLFVTNSARLRDGIKMGAANSILIKVNQIGTLSETLDAIETAHKAGYRAIIS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           HRSGETED  IADL VATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA++ G
Sbjct: 364 HRSGETEDSFIADLTVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGTQARYEG 418


>gi|148553370|ref|YP_001260952.1| enolase [Sphingomonas wittichii RW1]
 gi|166232234|sp|A5V3E8|ENO_SPHWW RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|148498560|gb|ABQ66814.1| enolase [Sphingomonas wittichii RW1]
          Length = 427

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 274/420 (65%), Positives = 334/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AR++IDSRG+PT+EVD+ LEDGS GRA VPSGASTG +EA E RD +K R+ GKG
Sbjct: 4   IVDVHARQIIDSRGNPTVEVDITLEDGSFGRAAVPSGASTGAYEAVEKRDGDKSRWLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V  A+  VNDEI  A++G +A DQ  ID  +I+LDGTPNK RLGANAILG SL+V++AAA
Sbjct: 64  VQDAVDAVNDEIADAIIGMEAEDQSEIDARLIELDGTPNKGRLGANAILGASLSVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+Y+GG SA +LPVP+MNI+NGG HADN +DFQEFMIMPVGA  + +A+R G+
Sbjct: 124 EARALPLYRYVGGVSAQVLPVPMMNIINGGAHADNPIDFQEFMIMPVGAPTLFDAVRAGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKK L  KG +T VGDEGGF+PNL +A  ALD I  SIEKAGY  G D+++ALDC
Sbjct: 184 EIFHTLKKALHDKGLATAVGDEGGFAPNLASAPDALDFIMQSIEKAGYKPGDDVVLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y   GE ++  P EMA YLA+L  +YPI S+EDGM EDD+ GWKILT+KI
Sbjct: 244 AATEFFKDGVYDFHGEGVKRSPAEMADYLADLCARYPIVSVEDGMGEDDFEGWKILTDKI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+RL +GI + +AN++L+K NQIG++SETL  +  AQ AGY +++
Sbjct: 304 GHKVQLVGDDLFVTNPKRLAQGIKDGLANSLLVKVNQIGTLSETLEAVNMAQRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A +AGRS +
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGPVAVYAGRSAI 423


>gi|254437402|ref|ZP_05050896.1| phosphopyruvate hydratase [Octadecabacter antarcticus 307]
 gi|198252848|gb|EDY77162.1| phosphopyruvate hydratase [Octadecabacter antarcticus 307]
          Length = 424

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 271/420 (64%), Positives = 329/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG+HEA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVTLEDGTMGRAAVPSGASTGVHEAVEKRDGDKSRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VN EI   ++G DA +Q+ ID  MI+LDGT NK RLGANAILGVSLAV+KAAA
Sbjct: 64  VLQAVDSVNGEIADTIVGFDATEQVAIDMAMIELDGTDNKGRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
                PL++Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A NIR+A+RMG+
Sbjct: 124 DYMGQPLFRYIGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVSATNIRDAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLK EL + G ST +GDEGGF+PN+ +   ALD I  S+EKAGY  G+D+ +ALDC
Sbjct: 184 EVFHTLKGELTAAGLSTGIGDEGGFAPNISSTRDALDFILKSVEKAGYKPGEDIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ +++  KY +KGE   L   E   YL  LV+ YPI SIEDGMSEDDW GW  LT ++
Sbjct: 244 AATEYYEGGKYEMKGEGKSLTSAENVDYLEALVNDYPIISIEDGMSEDDWDGWNALTARL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI ++ AN++L+K NQIG+++ETL  ++ A  A + +++
Sbjct: 304 GDKIQLVGDDLFVTNPARLAMGIEQKSANSMLVKVNQIGTLTETLTAVDMAHRARFTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG+ A FAGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGETAIFAGRSIL 423


>gi|154253583|ref|YP_001414407.1| phosphopyruvate hydratase [Parvibaculum lavamentivorans DS-1]
 gi|171769672|sp|A7HXW7|ENO_PARL1 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|154157533|gb|ABS64750.1| Phosphopyruvate hydratase [Parvibaculum lavamentivorans DS-1]
          Length = 424

 Score =  558 bits (1438), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 271/419 (64%), Positives = 330/419 (78%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IIDIIGREILDSRGNPTVEVDVLLEDGSLGRAAVPSGASTGAHEAVELRDGGSRYKGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
           L AIA VN +I  A+ G DA +Q+ ID+ MI LDGT NKS LGANAILGVSLA++KA A 
Sbjct: 64  LNAIAAVNGDIFDAIGGMDASEQIQIDRTMIALDGTSNKSNLGANAILGVSLAIAKAQAA 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
           +   PL++Y+GG +A +LPVP+MNI+NGG HADN +D QEFMIMPV A ++ +A+RMG+E
Sbjct: 124 SLGQPLFRYIGGPAARVLPVPMMNIVNGGEHADNPIDIQEFMIMPVAAGSLADAVRMGSE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLK ELKS G++TNVGDEGGF+PNL + + A+  I  +IEKAGY  G D+ +ALD A
Sbjct: 184 VFHTLKAELKSAGHNTNVGDEGGFAPNLASTEEAIGFIMKAIEKAGYKPGDDIYLALDAA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK   Y L+GE  +L    M  Y A+LV +YPI SIEDGM+EDDW GWK LT++IG
Sbjct: 244 STEFFKNGVYNLQGEGKKLDAGGMVDYWADLVGKYPIISIEDGMAEDDWEGWKALTDRIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           S  QLVGDDLFVTN  RL  GI +  AN+IL+K NQIGS++ETL ++E A  A Y +++S
Sbjct: 304 SKVQLVGDDLFVTNKRRLADGIAKGTANSILVKVNQIGSLTETLESVEMAHKASYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE+LG   ++AG+S+L
Sbjct: 364 HRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEALGPSGEYAGKSVL 422


>gi|49474124|ref|YP_032166.1| enolase [Bartonella quintana str. Toulouse]
 gi|59797553|sp|Q6G173|ENO_BARQU RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|49239628|emb|CAF25987.1| Enolase [Bartonella quintana str. Toulouse]
          Length = 422

 Score =  558 bits (1438), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 270/416 (64%), Positives = 322/416 (77%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKG 61
            I DII RE++DSRG+PT+EVDV LE+G  GRA VPSGAS G HEA ELRD   RY GKG
Sbjct: 3   IIVDIIGREILDSRGNPTVEVDVHLENGIVGRAFVPSGASKGAHEAVELRDGGIRYQGKG 62

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V +A+A VN EI   L+G DAR+Q+ ID+ MI LDGTPNK+RLGANAILGVSLAV+KAAA
Sbjct: 63  VERAVAAVNGEILEELVGRDARNQIAIDQAMIALDGTPNKARLGANAILGVSLAVAKAAA 122

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           ++  LPLY+Y+GG  AH+LP P+MNI+NGG+HADN++DFQEFMI+PVGA  ++EA+R GA
Sbjct: 123 ESLCLPLYRYIGGTQAHVLPTPMMNIINGGVHADNSIDFQEFMIIPVGASTLKEAVRYGA 182

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK LK  G++TNVGDEGGF+P  K+A+ A+D I  SI   GY  G+ + + LDC
Sbjct: 183 EIFHMLKKRLKDAGHNTNVGDEGGFAPQFKSAEQAIDFIMESIITCGYKPGEQIALGLDC 242

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ F+K   Y  KGE       E   YLA LV  YPI +IEDGM+EDDW GWK+LT+ I
Sbjct: 243 ASTEFYKNGSYFYKGEGKCRNTQEQVDYLAQLVKTYPIITIEDGMAEDDWEGWKLLTDSI 302

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN  RL  GI    AN+ILIK NQIG++SETL+ +E A  A Y +II
Sbjct: 303 GKQCQLVGDDLFVTNSARLRDGIKMGAANSILIKMNQIGTLSETLDAVETAHRASYRAII 362

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED  IADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG QA +AG
Sbjct: 363 SHRSGETEDSFIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGAQACYAG 418


>gi|159044688|ref|YP_001533482.1| phosphopyruvate hydratase [Dinoroseobacter shibae DFL 12]
 gi|189037214|sp|A8LQL4|ENO_DINSH RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|157912448|gb|ABV93881.1| enolase [Dinoroseobacter shibae DFL 12]
          Length = 424

 Score =  558 bits (1437), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 274/421 (65%), Positives = 334/421 (79%), Gaps = 1/421 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I D+ ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA ELRD++  RYFGK
Sbjct: 3   LIVDVYAREILDSRGNPTVEVDVTLEDGTLGRAAVPSGASTGAYEAVELRDKDTARYFGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV  A+AFVN EI  AL+G DA DQ+ ID  MI+LDGTPNKSRLGANAILGVSLAV+KAA
Sbjct: 63  GVKTAVAFVNGEIAEALMGIDATDQVGIDSAMIELDGTPNKSRLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A+ +  PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A++I EA+RMG
Sbjct: 123 AEATGQPLYRYVGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVSADSIAEAVRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFHTLKKEL + G ST +GDEGGF+PNL +   ALD +  +IEKAGY  G+D+ +ALD
Sbjct: 183 AEVFHTLKKELSAAGLSTGIGDEGGFAPNLSSTRDALDFVLKAIEKAGYTPGEDIYLALD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           CAA+ +F+  +Y +KGE   L P     YL  LV+ YPI SIEDG SEDDW GW +LT +
Sbjct: 243 CAATEYFEDGRYEMKGEGKTLTPEANVDYLEALVNDYPILSIEDGCSEDDWEGWALLTER 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTNP RL +GI +  AN++L+K NQIG+++ETL+ ++ A       +
Sbjct: 303 LGDRVQLVGDDLFVTNPARLAEGIQKGCANSLLVKVNQIGTLTETLSAVDLAHRNRMTCV 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           +SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIE+ LG+ A +AGRSI
Sbjct: 363 MSHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEDELGETAIYAGRSI 422

Query: 421 L 421
           L
Sbjct: 423 L 423


>gi|254487497|ref|ZP_05100702.1| phosphopyruvate hydratase [Roseobacter sp. GAI101]
 gi|214044366|gb|EEB85004.1| phosphopyruvate hydratase [Roseobacter sp. GAI101]
          Length = 425

 Score =  557 bits (1436), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 278/420 (66%), Positives = 332/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVTLEDGTMGRAAVPSGASTGAYEAVERRDGDKDRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A A VN EI  AL+G DA +Q+ ID IMI+LDGT NK RLGANAILGVS+A +KAAA
Sbjct: 64  VLEACAAVNGEIAEALVGIDATEQVEIDGIMIELDGTDNKERLGANAILGVSIAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
              + PL++Y+GG SA ILPVP+MNI+NGG HADN +D QEFMIMPV A NI EAIRMGA
Sbjct: 124 DYCSQPLFRYIGGTSARILPVPMMNIINGGEHADNPIDIQEFMIMPVAASNISEAIRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+PNL +   ALD +  +IEKAG+  G+++ +ALDC
Sbjct: 184 EVFHTLKKELTTAGLSTGIGDEGGFAPNLSSTREALDFVMKAIEKAGFKPGEEIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ ++ + KY+L GE  +L   E   YLA L   YPI SIEDGMSEDDW GWK+LT ++
Sbjct: 244 AATEYYDEGKYVLSGEQKKLSSAENVDYLAALCADYPIISIEDGMSEDDWDGWKMLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI    AN++L+K NQIG++SETL  +E A  AGY +++
Sbjct: 304 GDKIQLVGDDLFVTNPARLSDGIQRGCANSMLVKVNQIGTLSETLQAVEMAHRAGYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE+LG  AK+AGRSIL
Sbjct: 364 SHRSGETEDTTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEALGITAKYAGRSIL 423


>gi|307295440|ref|ZP_07575276.1| enolase [Sphingobium chlorophenolicum L-1]
 gi|306878479|gb|EFN09699.1| enolase [Sphingobium chlorophenolicum L-1]
          Length = 424

 Score =  557 bits (1436), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 279/420 (66%), Positives = 334/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI AR+++DSRG+PT+EVDV LEDGS GRA VPSGASTG +EA E RD +  +Y GKG
Sbjct: 4   ILDIHARQILDSRGNPTVEVDVMLEDGSFGRAAVPSGASTGAYEAVEKRDGDAAKYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+A VND+I   ++G DA DQ  +D  MI LDGT NKS LGANAILGVSLAV+KAAA
Sbjct: 64  VLAAVAAVNDQIAEQIIGLDAEDQAEVDAAMIALDGTENKSNLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMIMPVGAE+I +A+R+G+
Sbjct: 124 DARGLPLYRYVGGVNAHVLPVPMMNIINGGEHADNPIDFQEFMIMPVGAESIADAVRIGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKK L  KG +T+VGDEGGF+PN+ +   ALD I  S+EKAGY  G D+++ALDC
Sbjct: 184 EIFHTLKKGLHDKGLATSVGDEGGFAPNIASTRDALDFIMLSVEKAGYRPGDDVVLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK  KY + GE L L P EMA YLA L   YPI SIEDGMSEDD+ GWK LT+KI
Sbjct: 244 AATEFFKNGKYEISGEGLSLSPVEMADYLAALCADYPIKSIEDGMSEDDFEGWKALTDKI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+RL  GI + +AN++L+K NQIGS++ETL  ++ A  A Y +++
Sbjct: 304 GGKVQLVGDDLFVTNPKRLEMGIGKGLANSLLVKVNQIGSLTETLAAVDMAHRARYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A +AGRSI 
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGDIAVYAGRSIF 423


>gi|254469853|ref|ZP_05083258.1| phosphopyruvate hydratase [Pseudovibrio sp. JE062]
 gi|211961688|gb|EEA96883.1| phosphopyruvate hydratase [Pseudovibrio sp. JE062]
          Length = 424

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 273/419 (65%), Positives = 333/419 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG  EA E RD  +RY GKGV
Sbjct: 4   IIDIIGREILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAFEAVERRDGGERYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
             A+  VN EI  A+ G DA DQ+ ID+ MI+LDGT NK RLGANAILGVSLAV+KAAA+
Sbjct: 64  EDAVEAVNGEIFDAIGGMDAEDQIKIDRAMIELDGTDNKGRLGANAILGVSLAVAKAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            + +PLY+Y+GG  A  LPVP+MNI+NGG HADN +DFQEFMIMPVGA ++RE++RMGAE
Sbjct: 124 AAAMPLYRYVGGFGARTLPVPMMNIINGGEHADNPIDFQEFMIMPVGASSLRESVRMGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           +FHTLKK L S G++TNVGDEGGF+P + + D A+  + N+IEKAGY  G D+++A D A
Sbjct: 184 IFHTLKKGLSSAGHNTNVGDEGGFAPGIGSTDEAIGFVLNAIEKAGYTPGDDVMLAFDAA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ F+K  KY LKGE   L  +EM  YL +LV +YP++SIEDGM+E+DW GWK LT  IG
Sbjct: 244 STEFYKDGKYNLKGEGKILGSDEMVRYLEDLVSKYPVFSIEDGMAEEDWDGWKSLTQAIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           + CQLVGDDLFVTN ERL +GI  + AN+IL+K NQIGS++ET+  ++ A  A Y S++S
Sbjct: 304 NKCQLVGDDLFVTNSERLARGIKNDTANSILVKVNQIGSLTETMEAVDMAHRANYTSVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED+TIADLAVA NCGQIKTGSL+RSDR+AKYNQLIRIEE LG Q  FAGRSIL
Sbjct: 364 HRSGETEDNTIADLAVAFNCGQIKTGSLSRSDRMAKYNQLIRIEEELGVQGVFAGRSIL 422


>gi|89054288|ref|YP_509739.1| phosphopyruvate hydratase [Jannaschia sp. CCS1]
 gi|119369337|sp|Q28RE8|ENO_JANSC RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|88863837|gb|ABD54714.1| enolase [Jannaschia sp. CCS1]
          Length = 425

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/420 (64%), Positives = 325/420 (77%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVTLEDGTMGRAAVPSGASTGAYEAVEKRDGDKARYKGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  VN EI   L+G DA +Q+ ID+ M +LDGT NK RLGANAILGVSLA +KAAA
Sbjct: 64  VLAAVEAVNGEIADTLVGFDATEQVAIDQTMCELDGTDNKGRLGANAILGVSLATAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PLY+Y+GG  AH+LPVP+MNI+NGG HADN +D QEFMIMPV A +I EA+RMG+
Sbjct: 124 DFTAQPLYRYVGGTMAHVLPVPMMNIINGGEHADNPIDIQEFMIMPVSATSIAEAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLK EL + G ST +GDEGGF+PNL +   ALD +  SIEKAGY  G D+++ALDC
Sbjct: 184 EVFHTLKSELSAAGLSTGIGDEGGFAPNLSSTRDALDFVLKSIEKAGYAPGDDMVLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ +++  KY L GE   L  +E  +YLA LV  YPI+SIEDGM EDDW GW  LT  +
Sbjct: 244 AATEYYRDGKYELSGEGKSLTSDENVAYLAALVANYPIFSIEDGMGEDDWDGWIALTEAL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI+ + AN++L+K NQIG+++ETL  +  A  AG+ S++
Sbjct: 304 GDKVQLVGDDLFVTNPARLKDGIDRKAANSLLVKVNQIGTLTETLAAVNMATRAGFTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE L + A FAGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEQLEETANFAGRSIL 423


>gi|255262850|ref|ZP_05342192.1| phosphopyruvate hydratase [Thalassiobium sp. R2A62]
 gi|255105185|gb|EET47859.1| phosphopyruvate hydratase [Thalassiobium sp. R2A62]
          Length = 424

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 273/420 (65%), Positives = 331/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAYEAVEKRDGDKARYKGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   L+G DA +Q+ ID  MI+LDGTPNK+RLGANAILGVS+AV+KAAA
Sbjct: 64  VLEAVAAVNGEIAEELVGFDASEQVAIDGAMIELDGTPNKARLGANAILGVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PLY+Y+GG SA ILPVP+MNI+NGG HADN +D QEFMIMPV A+NIREA+RMG+
Sbjct: 124 DFTTQPLYRYIGGTSARILPVPMMNIINGGEHADNPIDIQEFMIMPVAADNIREAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLK EL +   ST +GDEGGF+PNL ++  ALD I  SIEKAGY  G+D+ +ALDC
Sbjct: 184 EVFHTLKGELSAADLSTGIGDEGGFAPNLSSSRDALDFILKSIEKAGYKPGEDIYLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ +     Y +KGE   L  +E  +YL  LV+ YPI SIEDG  EDDW GWK LT+ +
Sbjct: 244 AATEYCHNGVYEMKGEGKSLSSDENVAYLEALVNDYPIISIEDGCDEDDWGGWKALTDTL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL  GI +  AN++L+K NQIG+++ETL  ++ A  A +  ++
Sbjct: 304 GGRIQLVGDDLFVTNPERLATGIEQGSANSLLVKVNQIGTLTETLKAVDMAHRAQFTCVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE+L + A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEALAETAEYAGRSIL 423


>gi|294011433|ref|YP_003544893.1| enolase [Sphingobium japonicum UT26S]
 gi|292674763|dbj|BAI96281.1| enolase [Sphingobium japonicum UT26S]
          Length = 424

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 279/420 (66%), Positives = 334/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DI AR+++DSRG+PT+EVDV LEDGS GRA VPSGASTG +EA E RD +  +Y GKG
Sbjct: 4   ILDIHARQILDSRGNPTVEVDVMLEDGSFGRAAVPSGASTGAYEAVEKRDGDATKYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+A VND+I   ++G DA DQ  +D  MI LDGT NKS LGANAILGVSLAV+KAAA
Sbjct: 64  VLAAVAAVNDQIAEQIIGLDAEDQAEVDAAMIALDGTDNKSNLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+Y+GG +AH+LPVP+MNI+NGG HADN +DFQEFMIMPVGAE+I +A+R+G+
Sbjct: 124 DARGLPLYRYVGGVNAHVLPVPMMNIINGGEHADNPIDFQEFMIMPVGAESIADAVRIGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKK L  KG +T+VGDEGGF+PN+ +   ALD I  S+EKAGY  G D+++ALDC
Sbjct: 184 EIFHTLKKGLHDKGLATSVGDEGGFAPNIASTRDALDFIMLSVEKAGYKPGDDVVLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK  KY + GE L L P EMA YLA L   YPI SIEDGMSEDD+ GWK LT+KI
Sbjct: 244 AATEFFKNGKYEISGEGLSLSPVEMADYLAALCADYPIKSIEDGMSEDDFEGWKALTDKI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+RL  GI + +AN++L+K NQIGS++ETL  ++ A  A Y +++
Sbjct: 304 GGKVQLVGDDLFVTNPKRLEMGIGKGLANSLLVKVNQIGSLTETLAAVDMAHRARYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A +AGRSI 
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGDIALYAGRSIF 423


>gi|258542194|ref|YP_003187627.1| phosphopyruvate hydratase [Acetobacter pasteurianus IFO 3283-01]
 gi|256633272|dbj|BAH99247.1| phosphopyruvate hydratase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636331|dbj|BAI02300.1| phosphopyruvate hydratase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639384|dbj|BAI05346.1| phosphopyruvate hydratase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642440|dbj|BAI08395.1| phosphopyruvate hydratase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645495|dbj|BAI11443.1| phosphopyruvate hydratase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648548|dbj|BAI14489.1| phosphopyruvate hydratase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651601|dbj|BAI17535.1| phosphopyruvate hydratase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654592|dbj|BAI20519.1| phosphopyruvate hydratase [Acetobacter pasteurianus IFO 3283-12]
          Length = 426

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/420 (63%), Positives = 328/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DIIARE++DSRG+PT+EVDV L   + GRA VPSGASTG HEA ELRD + KR+ GKG
Sbjct: 4   IVDIIAREILDSRGNPTVEVDVELASSARGRAAVPSGASTGAHEAVELRDGDPKRFGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  + +EI   L G ++ DQ+ ID  MIDLDGTPNKSR+GANAILGVSLA++KA A
Sbjct: 64  VLKAVENIENEILPTLQGAESADQIDIDNAMIDLDGTPNKSRMGANAILGVSLAIAKATA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
              ++PLY+Y+GG  AH+LPVP+MNI+NGG HADN +D QEFM+ PVGA  + +AIR G+
Sbjct: 124 AELHVPLYRYIGGVFAHVLPVPMMNIVNGGEHADNPIDIQEFMVQPVGAPTVADAIRWGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+F  LKK L + GY+TNVGDEGGF+P LK+AD AL  I  ++E AGY  G+D+  ALDC
Sbjct: 184 EIFAQLKKALSAAGYNTNVGDEGGFAPALKSADEALGFITRAVEAAGYRPGEDVTFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY LKGE        M SYL++LV +YPI SIEDGM+EDDW GW +LT ++
Sbjct: 244 ASTEFFKDGKYNLKGEGKVFDSAGMVSYLSDLVSRYPIVSIEDGMAEDDWEGWALLTQEL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI   VAN++L+K NQIG+++ETL  +E A  AGY +++
Sbjct: 304 GKKIQLVGDDLFVTNPERLRRGIQAGVANSLLVKVNQIGTLTETLQAVEMAHHAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR AKYNQLIRIE+ L   A++AGR+IL
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRTAKYNQLIRIEQELATAARYAGRTIL 423


>gi|296116171|ref|ZP_06834789.1| phosphopyruvate hydratase [Gluconacetobacter hansenii ATCC 23769]
 gi|295977277|gb|EFG84037.1| phosphopyruvate hydratase [Gluconacetobacter hansenii ATCC 23769]
          Length = 426

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 268/420 (63%), Positives = 326/420 (77%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DIIARE++DSRG+PT+EVDV L  G+ GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IIDIIAREILDSRGNPTVEVDVELASGAKGRAAVPSGASTGAHEAVELRDGDKSRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  V ++I +AL G ++ DQ+ ID+ MIDLDGTPNKSRLGANAILGVSLAV+KA A
Sbjct: 64  VLKAVGNVENDILSALQGAESSDQVAIDEAMIDLDGTPNKSRLGANAILGVSLAVAKATA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   +P Y+Y+GG  A  LPVP+MNI+NGG HADN +D QEFMI PVGA  + +AIRMG+
Sbjct: 124 EELQVPFYRYVGGVYARTLPVPMMNIINGGQHADNPIDIQEFMIQPVGAPTVTDAIRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+F  LKK L   GY+TNVGDEGGF+P LK+AD AL  I+ ++E AGY  G D+  ALDC
Sbjct: 184 EIFAQLKKSLSGAGYNTNVGDEGGFAPALKSADEALGFISRAVEAAGYRPGDDVTFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ F+   +Y LKGE   L    M +YLA+L  +YPI SIEDG++EDDW GW  LT  +
Sbjct: 244 AATEFYHDGRYELKGEGKSLDAGGMIAYLADLAARYPIVSIEDGLAEDDWEGWAELTANL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+RL +GI   VAN++L+K NQIG++SETL  ++ AQ AGY +++
Sbjct: 304 GGKLQLVGDDLFVTNPDRLRRGIKAGVANSLLVKVNQIGTLSETLEAVQMAQHAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR AKYNQLIRIE  L   A++AGR+IL
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRTAKYNQLIRIENELATAARYAGRTIL 423


>gi|304321947|ref|YP_003855590.1| hypothetical protein PB2503_12024 [Parvularcula bermudensis
           HTCC2503]
 gi|303300849|gb|ADM10448.1| hypothetical protein PB2503_12024 [Parvularcula bermudensis
           HTCC2503]
          Length = 424

 Score =  555 bits (1431), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/419 (63%), Positives = 323/419 (77%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI ARE++DSRG+PT+EVDV  EDG  GRA VPSGASTG+HEA E RD  +RY GKGV
Sbjct: 4   IIDINAREILDSRGNPTVEVDVFTEDGVMGRAAVPSGASTGVHEAHERRDGGERYGGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
             A+  VN  I  A++G D  +Q+ ID+ MIDLDG+PNK+ LGANAILGVSLAV+KAAA+
Sbjct: 64  RGAVDAVNSSIFEAIVGLDVEEQVFIDEAMIDLDGSPNKASLGANAILGVSLAVAKAAAK 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            +  PLY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMP GA +  EA+RMGAE
Sbjct: 124 QTGQPLYRYVGGVSADLLPVPMMNIVNGGAHADNPIDIQEFMIMPTGAGSFAEALRMGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
            FH LK ELK+ G++TNVGDEGGF+P L + D ALD I  +I+KAGY AG D+ +ALD A
Sbjct: 184 TFHALKAELKAAGHNTNVGDEGGFAPTLSSTDEALDFIMKAIDKAGYTAGDDMHLALDVA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ F+K  KY L+GE   L    M  YL  LVD YPI SIEDGM+EDDW GW  LT KIG
Sbjct: 244 STEFYKDGKYHLEGEGKTLDAAGMTDYLVRLVDAYPIISIEDGMAEDDWDGWVTLTEKIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
             CQLVGDDLFVTN +RL  G+ +  AN+IL+K NQIG+++ET+  + +A   GY +++S
Sbjct: 304 DRCQLVGDDLFVTNEKRLVTGLEKGAANSILVKVNQIGTLTETMRAVSRAHRGGYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVAT CGQIKTGSLAR+DR AKYNQL+RIEE LG  A+FAG+SIL
Sbjct: 364 HRSGETEDTTIADLAVATACGQIKTGSLARADRTAKYNQLLRIEEDLGPSARFAGKSIL 422


>gi|296444652|ref|ZP_06886616.1| enolase [Methylosinus trichosporium OB3b]
 gi|296257920|gb|EFH04983.1| enolase [Methylosinus trichosporium OB3b]
          Length = 427

 Score =  555 bits (1431), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 268/420 (63%), Positives = 338/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGKG 61
           I DI ARE++DSRG+PT+EV+V LEDGS+GRA VPSGASTG HEA E RD  +KR+ GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVEVTLEDGSSGRAAVPSGASTGAHEAVEKRDGDKKRFLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  VNDEI + L+G +A +Q  ID+ +I+LD TPNKSRLGANAILGVSLAV+KAAA
Sbjct: 64  VLGAVQSVNDEIASELMGMEAEEQATIDEALIELDDTPNKSRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + ++LPLY+Y+GG  A +LPVP+MNI+NGG+HADN +DFQEFMI+PVGA  +REA+R GA
Sbjct: 124 EAASLPLYRYIGGVQARVLPVPMMNIINGGVHADNPIDFQEFMILPVGAPTLREAVRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLK  LK  G ST+VGDEGGF+PNL +A++ALD+I  +I  AG+  G+D+ +  DC
Sbjct: 184 EVFHTLKAALKKAGLSTSVGDEGGFAPNLPSAEAALDIIVEAIAAAGFVPGEDIYLGADC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK  KY+ +GE L     E  +YLA L D YPI +IEDGM+EDDW GW++LT+ +
Sbjct: 244 AATEFFKDGKYVYEGEKLSRSIEEQVAYLAKLADSYPIVTIEDGMAEDDWEGWRLLTDTL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDD+FVTN +RL +GI+E+VAN++L+K NQIG+++ETL  +E A  A Y ++I
Sbjct: 304 GDKIQLVGDDIFVTNVDRLSRGIDEDVANSLLVKVNQIGTLTETLAAVEMAHRAAYTTVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIAD++VATN GQIKTGSLARSDR+AKYNQLIRIEE LG  A +AGR+ L
Sbjct: 364 SHRSGETEDSTIADISVATNSGQIKTGSLARSDRVAKYNQLIRIEEELGPAAIYAGRNAL 423


>gi|56552504|ref|YP_163343.1| phosphopyruvate hydratase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241762253|ref|ZP_04760335.1| Phosphopyruvate hydratase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|260753833|ref|YP_003226726.1| enolase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|59802545|sp|P33675|ENO_ZYMMO RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|56544078|gb|AAV90232.1| Phosphopyruvate hydratase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373300|gb|EER62919.1| Phosphopyruvate hydratase [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|258553196|gb|ACV76142.1| enolase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 429

 Score =  554 bits (1428), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 276/422 (65%), Positives = 337/422 (79%), Gaps = 3/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I  I  R+V+DSRG+PT+EVDV LEDGS GRA VPSGASTG+HEA ELRD +K R+ GKG
Sbjct: 4   IVSIHGRQVVDSRGNPTVEVDVTLEDGSFGRAAVPSGASTGVHEAVELRDGDKTRWGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+EI  A++G +A DQ LID+ MI LDGTPNK + GANAILGVSLAV+KAAA
Sbjct: 64  VTKAVHAVNNEIANAIIGLEAEDQELIDQTMIKLDGTPNKGKFGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+Y+GG +AH+LPVP+MNI+NGG+HADN +DFQEFMI PVGA +I EA+R+G 
Sbjct: 124 EARGLPLYRYVGGTAAHVLPVPMMNIVNGGMHADNPIDFQEFMIAPVGASSINEAVRIGT 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL +KG +TNVGDEGGF+P+L +A SALD I +SI KAGY  G+D+ IALD 
Sbjct: 184 EVFHTLKKELSAKGMNTNVGDEGGFAPSLDSASSALDFIVDSISKAGYKPGEDVFIALDA 243

Query: 242 AASAFFKKEK--YILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           A+S F+ K++  Y LKGE  +L   ++  Y   L  +YPIYSIEDG++EDD+ GWKILT 
Sbjct: 244 ASSEFYNKDQNIYDLKGEGRKLTSAQLVDYYVELCGKYPIYSIEDGLAEDDFEGWKILTE 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           K+G   QLVGDDLFVTN +RL  GI   +AN++L+K NQIGS+SETL  +  A  A Y +
Sbjct: 304 KLGDKVQLVGDDLFVTNVKRLSDGIERGIANSLLVKFNQIGSLSETLAAVNMANDASYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ++SHRSGETED TIADLAVATNCGQIKTGSL RS+RIAKYNQL+RIEE LG  AK+AGRS
Sbjct: 364 VMSHRSGETEDTTIADLAVATNCGQIKTGSLCRSERIAKYNQLMRIEEELGSVAKYAGRS 423

Query: 420 IL 421
           +L
Sbjct: 424 VL 425


>gi|329889603|ref|ZP_08267946.1| phosphopyruvate hydratase [Brevundimonas diminuta ATCC 11568]
 gi|328844904|gb|EGF94468.1| phosphopyruvate hydratase [Brevundimonas diminuta ATCC 11568]
          Length = 425

 Score =  554 bits (1428), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 272/421 (64%), Positives = 332/421 (78%), Gaps = 1/421 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFG-KG 61
           I DI+AR+++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K  +G KG
Sbjct: 4   IVDIVARQILDSRGNPTVEVDVILEDGSFGRAAVPSGASTGAHEAVELRDGDKDMWGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN EI  AL G DA DQ  ID+ +I+LDGT NKSRLGANA+LGVSLAV+KA+A
Sbjct: 64  VEKAVDAVNGEIFDALSGMDAEDQRRIDEALIELDGTENKSRLGANAMLGVSLAVAKASA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            ++ LPL++Y+GG SA ILP P+MNI+NGG HADN +D QEFMIMP GAEN  EA+RMGA
Sbjct: 124 ISAGLPLHRYIGGVSARILPTPMMNIINGGAHADNPIDIQEFMIMPTGAENFSEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK LK  G++TNVGDEGGF+PNL +AD AL  I  + + AGY AG+D  +ALD 
Sbjct: 184 EIFHALKKALKDAGHNTNVGDEGGFAPNLASADEALTFITKAGQAAGYLAGEDFHLALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY L GE        M +YLA+LV+++PI SIEDG +EDD+ GWK+LT+++
Sbjct: 244 ASTEFFKNGKYELTGEGKSFDAEGMVNYLADLVERFPIVSIEDGCAEDDFDGWKLLTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI E +AN+ILIK NQIG++SETL+ ++ A  AGY +++
Sbjct: 304 GDRVQLVGDDLFVTNPRRLAAGIGEGLANSILIKVNQIGTLSETLDAVDMAHRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQL+RIEE LG QA + G  +L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLLRIEEMLGDQAAYFGDGML 423

Query: 422 I 422
           +
Sbjct: 424 L 424


>gi|89068833|ref|ZP_01156216.1| enolase [Oceanicola granulosus HTCC2516]
 gi|89045603|gb|EAR51666.1| enolase [Oceanicola granulosus HTCC2516]
          Length = 424

 Score =  554 bits (1428), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 276/420 (65%), Positives = 325/420 (77%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PTIEVDV LEDG+ GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTIEVDVTLEDGTMGRAAVPSGASTGAYEAVEKRDGDKGRYKGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   +LG DA DQ+ ID  MI+LDGT NK+RLGANAILGVSLA +KAAA
Sbjct: 64  VLEAVAAVNGEIAETILGADATDQVEIDLAMIELDGTDNKARLGANAILGVSLATAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             S  PL++Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A +I EA+R G+
Sbjct: 124 IYSGQPLFRYVGGTSARMLPVPMMNIINGGEHADNPIDIQEFMIMPVAATSIAEAVRFGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL   G ST +GDEGGF+PNL +   ALD I  SIEKAG+  G D+ +ALDC
Sbjct: 184 EVFHTLKKELSDAGLSTGLGDEGGFAPNLGSTREALDFILKSIEKAGFTPGDDIHLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ +FK   Y + GE  +L P E  +YL  LV  YPI SIEDG SEDDW GW  L   +
Sbjct: 244 AATEYFKNGVYDMVGEGKKLSPEENVAYLEALVKDYPIISIEDGCSEDDWDGWVALNAAL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTNP+RL  GI +  AN++L+K NQIGS++ETL  +E A  AG  +++
Sbjct: 304 GERCQLVGDDLFVTNPKRLKMGIEKRAANSMLVKVNQIGSLTETLQAVEMAHRAGMTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A++AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGSAAEYAGRSIL 423


>gi|260576397|ref|ZP_05844388.1| enolase [Rhodobacter sp. SW2]
 gi|259021468|gb|EEW24773.1| enolase [Rhodobacter sp. SW2]
          Length = 425

 Score =  554 bits (1428), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 274/420 (65%), Positives = 337/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DI ARE++DSRG+PTIEVDV LE G+ GRA VPSGASTG HEA E RD +  RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTIEVDVTLESGAMGRAAVPSGASTGAHEAHERRDGDPSRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN E+   L+G DA +Q+ ID+ MI++DGTPNKSRLGANAILG+SLAV+KAAA
Sbjct: 64  VLEAVAAVNGELAEELVGFDATEQVGIDRTMIEMDGTPNKSRLGANAILGISLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           Q +   LY+Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A+NIREA+RMG+
Sbjct: 124 QVTGQELYRYVGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAADNIREAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKK+L   G ST++GDEGGF+PNL +   ALD+I  SIE AGY  G+D+ +A+DC
Sbjct: 184 EVFHTLKKQLSKAGLSTSIGDEGGFAPNLSSTRDALDIILKSIEIAGYRPGEDIYLAMDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ ++K  KY++KGE   L   E  +YLA L   YPI SIEDG SEDDW GWK+LT  +
Sbjct: 244 AATEYYKNGKYVMKGEGKTLTSEENVAYLAALAADYPIISIEDGCSEDDWAGWKLLTETL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTNP RL +GI +  AN++L+K NQIG+++ETL  ++ A  A Y +++
Sbjct: 304 GNKLQLVGDDLFVTNPLRLAEGIAKGCANSMLVKVNQIGTLTETLAAVDMAHRARYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE+LG+ A+FAGRSIL
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEETLGEVAEFAGRSIL 423


>gi|83310922|ref|YP_421186.1| enolase [Magnetospirillum magneticum AMB-1]
 gi|119369342|sp|Q2W698|ENO_MAGSA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|82945763|dbj|BAE50627.1| Enolase [Magnetospirillum magneticum AMB-1]
          Length = 425

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 276/420 (65%), Positives = 331/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI  RE++DSRG+PT+EVDV LE G  GRA VPSGASTG+HEA ELRD +K RY GKG
Sbjct: 4   IIDIHGREILDSRGNPTVEVDVVLETGVIGRAAVPSGASTGVHEACELRDGDKQRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA   VN EI  AL G D  DQ+L+DK MIDLDGT NKSRLGANAILGVSLA +KAAA
Sbjct: 64  VQKACDSVNGEIYDALSGMDVEDQILLDKTMIDLDGTANKSRLGANAILGVSLAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y+GG  A  LPVP+MNI+NGG HADN +D QEFMIMPVGA +  EAIRMGA
Sbjct: 124 EESGLPLYRYVGGAFASTLPVPMMNIINGGAHADNPIDIQEFMIMPVGASSCSEAIRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK LK  G++TNVGDEGGF+PNLK+A+ ALD I  SIE AGY  G+D+++ALDC
Sbjct: 184 EVFHALKKTLKDAGHNTNVGDEGGFAPNLKSAEMALDFIMKSIETAGYKPGEDIMLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S FFK+ KY++ G         +  + A LV  YPI SIEDG +EDD  GW++LT+ +
Sbjct: 244 ASSEFFKEGKYVMAGAKKTYDQKGLVKFYAKLVGSYPIISIEDGCAEDDLVGWELLTDAL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTNP RL  GI++ +AN+IL+K NQIG++SETL  ++ A  AGY +++
Sbjct: 304 GAKVQLVGDDLFVTNPARLSMGIDQGLANSILVKVNQIGTLSETLEAVDMAHKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDRIAKYNQLIRIEE LG  A++AG++I+
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRIAKYNQLIRIEELLGSAARYAGQTIM 423


>gi|167646724|ref|YP_001684387.1| phosphopyruvate hydratase [Caulobacter sp. K31]
 gi|189037204|sp|B0SYX8|ENO_CAUSK RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|167349154|gb|ABZ71889.1| Phosphopyruvate hydratase [Caulobacter sp. K31]
          Length = 426

 Score =  553 bits (1426), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 275/420 (65%), Positives = 336/420 (80%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DIIARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD +K RY GKG
Sbjct: 4   IVDIIAREILDSRGNPTVEVDVVLEDGAFGRAAVPSGASTGAHEAVEKRDGDKSRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V  A+  VN E+  AL G DA DQ  ID +MI LDGTPNKSRLGANAILGVSLAV+KAAA
Sbjct: 64  VKSAVDAVNGELFDALSGVDAEDQRRIDNLMIALDGTPNKSRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +++ LPLYKY+GG SA +LPVP+MNI+NGG HADN +D QEFMI+P G+    EA+RMGA
Sbjct: 124 ESAGLPLYKYVGGVSARVLPVPMMNIINGGAHADNPIDIQEFMILPTGSPTFAEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK LK  G++TNVGDEGGF+PNL +A+ AL  I  + E AGY +G+D ++ LD 
Sbjct: 184 EIFHGLKKALKDAGHNTNVGDEGGFAPNLGSAEDALAFIVKAGEAAGYKSGEDFVLGLDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK  KY L+GE   L P +M  YLA L D++PI SIEDGMSEDD+ GWK+LT+K+
Sbjct: 244 AATEFFKNGKYELEGEGKSLDPAQMVDYLAGLADKFPILSIEDGMSEDDFDGWKLLTDKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+RL  G+++ +AN+ILIK NQIG++SET++ ++ A  A Y S++
Sbjct: 304 GKKVQLVGDDLFVTNPKRLQIGLDKGLANSILIKVNQIGTLSETIDAVDMAHRAAYTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVA NCGQIKTGSLARSDR+AKYNQL+RIEE+L  QA +AGR++L
Sbjct: 364 SHRSGETEDSTIADLAVALNCGQIKTGSLARSDRLAKYNQLLRIEEALDDQAVYAGRAVL 423


>gi|209963464|ref|YP_002296379.1| phosphopyruvate hydratase, putative [Rhodospirillum centenum SW]
 gi|238064662|sp|B6IQ30|ENO_RHOCS RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|209956930|gb|ACI97566.1| phosphopyruvate hydratase, putative [Rhodospirillum centenum SW]
          Length = 426

 Score =  553 bits (1426), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 268/420 (63%), Positives = 330/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EV+V LE G+ GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVEVRLESGAFGRAAVPSGASTGAHEAVELRDGDKARYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VN EI   L G +A +Q+ ID IMI+LDGTPNK+RLGANAILGVSLAV+KAAA
Sbjct: 64  VLRAVESVNGEIFDTLSGLEATEQVAIDSIMIELDGTPNKNRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
              + PLY+Y+GG +A  LPVP+MNI+NGG HADN +D QEFM+MPVGAE   ++IRMGA
Sbjct: 124 DELDQPLYRYVGGTNARTLPVPMMNIINGGAHADNPIDIQEFMVMPVGAETCADSIRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK+LK  G++T VGDEGGF+PNLK+ D AL  I  ++E AGY  G+D+L+ALD 
Sbjct: 184 EIFHALKKKLKDAGHNTAVGDEGGFAPNLKSTDEALGFIMKAVEAAGYRPGEDVLLALDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ F++  +Y L GE   L    M +Y  +LV +YPI S+EDGM+EDDW GWK LT+ I
Sbjct: 244 ASTEFYRNGRYELAGEGKSLDAAGMVAYWQDLVGRYPIVSVEDGMAEDDWDGWKALTDAI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G + QLVGDDLFVTNP RL +GI+  +AN+IL+K NQIGS++ETL  +  AQ  GY +++
Sbjct: 304 GGSVQLVGDDLFVTNPTRLSEGISRGIANSILVKVNQIGSLTETLEAVRIAQSNGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDRIAKYNQLIRIEE LG+   F GR+ L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRIAKYNQLIRIEEGLGRARIFPGRAAL 423


>gi|162147711|ref|YP_001602172.1| phosphopyruvate hydratase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542335|ref|YP_002274564.1| phosphopyruvate hydratase [Gluconacetobacter diazotrophicus PAl 5]
 gi|189037218|sp|A9HJ75|ENO_GLUDA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|161786288|emb|CAP55870.1| Enolase protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530012|gb|ACI49949.1| Phosphopyruvate hydratase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 426

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 262/420 (62%), Positives = 327/420 (77%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ARE++DSRG+PT+EVDV L  G+ GRA VPSGASTG HEA ELRD +K R+ GKG
Sbjct: 4   IVDIVAREILDSRGNPTVEVDVELASGAKGRAAVPSGASTGAHEAVELRDGDKSRFGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  V  EI  AL G ++ DQ+ ID+ MIDLDGTPNK+RLGANAIL VSLAV+KA+A
Sbjct: 64  VLKAVEHVETEILEALQGAESMDQVAIDEAMIDLDGTPNKARLGANAILAVSLAVAKASA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   +PLY+Y+GG  A  LPVP+MNI+NGG HADN +D QEFMI PVGA  + +A+R+G+
Sbjct: 124 EELQIPLYRYVGGVYARTLPVPMMNIVNGGQHADNPIDIQEFMIQPVGAPTLADAVRVGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+F  LKK L + G++TNVGDEGGF+P LK+AD AL  I  ++E AGY  G D+  ALDC
Sbjct: 184 EIFAQLKKNLSAAGHNTNVGDEGGFAPGLKSADDALGFITKAVEAAGYRPGDDVTFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ F++   Y+++GE   L    M +YLA+L  +YPI SIEDG++EDDW GW +LT  +
Sbjct: 244 AATEFYRDGLYVMEGEGKTLDSAGMVAYLADLAARYPIVSIEDGLAEDDWEGWAVLTATL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+RL +GI   VAN++L+K NQIG++SETL  +E AQ AGY +++
Sbjct: 304 GKTVQLVGDDLFVTNPDRLRRGIKAGVANSLLVKVNQIGTLSETLEAVETAQRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR AKYNQLIRIE  L   A++AGR+IL
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRTAKYNQLIRIENELATAARYAGRTIL 423


>gi|315499908|ref|YP_004088711.1| enolase [Asticcacaulis excentricus CB 48]
 gi|315417920|gb|ADU14560.1| enolase [Asticcacaulis excentricus CB 48]
          Length = 425

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 276/420 (65%), Positives = 334/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD +K RY GKG
Sbjct: 4   IIDIVAREILDSRGNPTVEVDVTLEDGAFGRAAVPSGASTGAHEAVEKRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V +A+  VN EI  AL G DARDQ  ID+I+I+LDGT NK+RLGANAILGVSLAV+KAAA
Sbjct: 64  VRQAVDAVNGEIYEALSGLDARDQRHIDQILINLDGTENKARLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + NLPLYKY+GG SA +LPVPLMNI+NGG HADN +D QEFMI+P GAE   EA+RMGA
Sbjct: 124 ASVNLPLYKYVGGLSARVLPVPLMNIINGGAHADNPIDIQEFMIVPAGAETFSEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH+LK  LK  G++TNVGDEGGF+PNL +A+ AL  I ++   AGY AG+D  +ALD 
Sbjct: 184 EIFHSLKSALKKAGHNTNVGDEGGFAPNLSSAEVALQFIVDAGTAAGYKAGEDYWLALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK EKY L+GE   L   EM  YLANL D++PI SIEDGMSEDD+ GW +LT ++
Sbjct: 244 ASTEFFKDEKYHLEGEGKVLSREEMVDYLANLADKFPICSIEDGMSEDDFEGWALLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI E +AN+IL+K NQIG++SET++ ++ A  +GY S++
Sbjct: 304 GDRLQLVGDDLFVTNPSRLETGIVEGLANSILVKVNQIGTLSETMDAVDMAHRSGYTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVA NCGQIKTGSLARSDR+AKYNQL+RIE  L  +A FAG S++
Sbjct: 364 SHRSGETEDSTIADLAVALNCGQIKTGSLARSDRLAKYNQLLRIESILDDEAVFAGLSVI 423


>gi|312113883|ref|YP_004011479.1| enolase [Rhodomicrobium vannielii ATCC 17100]
 gi|311219012|gb|ADP70380.1| enolase [Rhodomicrobium vannielii ATCC 17100]
          Length = 447

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 276/419 (65%), Positives = 330/419 (78%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DII RE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD   RY GKGV
Sbjct: 25  ITDIIGREILDSRGNPTVEVDVMLEDGAVGRAAVPSGASTGAHEANEKRDGGARYLGKGV 84

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
           L+A+  VN EI  AL G DA DQ  ID+ +IDLDGT NKSRLGANAILGVSLAV+KAA+ 
Sbjct: 85  LQAVDAVNGEIYDALQGFDAEDQRRIDQTLIDLDGTENKSRLGANAILGVSLAVAKAASI 144

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            ++ PLY+YLGG +A +LPVP+MNI+NGG HADN +DFQEFMI P+GA  + EA+R GAE
Sbjct: 145 AADAPLYRYLGGVNARVLPVPMMNIINGGAHADNPIDFQEFMISPLGAPTLAEAVRWGAE 204

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLKK LK  G+STNVGDEGGF+PNLK+AD AL  +  +IEKAGY  G+++ IALD A
Sbjct: 205 VFHTLKKLLKDGGHSTNVGDEGGFAPNLKSADEALTFVVRAIEKAGYKPGEEIAIALDPA 264

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ F+K  KY L GE   L   +M +   +LV +YPI SIEDGM+EDDW GWK LT++IG
Sbjct: 265 STEFYKNGKYELAGEGKSLDAGQMVALYRDLVSRYPIISIEDGMAEDDWEGWKALTDEIG 324

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
               LVGDDLFVTNP+RL +GI +   NAIL+K NQIG++SE L+ ++ AQ A + ++IS
Sbjct: 325 GKVNLVGDDLFVTNPKRLREGIAKGAGNAILVKVNQIGTLSEALDAVDIAQRASFKAVIS 384

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIAD+AVATN GQIKTGSL+RSDRIAKYNQLIRIEE LG  A FAGRSIL
Sbjct: 385 HRSGETEDSTIADIAVATNAGQIKTGSLSRSDRIAKYNQLIRIEEELGDTAVFAGRSIL 443


>gi|330994775|ref|ZP_08318697.1| Enolase [Gluconacetobacter sp. SXCC-1]
 gi|329758036|gb|EGG74558.1| Enolase [Gluconacetobacter sp. SXCC-1]
          Length = 463

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 270/420 (64%), Positives = 327/420 (77%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DIIARE++DSRG+PTIEVDV L  G+ GRA VPSGASTG HEA ELRD + KR+ GKG
Sbjct: 41  IIDIIAREILDSRGNPTIEVDVELASGAKGRAAVPSGASTGAHEAVELRDGDPKRFGGKG 100

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA   V  EI  AL G ++ DQ+ ID+ MIDLDGTPNKSRLGANAILGVSLAV+KA+A
Sbjct: 101 VLKAAGHVEHEILEALQGVESTDQVAIDEAMIDLDGTPNKSRLGANAILGVSLAVAKASA 160

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           Q   +PLY+Y+GG  A  LPVP+MNI+NGG HADN +D QEFMI PVGA  + +AIRMG+
Sbjct: 161 QELQVPLYRYVGGVYARTLPVPMMNIINGGEHADNPIDIQEFMIQPVGAPTVTDAIRMGS 220

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+F  LKK L   GY+TNVGDEGGF+P L++AD AL  +  ++E AGY  G D+  ALDC
Sbjct: 221 EIFTQLKKSLSGAGYNTNVGDEGGFAPALRSADEALGFMMRAVEAAGYRPGDDVTFALDC 280

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ F+K  +Y LKGE+  L    M +YLA+L  +YPI SIEDG++EDDW GW  LT  +
Sbjct: 281 AATEFYKNGRYELKGEDKSLDAAGMIAYLADLSARYPIISIEDGLAEDDWEGWAELTANL 340

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+RL +GI + VAN++L+K NQIG++SETL  ++ AQ AGY +++
Sbjct: 341 GHKLQLVGDDLFVTNPDRLRRGIRDGVANSLLVKVNQIGTLSETLEAVQMAQHAGYTAVM 400

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR AKYNQLIRIE  L   A++AGR+IL
Sbjct: 401 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRTAKYNQLIRIENELATAARYAGRTIL 460


>gi|304391612|ref|ZP_07373554.1| phosphopyruvate hydratase [Ahrensia sp. R2A130]
 gi|303295841|gb|EFL90199.1| phosphopyruvate hydratase [Ahrensia sp. R2A130]
          Length = 424

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 271/419 (64%), Positives = 334/419 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I D+ AR+++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD    Y GK V
Sbjct: 4   ILDVHARQILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAVELRDGGSDYMGKSV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KAI  VND+I  A+ G +A  Q  ID  M DLDGTPNKS+LGANAILGVS+AV+KAAA+
Sbjct: 64  NKAIEAVNDDIFDAIAGMEAEHQRGIDMAMCDLDGTPNKSKLGANAILGVSMAVAKAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            + LPLY+YLGG SAH+LPVP+MNI+NGG HADN +DFQEFM+MP GA+   E++RMGAE
Sbjct: 124 AAGLPLYRYLGGPSAHVLPVPMMNIINGGEHADNPIDFQEFMVMPAGADTFAESLRMGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           +FHTLKK L + G++TNVGDEGGF+PN+ +A  ALD +  SIEKAGY  G+++ IALD A
Sbjct: 184 IFHTLKKALHNAGHNTNVGDEGGFAPNIGSAPEALDFVMQSIEKAGYKPGENVFIALDTA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FF+  +Y LKGE   L   +MA+YLA L  +YPI SIEDGM+EDDW GWK LT++IG
Sbjct: 244 STEFFRDGQYDLKGEGRVLSSTDMAAYLAELAQKYPIISIEDGMAEDDWDGWKDLTDRIG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTN ERL +GI+   AN+IL+K NQIG+++ET   ++ A  A Y +++S
Sbjct: 304 KTHQLVGDDLFVTNTERLGEGISRGTANSILVKVNQIGTLTETFAAVDMAHRASYTAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED+TIADLAVATNCGQIKTGSL+RSDR+AKYNQL+RIEE LG QA+FAG S++
Sbjct: 364 HRSGETEDNTIADLAVATNCGQIKTGSLSRSDRLAKYNQLLRIEEELGSQAEFAGLSVV 422


>gi|71907983|ref|YP_285570.1| phosphopyruvate hydratase [Dechloromonas aromatica RCB]
 gi|119369317|sp|Q47DI1|ENO_DECAR RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|71847604|gb|AAZ47100.1| enolase [Dechloromonas aromatica RCB]
          Length = 427

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 268/417 (64%), Positives = 324/417 (77%), Gaps = 1/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I D+IARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IVDVIAREILDSRGNPTVEADVLLESGVMGRAAVPSGASTGTREAIELRDGDASRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V++A+  VN EI  A++G DA++Q  ID+ MIDLDGT NKSRLGANAIL VS+AV+KAAA
Sbjct: 64  VMQAVENVNTEISEAIIGLDAQEQAFIDQTMIDLDGTDNKSRLGANAILAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y GG S   +PVP+MNI+NGG HA+N+LD QEFM+MPVGA NIREAIR GA
Sbjct: 124 EESGLPLYRYFGGMSPMQMPVPMMNIINGGEHANNSLDIQEFMVMPVGAANIREAIRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK L  KG+ST VGDEGGF+PNL +   AL +I  +IE AGY  G+D+L+ALDC
Sbjct: 184 EIFHALKKLLNKKGHSTAVGDEGGFAPNLGSHAEALQIIMEAIEIAGYVPGQDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY L GE LEL   +   YLANL DQ+PI SIEDGMSE DW GWK+LT+++
Sbjct: 244 AASEFYKDGKYKLAGEGLELTSAQFVDYLANLADQFPIVSIEDGMSEADWDGWKLLTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   Q+VGDD+FVTN +   +GI + + N+ILIK NQIG++SET   +E A+ AGY ++I
Sbjct: 304 GDKVQIVGDDIFVTNTKIFKEGIKKGIGNSILIKINQIGTLSETFAAVEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRIAKYNQLIRIEE LG  A + GR
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRIAKYNQLIRIEEDLGDTASYPGR 420


>gi|288960005|ref|YP_003450345.1| enolase [Azospirillum sp. B510]
 gi|288912313|dbj|BAI73801.1| enolase [Azospirillum sp. B510]
          Length = 425

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 272/420 (64%), Positives = 332/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I +I ARE++DSRG+PT+EVDV L+ G+ GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   ITEIHAREILDSRGNPTVEVDVALDSGAFGRAAVPSGASTGAHEAVELRDGDKGRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EI   L G +A DQ  ID  MI+LDGT NK RLGANAILGVSLAV++AAA
Sbjct: 64  VLKAVEAVNGEIYDTLAGFEADDQRAIDLAMIELDGTENKGRLGANAILGVSLAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y+GG  A +LPVP+MNI+NGG HADN +D QEFMIMPVGAE   +AIRMG+
Sbjct: 124 EDAGLPLYRYVGGAFASLLPVPMMNIINGGAHADNPIDIQEFMIMPVGAETGADAIRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+F +LKK+LK  G++TNVGDEGGF+PNL + D AL  +  +IE AGY  G D+++A+D 
Sbjct: 184 EIFQSLKKKLKDAGHNTNVGDEGGFAPNLASTDDALGFVMKAIEAAGYKPGDDVMLAIDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY L GE   L P +M +Y  +L  +YPI SIEDGM+EDDW GWK LT+ I
Sbjct: 244 ASTEFFKNGKYELAGEGKSLSPEQMVAYWTDLAGRYPIISIEDGMAEDDWEGWKALTDAI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTNP+RL +GI + VAN+IL+K NQIG++SETL  ++ A  AGY +++
Sbjct: 304 GNKVQLVGDDLFVTNPKRLAQGIRQGVANSILVKVNQIGTLSETLEAVDMAHKAGYTAVL 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG  A+FAGR IL
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEQLGVAARFAGRGIL 423


>gi|288961177|ref|YP_003451516.1| enolase [Azospirillum sp. B510]
 gi|288913485|dbj|BAI74972.1| enolase [Azospirillum sp. B510]
          Length = 425

 Score =  551 bits (1421), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 272/420 (64%), Positives = 331/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I +I ARE++DSRG+PT+EVDV L+ G+ GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   ITEIHAREILDSRGNPTVEVDVALDSGAFGRAAVPSGASTGAHEAVELRDGDKGRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EI   L G +A DQ  ID  MI+LDGT NK RLGANAILGVSLAV++AAA
Sbjct: 64  VLKAVEAVNGEIYDTLAGFEADDQRAIDLAMIELDGTENKGRLGANAILGVSLAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y+GG  A +LPVP+MNI+NGG HADN +D QEFMIMPVGAE   +AIRMG+
Sbjct: 124 EDAGLPLYRYVGGAFASLLPVPMMNIINGGAHADNPIDIQEFMIMPVGAETGADAIRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+F +LKK+LK  G++TNVGDEGGF+PNL + D AL  +  +IE AGY  G D+++A+D 
Sbjct: 184 EIFQSLKKKLKDAGHNTNVGDEGGFAPNLASTDDALGFVMKAIEAAGYKPGDDVMLAIDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY L GE   L P +M +Y  +L  +YPI SIEDGM+EDDW GWK LT+ I
Sbjct: 244 ASTEFFKNGKYELAGEGKSLSPEQMVAYWTDLAGRYPIISIEDGMAEDDWEGWKALTDAI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+RL +GI + VAN+IL+K NQIG++SETL  ++ A  AGY +++
Sbjct: 304 GDKVQLVGDDLFVTNPKRLAQGIRQGVANSILVKVNQIGTLSETLEAVDMAHKAGYTAVL 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIEE LG  A+FAGR IL
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEEQLGVAARFAGRGIL 423


>gi|85716527|ref|ZP_01047498.1| enolase [Nitrobacter sp. Nb-311A]
 gi|85696716|gb|EAQ34603.1| enolase [Nitrobacter sp. Nb-311A]
          Length = 427

 Score =  551 bits (1419), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 267/420 (63%), Positives = 329/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII+RE++DSRG+PT+EVDV LEDG+TGRA VPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   IVDIISREILDSRGNPTVEVDVVLEDGATGRAAVPSGASTGAYEAAELRDDDKSRYQGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN EI  A+ G DA  Q+ ID+ +I+LDGT NK RLGANAILGVSLA+++AAA
Sbjct: 64  VRKAVEAVNGEIFDAIGGMDAEQQVQIDETLIELDGTANKGRLGANAILGVSLALARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + ++PLY+Y+GG  A  LPVP+MNI+NGG+HADN +DFQEFMIMPVGA    +A+R G+
Sbjct: 124 DSLDIPLYRYVGGVMARTLPVPMMNIVNGGVHADNPIDFQEFMIMPVGANTFSDALRCGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTL+ ELK  G++TNVGDEGGF+P+L +A +ALD I  +I KAGY  G D+ +ALD 
Sbjct: 184 EIFHTLRSELKKAGHNTNVGDEGGFAPDLPSAGAALDFIMGAIVKAGYRPGDDVALALDP 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY+ +GE       E A YLA L   YPI SIEDGM+EDD+ GWK++T+ I
Sbjct: 244 ASTEFFKDGKYVYEGEGKTRSIEEQAKYLAKLASDYPIVSIEDGMAEDDFEGWKLITDMI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN  RL  GI    AN+ILIK NQIG+++ETL  +E A  AGY +++
Sbjct: 304 GKTCQLVGDDLFVTNVTRLADGIRNGRANSILIKVNQIGTLTETLAAVEMAYKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR AKYNQL+RIE+ LG QAK+ GR+ L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRAAKYNQLLRIEQQLGTQAKYGGRAAL 423


>gi|296532891|ref|ZP_06895557.1| enolase [Roseomonas cervicalis ATCC 49957]
 gi|296266789|gb|EFH12748.1| enolase [Roseomonas cervicalis ATCC 49957]
          Length = 425

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 271/420 (64%), Positives = 331/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DIIARE++DSRG+PT+EVDV L+ G+ GRA VPSGASTG HEA ELRD +K R+ GKG
Sbjct: 4   IADIIAREILDSRGNPTVEVDVVLDSGAIGRAAVPSGASTGAHEAVELRDGDKARFGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KAIA V  EI  AL G DA +Q+ ID+ MI LDGTPNK RLGANAIL VSLA +KAAA
Sbjct: 64  VQKAIANVEGEIFDALSGMDATEQVKIDETMIALDGTPNKGRLGANAILAVSLATAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+Y+GG  A  LPVP+MNI+NGG HADN +D QEFMIMPV A +  +A R+GA
Sbjct: 124 EHYGLPLYRYVGGVFARTLPVPMMNIINGGQHADNPIDIQEFMIMPVAAGSAADAARIGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+F  LKK L   G+STNVGDEGGF+PNLK+A+ AL  I  + EKAG+  G+D+++ALDC
Sbjct: 184 EIFQALKKGLHDAGHSTNVGDEGGFAPNLKSAEEALSFIERACEKAGHRFGEDVMVALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK   Y ++GE  +L    M  YLA+L  ++PI SIEDGMSEDDW GWK+LT+++
Sbjct: 244 ASTEFFKDGVYDMEGEGKKLDAAGMVDYLADLCGKFPIISIEDGMSEDDWDGWKLLTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI  + AN+IL+K NQIGS++ETL  +E A  AGY +++
Sbjct: 304 GGKVQLVGDDLFVTNPERLRQGIERKTANSILVKVNQIGSLTETLEAVELAHRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR+AKYNQLIRIE+ LG  A++AGR+IL
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRIEQGLGPAARYAGRTIL 423


>gi|154248209|ref|YP_001419167.1| phosphopyruvate hydratase [Xanthobacter autotrophicus Py2]
 gi|238686743|sp|A7INB6|ENO_XANP2 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|154162294|gb|ABS69510.1| Phosphopyruvate hydratase [Xanthobacter autotrophicus Py2]
          Length = 427

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 263/414 (63%), Positives = 326/414 (78%), Gaps = 1/414 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DII RE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA ELRD +  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVEVDVVLEDGALGRAAVPSGASTGAHEAVELRDGDASRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V  A+  VN EI  A+ G +A DQ  ID  ++ LDGTPNK RLGANAILGVSLAV+KAAA
Sbjct: 64  VGMAVDAVNGEIFDAIGGYEAEDQAHIDAALLALDGTPNKGRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           ++  LPLY+Y+GG +A +LPVP+MNI+NGG HADN +DFQEFMI+P GA +  E +R GA
Sbjct: 124 ESKGLPLYRYVGGVNARVLPVPMMNIINGGAHADNPIDFQEFMILPAGAPSFAEGLRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKK LK  G++TNVGDEGGF+PNL +A++AL+ +  +IEKAG+  G+D+ + LDC
Sbjct: 184 EIFHTLKKGLKDAGHNTNVGDEGGFAPNLASAEAALEFVLKAIEKAGFKPGEDVYLGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK   Y  +GE          +YLA LV +YPI +IEDGM+EDDW GWK+LT+ +
Sbjct: 244 ASTEFFKNGVYNYEGEGTVRDIEAQVAYLAELVAKYPIVTIEDGMAEDDWVGWKLLTDTV 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS CQLVGDDLFVTN ERL +GI + V N+IL+K NQIGS++ETL+ +E A  AGY +++
Sbjct: 304 GSKCQLVGDDLFVTNVERLSRGIKDGVGNSILVKVNQIGSLTETLDAVEMAHKAGYRAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQL+RIE+ LG  A++
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRTAKYNQLLRIEQELGDSARY 417


>gi|16125968|ref|NP_420532.1| enolase [Caulobacter crescentus CB15]
 gi|221234732|ref|YP_002517168.1| phosphopyruvate hydratase [Caulobacter crescentus NA1000]
 gi|21263607|sp|Q9A7J9|ENO_CAUCR RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|254783240|sp|B8GW68|ENO_CAUCN RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|13423140|gb|AAK23700.1| enolase [Caulobacter crescentus CB15]
 gi|220963904|gb|ACL95260.1| enolase [Caulobacter crescentus NA1000]
          Length = 426

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 269/420 (64%), Positives = 334/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DIIARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD +K RY GKG
Sbjct: 4   IVDIIAREILDSRGNPTVEVDVILEDGAFGRAAVPSGASTGAHEANEKRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V +A+  VN EI  AL G DA DQ  +D +MI+LDGTPNK+RLGANAILGVSLA +KAAA
Sbjct: 64  VQQAVDAVNGEIFDALSGVDAEDQRRVDNLMIELDGTPNKARLGANAILGVSLATAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +++ LPLYKY+GG +A +LP P+MNI+NGG HADN +D QEFMI+P GA++ RE +RMGA
Sbjct: 124 ESAGLPLYKYVGGVNARVLPTPMMNIINGGAHADNPIDIQEFMILPTGAKDFREGLRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK LK  G++TNVGDEGGF+PNL +A++ALD I  + EKAGY AG D ++ LD 
Sbjct: 184 EIFHALKKALKDAGHNTNVGDEGGFAPNLASAEAALDFIVKAGEKAGYKAGDDFVLGLDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY L+GE   L P  M  YLA LV ++PI +IEDGM+EDD+ GWK+LT+ +
Sbjct: 244 ASTEFFKNGKYELEGEGKSLDPAAMVDYLAGLVAKFPILTIEDGMAEDDFDGWKLLTDTL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+RL  G+++ +AN+IL+K NQIG++SET++ +E A   GY S++
Sbjct: 304 GKKVQLVGDDLFVTNPKRLQMGLDKGLANSILVKVNQIGTLSETIDAVELAHRHGYTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVA NCGQIKTGSLARSDR AKYNQL+RI+E L  Q  +AGR+ L
Sbjct: 364 SHRSGETEDSTIADLAVALNCGQIKTGSLARSDRTAKYNQLLRIQEMLDDQGVYAGRAAL 423


>gi|114327845|ref|YP_745002.1| phosphopyruvate hydratase [Granulibacter bethesdensis CGDNIH1]
 gi|119369331|sp|Q0BSX3|ENO_GRABC RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|114316019|gb|ABI62079.1| enolase [Granulibacter bethesdensis CGDNIH1]
          Length = 425

 Score =  549 bits (1414), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 266/420 (63%), Positives = 323/420 (76%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DIIARE++DSRG+PT+EVDV LE G+ GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IADIIAREILDSRGNPTVEVDVTLESGAQGRAAVPSGASTGAHEAVELRDGDKSRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A++FV  EI  A+ G DA +QL ID+ +I +DGTPNKSRLGANA+L VSLA +KAAA
Sbjct: 64  VLHAVSFVEGEIFEAIGGMDASEQLRIDETLIAVDGTPNKSRLGANAMLAVSLATAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY+YLGG  A  LPVP+MNI+NGG HADN +D QEFMI PV A  I +A+R+GA
Sbjct: 124 NHQGVPLYRYLGGVYARTLPVPMMNIVNGGKHADNPIDIQEFMIQPVAAPTIADAVRVGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+F  LKKEL + G++TNVGDEGGF+P LK+A+ AL  I  + EKAGY  G+D+  ALDC
Sbjct: 184 EIFAALKKELSAAGHNTNVGDEGGFAPGLKSAEEALSFITKACEKAGYRPGEDVTFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y L+GE  +     M  YL +L  ++PI SIEDG++EDDW GWK+LT+ +
Sbjct: 244 AATEFFKDGVYDLEGEGKKFDAAGMVRYLEDLAAKFPIVSIEDGLAEDDWEGWKLLTDTL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+RL  GI    ANAIL+K NQIG++SETL  +E A  AGY +++
Sbjct: 304 GRKVQLVGDDLFVTNPDRLRHGIALGTANAILVKVNQIGTLSETLEAVETAHRAGYAAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR AKYNQLIRIE+ L    ++AGR+IL
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRTAKYNQLIRIEQDLDTSGRYAGRTIL 423


>gi|295689363|ref|YP_003593056.1| enolase [Caulobacter segnis ATCC 21756]
 gi|295431266|gb|ADG10438.1| enolase [Caulobacter segnis ATCC 21756]
          Length = 426

 Score =  548 bits (1412), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 269/420 (64%), Positives = 334/420 (79%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DIIARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD +K RY GKG
Sbjct: 4   IVDIIAREILDSRGNPTVEVDVILEDGAFGRAAVPSGASTGAHEANEKRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V +A+  VN EI  AL G DA DQ  +D ++I+LDGTPNK+RLGANAILGVSLA +KAAA
Sbjct: 64  VQQAVDAVNGEIFDALSGVDAEDQRRLDNLLIELDGTPNKARLGANAILGVSLAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +++ LPLYKY+GG +A +LP P+MNI+NGG HADN +D QEFMI+P GA++ RE +RMGA
Sbjct: 124 ESAGLPLYKYVGGVNARVLPTPMMNIINGGAHADNPIDIQEFMILPTGAKDFREGLRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK LK  G++TNVGDEGGF+PNL +A++ALD I  + EKAGY AG D ++ LD 
Sbjct: 184 EIFHALKKALKDAGHNTNVGDEGGFAPNLASAEAALDFIVKAGEKAGYKAGDDFVLGLDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY L+GE   L P  M  YLA LV ++PI +IEDGM+EDD+ GWK+LT+ +
Sbjct: 244 ASTEFFKNGKYELEGEGKSLDPAAMVDYLAGLVAKFPILTIEDGMAEDDFEGWKLLTDTL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+RL  G+++ +AN+IL+K NQIG++SET++ +E A   GY S++
Sbjct: 304 GKKVQLVGDDLFVTNPKRLQIGLDKGLANSILVKVNQIGTLSETIDAVELAHRHGYTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVA NCGQIKTGSLARSDR AKYNQL+RIEE L  Q  +AGR+ L
Sbjct: 364 SHRSGETEDSTIADLAVALNCGQIKTGSLARSDRTAKYNQLLRIEEMLDDQGVYAGRAAL 423


>gi|84501065|ref|ZP_00999300.1| Enolase [Oceanicola batsensis HTCC2597]
 gi|84391132|gb|EAQ03550.1| Enolase [Oceanicola batsensis HTCC2597]
          Length = 424

 Score =  548 bits (1411), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 275/420 (65%), Positives = 330/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG +EA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVTLEDGSMGRAAVPSGASTGAYEAVEKRDGDKARYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+A VN EI   LLG DA DQ+ +D  MI+LDGT NK RLGANAILGVSLA +KAAA
Sbjct: 64  VLEAVAAVNGEIAEDLLGLDATDQIGLDMAMIELDGTDNKGRLGANAILGVSLAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + +  PL++Y+GG SA +LPVP+MNI+NGG HADN +D QEFMIMPV A NIREA+RMG+
Sbjct: 124 EFTMQPLFRYVGGTSARVLPVPMMNIINGGEHADNPIDIQEFMIMPVSAGNIREAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKKEL + G ST +GDEGGF+P LK    ALD +  +IEKAGY  G+D+ +ALDC
Sbjct: 184 EVFHVLKKELSAAGMSTGLGDEGGFAPELKGTRDALDFVLKAIEKAGYRPGEDIHLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ +F+ ++Y +KGE   L   E   YLA L   YPI SIEDG SEDDW GWK+LT  +
Sbjct: 244 AATEYFEGDRYEMKGEGKSLTARENVDYLAALCADYPIISIEDGCSEDDWDGWKMLTETL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL +GI + VAN++L+K NQIGS++ETL  ++ A  A Y +++
Sbjct: 304 GDKVQLVGDDLFVTNPARLSEGIAKGVANSMLVKVNQIGSLTETLRAVDMAHRARYTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG+ A++AG SIL
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGEAAEYAGTSIL 423


>gi|254294052|ref|YP_003060075.1| enolase [Hirschia baltica ATCC 49814]
 gi|254042583|gb|ACT59378.1| enolase [Hirschia baltica ATCC 49814]
          Length = 425

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 270/418 (64%), Positives = 327/418 (78%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PTIEVDV L+DGS GRA VPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTIEVDVTLDDGSLGRAAVPSGASTGAYEAHELRDGDKSRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EI   L+G DA DQ  +D+ MIDLDGT  KSRLGANAILGVS+A +KAAA
Sbjct: 64  VLKAVEAVNTEIYEELIGLDAEDQRRLDQAMIDLDGTETKSRLGANAILGVSMAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             S LPLY+Y+GG +AH+LP P+MNI+NGG HADNA+D QEFMIMPVGA +  EA+RMG 
Sbjct: 124 NASALPLYRYIGGANAHVLPTPMMNIINGGEHADNAIDVQEFMIMPVGAPSFSEALRMGT 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH+LKK L   G ST+VGDEGGF+PN+ + + A+  I  SIE AGY  G+D  +ALD 
Sbjct: 184 EVFHSLKKSLSDAGLSTSVGDEGGFAPNIASTEEAISFIMKSIENAGYRPGEDCALALDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ F+K  KY+L GE   L  +EMA YL +LV++YPI SIEDGM+EDDW GWK LT+ +
Sbjct: 244 ASTEFYKDGKYVLAGEGKSLSSDEMAQYLTDLVNKYPIISIEDGMAEDDWDGWKTLTDLV 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+ CQLVGDDLFVTN +RL KGI    AN+IL+K NQIG+++ET+  +  A   G+ S++
Sbjct: 304 GAKCQLVGDDLFVTNSKRLAKGIELGAANSILVKVNQIGTLTETMEAVNLATSRGFTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVA NCGQIKTGSLARSDR+AKYNQL+RIEE L +Q  + GRS
Sbjct: 364 SHRSGETEDATIADLAVAMNCGQIKTGSLARSDRLAKYNQLLRIEEELDEQGVYLGRS 421


>gi|85373975|ref|YP_458037.1| phosphopyruvate hydratase [Erythrobacter litoralis HTCC2594]
 gi|122544553|sp|Q2NAQ1|ENO_ERYLH RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|84787058|gb|ABC63240.1| enolase [Erythrobacter litoralis HTCC2594]
          Length = 428

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 270/416 (64%), Positives = 330/416 (79%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD ++ RY GKG
Sbjct: 4   IIDLHAREILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAIELRDGDQGRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V +A+  VN  I   LLG DA DQ  ID +M+DLDGTPNK++LGANAILG SLAV+KAAA
Sbjct: 64  VTRAVDAVNTTIADTLLGLDAEDQRDIDTVMLDLDGTPNKAKLGANAILGTSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PL+ Y+GG SAH+LPVP+MNI+NGG HADN +D QEFM+MPVGA+++ EA+R GA
Sbjct: 124 AARGMPLWAYVGGVSAHMLPVPMMNIVNGGEHADNPIDIQEFMVMPVGADSLAEAVRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKK L  KG ST+VGDEGGF+P++ +   ALD I  SIEKAG+  G+++ +ALDC
Sbjct: 184 EIFHTLKKGLSEKGLSTSVGDEGGFAPDIASTRDALDFIMQSIEKAGFKPGEEVALALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FF   +Y L GE + L P EMA YLA+L + YPI SIEDGM+EDD  GWK LT+ I
Sbjct: 244 ASTEFFADGRYDLAGEEVSLSPEEMAKYLADLCNDYPIRSIEDGMAEDDLEGWKALTDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTN ERL  GI++ +AN++L+K NQIG++SETL  ++ A  AGY  ++
Sbjct: 304 GNKVQLVGDDLFVTNSERLAMGIDKGLANSLLVKVNQIGTLSETLEAVDMAHRAGYTCVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A +AG
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGNSAHYAG 419


>gi|75676018|ref|YP_318439.1| enolase [Nitrobacter winogradskyi Nb-255]
 gi|119369361|sp|Q3SRK4|ENO_NITWN RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|74420888|gb|ABA05087.1| enolase [Nitrobacter winogradskyi Nb-255]
          Length = 426

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 265/420 (63%), Positives = 326/420 (77%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DII RE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA ELRD +  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVEVDVVLEDGAMGRAAVPSGASTGAYEAVELRDGDNSRYHGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN EI  A+ G DA  Q  ID+ +I+LDGT NK RLGANAILGVSLA+++AAA
Sbjct: 64  VRKAVDAVNGEIFDAIGGMDAEQQAQIDETLIELDGTANKGRLGANAILGVSLALARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + ++PLY+Y+GG +A  LPVP+MNI+NGG+HADN +DFQEFMIMPVG +   +A+R G+
Sbjct: 124 DSLDIPLYRYVGGVTARTLPVPMMNIVNGGVHADNPIDFQEFMIMPVGVQTFSDALRCGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTL+ ELK  G++TNVGDEGGF+P+L +A +ALD I  +I KAGY  G D+ +ALD 
Sbjct: 184 EIFHTLRSELKKAGHNTNVGDEGGFAPDLPSAGAALDFIMGAIVKAGYRPGDDVALALDP 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY+  GE       E A YLA L   YPI SIEDGM+EDD+ GWK++T+ I
Sbjct: 244 ASTEFFKDGKYVYGGEGKTRSIEEQAQYLAKLASDYPIVSIEDGMAEDDFEGWKLVTDMI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDDLFVTN  RL  GI    AN+ILIK NQIG+++ETL  +E A  AGY +++
Sbjct: 304 GKTCQLVGDDLFVTNVTRLADGIRNGRANSILIKVNQIGTLTETLAAVEMAYKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSL+RSDR AKYNQL+RIE+ LG QAK+AGR+ L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRAAKYNQLLRIEQQLGAQAKYAGRAAL 423


>gi|144898639|emb|CAM75503.1| Enolase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 425

 Score =  546 bits (1407), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 272/420 (64%), Positives = 330/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGKG 61
           I DI ARE++DSRG+PT+EVDV LE G  GRA VPSGASTG HEA ELRD  +KRY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVVLESGVMGRAAVPSGASTGAHEAAELRDGDKKRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EI  AL G DA +Q++IDK MIDLDGTPNKSRLGANAILGVSLA ++AAA
Sbjct: 64  VLKAVESVNGEIYDALSGMDAEEQVVIDKTMIDLDGTPNKSRLGANAILGVSLACARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y+GG  A +LPVP+MNI+NGG HADN +D QEFMIMPVGA    +AIRMG+
Sbjct: 124 EEAGLPLYRYVGGAFASLLPVPMMNIINGGAHADNPIDIQEFMIMPVGAPTCSDAIRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVF  LKK+LK  G++TNVGDEGGF+PNLK+A+ ALD I  SIEKAGY  G+D+++ALDC
Sbjct: 184 EVFQALKKQLKDAGHNTNVGDEGGFAPNLKSAEQALDFIMQSIEKAGYKPGEDIMLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY + G         +  + A L   YPI SIEDG SEDD  GW++LT ++
Sbjct: 244 ASTEFFKDGKYEMVGAKKTYDQKGIVKFYAKLAKSYPIISIEDGCSEDDLDGWEMLTEEL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI++ +AN+IL+K NQIG++SETL  ++ A  AGY +++
Sbjct: 304 GGKVQLVGDDLFVTNPARLSMGIDKGLANSILVKVNQIGTLSETLEAVDMAHKAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED  IADLAVATNCGQIKTGSL+RSDR+AKYNQLIR+EE LG  A++AG SI+
Sbjct: 364 SHRSGETEDSIIADLAVATNCGQIKTGSLSRSDRLAKYNQLIRLEEELGPAARYAGLSIM 423


>gi|119369343|sp|Q0APT2|ENO_MARMM RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
          Length = 424

 Score =  545 bits (1404), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 267/419 (63%), Positives = 326/419 (77%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DIIARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA E+RD  +RY GKGV
Sbjct: 4   ITDIIAREILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAVEMRDGGERYGGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
           LKA   V  EI  A+ G DA DQ  ID+ MI+LDGT NKSRLGANA+LGVSLA + AAA 
Sbjct: 64  LKACDLVEGEIFEAIAGMDAEDQRRIDEAMIELDGTANKSRLGANAMLGVSLAAAHAAAD 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
              LPLY+Y+GG +A +LP P+MNI+NGG HADN +DFQEFMIMPVG  +  EA+R GAE
Sbjct: 124 VQGLPLYRYIGGMNARVLPTPMMNIINGGAHADNPIDFQEFMIMPVGLPSFSEALRCGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFH LK  LK+ G +TNVGDEGGF+P+L++A+ ALD+I ++IE AGY  G+D+ +ALD A
Sbjct: 184 VFHALKSRLKADGLNTNVGDEGGFAPHLRSAEQALDVIMDAIEAAGYKPGEDVALALDVA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ F+K  +Y+L+G +        + YL  LV++YPI SIEDGM+EDDW GW+ LT ++ 
Sbjct: 244 STEFYKDGQYVLEGADESHDAEGFSQYLEKLVNKYPIVSIEDGMAEDDWDGWRALTQRLD 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
             CQLVGDDLFVTNPERL KGI    ANAIL+K NQIG++SETL+ ++ A  +GY +++S
Sbjct: 304 GRCQLVGDDLFVTNPERLAKGIETGAANAILVKVNQIGTLSETLDAVDMALRSGYGAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQL+RIE  LG+   FAG S L
Sbjct: 364 HRSGETEDATIADLAVATNCGQIKTGSLARSDRTAKYNQLLRIESLLGETGMFAGPSGL 422


>gi|126728650|ref|ZP_01744465.1| enolase [Sagittula stellata E-37]
 gi|126710580|gb|EBA09631.1| enolase [Sagittula stellata E-37]
          Length = 424

 Score =  545 bits (1404), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 274/420 (65%), Positives = 328/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG+HEA E RD +K RY GKG
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVLLEDGTMGRAAVPSGASTGVHEAVEKRDGDKSRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V  A+A VN EI   ++G DA +Q+ ID  MI+LDGT NK RLGANAILGVSLA +KAAA
Sbjct: 64  VRDAVASVNGEIAENIVGFDATEQVAIDLTMIELDGTDNKGRLGANAILGVSLACAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PL++Y+GG SA  LPVP+MNI+NGG HADN +D QEFMIMPV AENI EA+RMG+
Sbjct: 124 DFAGQPLFRYVGGTSARTLPVPMMNIINGGEHADNPIDIQEFMIMPVAAENIAEAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL + G ST +GDEGGF+P LK    ALD I  SIEKAGY  G+D+ +ALD 
Sbjct: 184 EVFHTLKKELSAAGMSTGLGDEGGFAPELKGTRDALDFILKSIEKAGYKPGEDIYLALDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ +FK  KY +KGE L L P +   YL  LV+ YPI SIEDG +EDDW GWK+LT+ +
Sbjct: 244 ASTEYFKDGKYEMKGEGLSLSPEDNVKYLEALVNDYPIISIEDGCAEDDWDGWKMLTDVL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+ CQLVGDDLFVTNP+RL  GI +  AN++L+K NQIG+++ETL  +E A  A   +++
Sbjct: 304 GNRCQLVGDDLFVTNPKRLSMGIEKGCANSMLVKVNQIGTLTETLQAVEMAHRARMTNVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE L   A +AGRSIL
Sbjct: 364 SHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLEDTAIYAGRSIL 423


>gi|149184459|ref|ZP_01862777.1| Phosphopyruvate hydratase [Erythrobacter sp. SD-21]
 gi|148831779|gb|EDL50212.1| Phosphopyruvate hydratase [Erythrobacter sp. SD-21]
          Length = 429

 Score =  545 bits (1403), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 271/418 (64%), Positives = 330/418 (78%), Gaps = 2/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GK 
Sbjct: 4   IIDIHAREILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAVELRDGDKGRYLGKS 63

Query: 62  VLKAIAFVNDEIRTALLG-CDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           V KA+  VN EIR  L+G  DA DQ  +D  MI LD TPNK RLGAN ILGVS+A +KAA
Sbjct: 64  VTKAVEAVNTEIRDLLVGNFDAEDQRDVDLSMIALDDTPNKGRLGANGILGVSMATAKAA 123

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    LPLY Y+GG SAH+LPVP+MNI+NGG HADN +D QEFM+MPVGA+++ EA+R G
Sbjct: 124 ANARGLPLYSYIGGVSAHVLPVPMMNIINGGEHADNPIDIQEFMVMPVGADSLAEAVRWG 183

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE+FHTLKK+L  KG +T VGDEGGF+PNL +   ALD I  S+E+AG+  G D+++ALD
Sbjct: 184 AEIFHTLKKKLSEKGLATAVGDEGGFAPNLASTRDALDFIMASVEQAGFKPGDDVMLALD 243

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           CA++ FFK  KY + GENL L  ++MA YL  L   YPI SIEDGM+EDD+ GWK LT++
Sbjct: 244 CASTEFFKDGKYQISGENLSLDGHQMAEYLDKLCRDYPIRSIEDGMAEDDFEGWKALTDR 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG + QLVGDDLFVTNP+RL +GI++ +AN++L+K NQIG+++ETL+ +  A  A Y ++
Sbjct: 304 IGKSIQLVGDDLFVTNPQRLREGIDQGLANSLLVKVNQIGTLTETLDAVAIANRASYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           +SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQLIRIEE LG  A +AGR
Sbjct: 364 MSHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEELGDSAFYAGR 421


>gi|114569963|ref|YP_756643.1| enolase [Maricaulis maris MCS10]
 gi|114340425|gb|ABI65705.1| enolase [Maricaulis maris MCS10]
          Length = 437

 Score =  544 bits (1401), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 267/419 (63%), Positives = 326/419 (77%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DIIARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA E+RD  +RY GKGV
Sbjct: 17  ITDIIAREILDSRGNPTVEVDVLLEDGSFGRAAVPSGASTGAHEAVEMRDGGERYGGKGV 76

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
           LKA   V  EI  A+ G DA DQ  ID+ MI+LDGT NKSRLGANA+LGVSLA + AAA 
Sbjct: 77  LKACDLVEGEIFEAIAGMDAEDQRRIDEAMIELDGTANKSRLGANAMLGVSLAAAHAAAD 136

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
              LPLY+Y+GG +A +LP P+MNI+NGG HADN +DFQEFMIMPVG  +  EA+R GAE
Sbjct: 137 VQGLPLYRYIGGMNARVLPTPMMNIINGGAHADNPIDFQEFMIMPVGLPSFSEALRCGAE 196

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFH LK  LK+ G +TNVGDEGGF+P+L++A+ ALD+I ++IE AGY  G+D+ +ALD A
Sbjct: 197 VFHALKSRLKADGLNTNVGDEGGFAPHLRSAEQALDVIMDAIEAAGYKPGEDVALALDVA 256

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ F+K  +Y+L+G +        + YL  LV++YPI SIEDGM+EDDW GW+ LT ++ 
Sbjct: 257 STEFYKDGQYVLEGADESHDAEGFSQYLEKLVNKYPIVSIEDGMAEDDWDGWRALTQRLD 316

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
             CQLVGDDLFVTNPERL KGI    ANAIL+K NQIG++SETL+ ++ A  +GY +++S
Sbjct: 317 GRCQLVGDDLFVTNPERLAKGIETGAANAILVKVNQIGTLSETLDAVDMALRSGYGAVMS 376

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQL+RIE  LG+   FAG S L
Sbjct: 377 HRSGETEDATIADLAVATNCGQIKTGSLARSDRTAKYNQLLRIESLLGETGMFAGPSGL 435


>gi|226314820|ref|YP_002774716.1| enolase [Brevibacillus brevis NBRC 100599]
 gi|254783235|sp|C0Z6L3|ENO_BREBN RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|226097770|dbj|BAH46212.1| enolase [Brevibacillus brevis NBRC 100599]
          Length = 428

 Score =  544 bits (1401), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 328/419 (78%), Gaps = 1/419 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I DI ARE++DSRG+PT+EV+V LEDGS GRA VPSGASTG +EA ELRD +K RY GK
Sbjct: 3   MITDIYAREIMDSRGNPTVEVEVYLEDGSMGRADVPSGASTGAYEAVELRDGDKSRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN+ I   L+G DA DQ+ ID  MI LDGTPNK +LGANAILGVS+AV++AA
Sbjct: 63  GVLKAVENVNEIIAPELIGMDALDQVGIDMAMIQLDGTPNKGKLGANAILGVSMAVARAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A++  +PLY YLGG +A +LPVP+MNILNGG HADN +D QEFM+MPVGA + +EA+R G
Sbjct: 123 AESLGVPLYNYLGGFNARMLPVPMMNILNGGKHADNTVDIQEFMVMPVGATSFKEALRTG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE+FH+LKK L  KG ST VGDEGGF+PNLK+ + A+  I ++I+ AGY  GKD+ +ALD
Sbjct: 183 AEIFHSLKKVLGEKGLSTAVGDEGGFAPNLKSNEEAITTILDAIKAAGYEPGKDVFLALD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            AA+  FK  KY  +GE +     EM ++  +LV++YPI SIEDG+SEDDW GWK LT+K
Sbjct: 243 VAATEMFKDGKYHFEGEGVVKTTEEMIAFYEDLVNKYPIISIEDGLSEDDWDGWKALTDK 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +GS  QLVGDDLFVTN ERL +GI     N+IL+K NQIG+++ET   IE A++AGY ++
Sbjct: 303 LGSKVQLVGDDLFVTNTERLARGIETSTGNSILVKVNQIGTLTETFEAIEMAKLAGYTAV 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ISHRSGETED TI+D+AVATN GQIKTG+ +R+DR+AKYNQL+RIE+ L   A+F GRS
Sbjct: 363 ISHRSGETEDSTISDIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDELADTARFGGRS 421


>gi|197105210|ref|YP_002130587.1| enolase [Phenylobacterium zucineum HLK1]
 gi|238690145|sp|B4RBW1|ENO_PHEZH RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|196478630|gb|ACG78158.1| enolase [Phenylobacterium zucineum HLK1]
          Length = 426

 Score =  543 bits (1399), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 271/420 (64%), Positives = 330/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG HEA E RD +K RY GKG
Sbjct: 4   IVDITAREILDSRGNPTVEVDVILEDGAMGRAAVPSGASTGAHEAVEKRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V +A+  VN EI  AL G DA DQ  ID+++I+LDGTPNKSRLGANAILGVSLA +KAAA
Sbjct: 64  VRQAVDAVNGEIYDALSGSDAEDQRRIDRMLIELDGTPNKSRLGANAILGVSLATAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +S LPLYKY+GG SA ILPVP+MNI+NGG HADN +D QEFMI+P GAE   EA+RMGA
Sbjct: 124 SSSALPLYKYVGGVSARILPVPMMNIINGGAHADNPIDIQEFMILPTGAETFSEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK+LK  G++TNVGDEGGF+PN+ +A+ AL  I  + E AGY  G+D  + LD 
Sbjct: 184 EIFHALKKQLKDAGHNTNVGDEGGFAPNIGSAEEALAFIVKAGEGAGYRCGEDFHLGLDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY+++GE   + P  M  YLA LV ++PI +IEDG +EDD+ GWKILT ++
Sbjct: 244 ASTEFFKNGKYVMEGEGKTVDPAGMVEYLAGLVSKFPIVTIEDGCAEDDFDGWKILTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL  GI + +AN+IL+K NQIG++SETL+ ++ A    Y +++
Sbjct: 304 GGKVQLVGDDLFVTNPERLAVGIEKGLANSILVKVNQIGTLSETLDAVDMAHRNSYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADL+VATNCGQIKTGSLARSDR AKYNQL+RIEE LG QA +AGR  L
Sbjct: 364 SHRSGETEDSTIADLSVATNCGQIKTGSLARSDRTAKYNQLLRIEEELGDQAIYAGRRAL 423


>gi|294083773|ref|YP_003550530.1| phosphopyruvate hydratase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663345|gb|ADE38446.1| Phosphopyruvate hydratase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 425

 Score =  543 bits (1398), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 271/420 (64%), Positives = 323/420 (76%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DI ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG +EA E+RD +  RY GKG
Sbjct: 4   IVDIQAREILDSRGNPTVEVDVFLEDGSAGRAAVPSGASTGAYEAVEMRDGDADRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EI  AL G DA DQ   D+ MI+LDGT NK RLGANAILGVSLA+S+AAA
Sbjct: 64  VLKAVDAVNFEIFDALAGADAFDQAGNDQDMIELDGTANKGRLGANAILGVSLAISRAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            ++ +PL++YLGG +AH+LPVP+MNI+NGG HADNALD QEFM+MPVGA +  + +RMGA
Sbjct: 124 DSAEMPLWRYLGGVNAHLLPVPMMNIINGGAHADNALDAQEFMVMPVGATHFNDGLRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK L     ST VGDEGGF+P + + D AL  I  SIE AGY  G D++IA+D 
Sbjct: 184 EIFHALKKLLSDNSLSTAVGDEGGFAPAINSTDEALGYITKSIEAAGYKPGDDVMIAVDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y L+GE   L  +EM S  A L  +YPI SIED + EDDW G+  LT+KI
Sbjct: 244 AASEFYKDGAYHLQGEGRSLSSDEMNSMWAELTGKYPITSIEDPLDEDDWDGFAALTDKI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  Q+VGDDLFVTNPERL +GIN+  ANAILIK NQIG++SET+  IE AQ AG+  +I
Sbjct: 304 GSTVQIVGDDLFVTNPERLSRGINDSSANAILIKVNQIGTLSETMQAIEMAQKAGFGVVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED  IADLAVATN GQIKTGSL+RSDR+AKYNQL+RIEE L + A +AG SIL
Sbjct: 364 SHRSGETEDSFIADLAVATNAGQIKTGSLSRSDRLAKYNQLLRIEEELDRTALYAGTSIL 423


>gi|255524717|ref|ZP_05391669.1| Phosphopyruvate hydratase [Clostridium carboxidivorans P7]
 gi|296185679|ref|ZP_06854088.1| phosphopyruvate hydratase [Clostridium carboxidivorans P7]
 gi|255511611|gb|EET87899.1| Phosphopyruvate hydratase [Clostridium carboxidivorans P7]
 gi|296049807|gb|EFG89232.1| phosphopyruvate hydratase [Clostridium carboxidivorans P7]
          Length = 431

 Score =  541 bits (1394), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 259/416 (62%), Positives = 330/416 (79%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D++ R+++DSR  PT+EV+V LEDG  GRA VPSGASTG+ EA ELRD++K +Y GKG
Sbjct: 7   IVDVVGRQILDSRCMPTVEVEVVLEDGIIGRAAVPSGASTGMFEAVELRDEDKSKYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN  I   L+G +  DQ+LIDK+MI+LDGT NKS+LGANA+LGVSLA ++AAA
Sbjct: 67  VLKAVDNVNTYIAEELIGMNVFDQVLIDKVMIELDGTKNKSKLGANAMLGVSLACARAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           ++  L LY+Y+GG +A +LPVP+MNI+NGG HADN +D QEFM+MPVGA +  EA+RM A
Sbjct: 127 ESLGLNLYQYIGGVNAKVLPVPMMNIINGGKHADNNVDLQEFMVMPVGAPSFSEALRMSA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H+LK  LK+KGY T VGDEGGF+PNLK+ + A+ +I  +I+KAGY  GK++ IALD 
Sbjct: 187 EVYHSLKSLLKAKGYDTGVGDEGGFAPNLKSNEEAIQVIVEAIQKAGYTPGKEMFIALDP 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S  ++  KY L GE   L P EM  Y ANLV++YPI SIEDGM+E+DW GWK++T+KI
Sbjct: 247 ASSEIYENGKYNLAGEGKVLSPAEMVDYYANLVEKYPIISIEDGMAEEDWEGWKLITDKI 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTN ERL  GI ++VAN+ILIK NQIG+++ETLN IE A+ AGY +++
Sbjct: 307 GNKVQLVGDDLFVTNTERLKTGIEKKVANSILIKLNQIGTLTETLNAIEMAERAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQL+RIEE LG   +F G
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLLRIEEELGDAGEFRG 422


>gi|20808178|ref|NP_623349.1| enolase [Thermoanaerobacter tengcongensis MB4]
 gi|23814070|sp|Q8R967|ENO_THETN RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|20516770|gb|AAM24953.1| Enolase [Thermoanaerobacter tengcongensis MB4]
          Length = 429

 Score =  541 bits (1394), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 267/419 (63%), Positives = 334/419 (79%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PTIEV+V L+ G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IIDIYAREILDSRGNPTIEVEVELDSGAVGRAAVPSGASTGAFEAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VND I   L+G +A+DQ+ IDK MI+LDGTPNKS+LGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVQNVNDIIAPELIGMEAQDQVAIDKAMIELDGTPNKSKLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+YLGG +A  LPVP+MNILNGG HADN +D QEFMIMPVGA N +EA+RM +
Sbjct: 124 EELGLPLYQYLGGVNAKTLPVPMMNILNGGKHADNNVDIQEFMIMPVGAPNFKEALRMCS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H+LK  L SKG ST VGDEGGF+PNL + + A+ +I  +IEKAGY  G+D+++ALD 
Sbjct: 184 EVYHSLKNVLHSKGLSTTVGDEGGFAPNLTSNEEAIKVILEAIEKAGYVPGEDIVLALDP 243

Query: 242 AASAFFKKE-KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AA+  +K++ KY  +GE +     EM  +   LV +YPI SIEDG++E+DW+GWK+LT +
Sbjct: 244 AATEMYKEDGKYHFEGEGIVRTSEEMIEFWEQLVSKYPIVSIEDGLAEEDWNGWKLLTER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN ERL KGIN  VAN+ILIK NQIG+++ETL+ IE A+ AGY +I
Sbjct: 304 LGKKVQLVGDDLFVTNTERLSKGINMGVANSILIKLNQIGTLTETLDAIEMAKRAGYTAI 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           +SHRSGETED TIADL VATN GQIKTG+ AR+DR+AKYNQL+RIEE+LG  A++ G++
Sbjct: 364 VSHRSGETEDTTIADLVVATNVGQIKTGAPARTDRVAKYNQLLRIEEALGSVAQYPGKN 422


>gi|254518102|ref|ZP_05130158.1| phosphopyruvate hydratase [Clostridium sp. 7_2_43FAA]
 gi|226911851|gb|EEH97052.1| phosphopyruvate hydratase [Clostridium sp. 7_2_43FAA]
          Length = 431

 Score =  541 bits (1393), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 256/422 (60%), Positives = 334/422 (79%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D++AR+++DSR  PT+EV+V LEDG+ GRA VPSGASTG++EA ELRD +K  Y GKG
Sbjct: 7   IVDVVARQILDSRCFPTVEVEVYLEDGTVGRAAVPSGASTGMYEAVELRDGDKDNYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VND I   L+GC+  DQ  IDK++I+LDGTPNK++LGANAILGVSLAV+ AAA
Sbjct: 67  VLKAVQNVNDTIAEELIGCNVYDQPYIDKMLIELDGTPNKAKLGANAILGVSLAVANAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           ++ +LPLY+Y+GG +A +LPVP+MNI+NGG HADN++D QEFM+MPVGA+   +A++M A
Sbjct: 127 KSLDLPLYQYVGGVNAKVLPVPMMNIINGGSHADNSVDLQEFMVMPVGAKTFSDALKMCA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK L  KGYST +GDEGGF+P+LK+ + A+++I  +I KAGY AG+D+ IA+D 
Sbjct: 187 EVYHTLKKTLHDKGYSTAIGDEGGFAPDLKSNEEAIEVIIEAITKAGYKAGEDMFIAIDA 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S ++K  KY+L+ E   L   EM  +L + V++YPI SIEDGM+E+DW GWK++T ++
Sbjct: 247 ASSEYYKDGKYVLEHEGKTLTAAEMVDFLEDWVNKYPIISIEDGMAEEDWEGWKLITERL 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN ERL +GI+  V N+ILIK NQIG+++ETLN IE A  AGY ++I
Sbjct: 307 GKKVQLVGDDLFVTNTERLERGIDMGVGNSILIKLNQIGTLTETLNAIEMANRAGYTAVI 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQLIRIEE L   A++ GR   
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLIRIEEELDDVAEYRGRKAF 426

Query: 422 IH 423
            +
Sbjct: 427 FN 428


>gi|299134962|ref|ZP_07028153.1| enolase [Afipia sp. 1NLS2]
 gi|298589939|gb|EFI50143.1| enolase [Afipia sp. 1NLS2]
          Length = 427

 Score =  540 bits (1392), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 268/414 (64%), Positives = 326/414 (78%), Gaps = 1/414 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVEVDVVLEDGSMGRAAVPSGASTGAHEAVELRDGDKGRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN EI  A+ G DA  Q+ ID  MI LDGTPNK RLGANAILGVSLAV+KAAA
Sbjct: 64  VQKAVEAVNGEIFDAIGGMDAEQQVQIDNAMIALDGTPNKKRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + ++PLY+Y+GG SA  LPVP+MNI+NGG+HADN +DFQE M+MPVGA +  EA+R GA
Sbjct: 124 ASCDMPLYRYVGGTSARTLPVPMMNIVNGGVHADNPIDFQEIMVMPVGAASFAEALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTL+ ELK  G++TNVGDEGGF+PNL +AD+ALD + ++I KAGY AG D+++ALDC
Sbjct: 184 EIFHTLRGELKKAGHNTNVGDEGGFAPNLPSADAALDFVMSAIGKAGYKAGSDVMLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY+ +GE      +E A YL +L ++YPI SIEDGM+EDD  GWK LT+ I
Sbjct: 244 ASTEFFKDGKYVYEGEKKTRSRSEQAKYLQDLANRYPIVSIEDGMAEDDMDGWKELTDLI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN  RL  GI + + N+IL+K NQIG+++ETL  +E A  A Y +++
Sbjct: 304 GGKVQLVGDDLFVTNVMRLADGIKKGIGNSILVKVNQIGTLTETLAAVEMAHKAAYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQL+RIE+ L  QA +
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLLRIEQQLDNQAIY 417


>gi|302390382|ref|YP_003826203.1| enolase [Thermosediminibacter oceani DSM 16646]
 gi|302201010|gb|ADL08580.1| enolase [Thermosediminibacter oceani DSM 16646]
          Length = 429

 Score =  540 bits (1391), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 264/418 (63%), Positives = 323/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I ++ ARE++DSRG+PT+E +V LEDG+ GRA VPSGASTG  EA ELRD + KRY GKG
Sbjct: 4   IMNVFAREILDSRGNPTVEAEVILEDGTVGRAAVPSGASTGQFEAVELRDNDPKRYKGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+ I   L G DA DQ+ +D+++IDLDGT NK RLGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVENVNEVIGPELEGMDALDQVAVDRLLIDLDGTKNKGRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY+Y+GG +A +LP+P+MNILNGG HADN +D QEFMIMPVGAEN   A+RMGA
Sbjct: 124 NYLGVPLYRYIGGTNAKVLPIPMMNILNGGKHADNNVDLQEFMIMPVGAENFAHALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E FHTLKK L  KG ST VGDEGGF+PNL + + A+  I  +IE+AGY  GKD+ +ALD 
Sbjct: 184 ETFHTLKKVLSEKGLSTTVGDEGGFAPNLASNEDAIKYILEAIERAGYVPGKDIYVALDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ F+K  KY LKGE LEL P  M  Y   LV++YPI SIEDGM+E+DW GWK+LT+ +
Sbjct: 244 AATEFYKDGKYHLKGEGLELDPAAMVEYYVKLVEKYPIISIEDGMAEEDWDGWKLLTDAL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN ERL +GI   VAN+ILIK NQIG+++ETL+ I+ A+ AGY +I+
Sbjct: 304 GKKVQLVGDDLFVTNTERLARGIELGVANSILIKLNQIGTLTETLDAIKMAERAGYTAIV 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADL V  N G IKTG+ +R+DR+AKYNQL+RIEE L   A +AG S
Sbjct: 364 SHRSGETEDTTIADLVVGVNAGMIKTGAPSRTDRVAKYNQLLRIEEDLDTAAGYAGIS 421


>gi|319792844|ref|YP_004154484.1| enolase [Variovorax paradoxus EPS]
 gi|315595307|gb|ADU36373.1| enolase [Variovorax paradoxus EPS]
          Length = 427

 Score =  540 bits (1391), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 260/417 (62%), Positives = 323/417 (77%), Gaps = 1/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIVGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A+LG DA +Q  +D+ MIDLDGT NK+RLGANA L VS+AV++AAA
Sbjct: 64  VLKAVENINTEISEAVLGLDASEQAFLDRTMIDLDGTDNKARLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y GG     LPVP+MN++NGG HA+N+LD QEFMI+PVGA++ REA+R GA
Sbjct: 124 EESGLPLYRYFGGMGGMQLPVPMMNVINGGAHANNSLDLQEFMIIPVGAKSFREAVRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+P++++ ++A+ LI  +I+KAGY AG+ + + LDC
Sbjct: 184 EVFHALKKILGDRGISTAVGDEGGFAPSVESHEAAIQLILEAIDKAGYTAGEQIALGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY+L GENL L        LAN VD+YPI SIEDGM E DW GWK LT ++
Sbjct: 244 AASEFYKDGKYVLSGENLSLSAESWTDMLANWVDKYPIISIEDGMHEGDWDGWKHLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN + L +GI++ +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKRVQLVGDDLFVTNTKILQEGIDKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           SHRSGETED TIAD+AV TN GQIKTGSL+RSDRIAKYNQL+RIEE LG  A + GR
Sbjct: 364 SHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDIASYPGR 420


>gi|78042740|ref|YP_359156.1| phosphopyruvate hydratase [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|119369306|sp|Q3AFC8|ENO_CARHZ RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|77994855|gb|ABB13754.1| enolase [Carboxydothermus hydrogenoformans Z-2901]
          Length = 428

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 264/416 (63%), Positives = 325/416 (78%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I ++IARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG  EA ELRD + +RY GKG
Sbjct: 4   IREVIAREILDSRGNPTVEVDVILEDGTWGRAAVPSGASTGAFEAVELRDNDPQRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V +A+  VN  I   +LG DA DQ+ ID+ +I+LDGTPNK +LGANAILGVS+AV+KAAA
Sbjct: 64  VTQAVENVNSIIGPEILGFDALDQVGIDEYLIELDGTPNKGKLGANAILGVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+YLGG +A +LP P+MNILNGG HADN +D QEFMIMP+GA +  EA+RMGA
Sbjct: 124 NYLGLPLYRYLGGTNARVLPAPMMNILNGGKHADNNVDIQEFMIMPLGASSFSEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK LK KGY+T VGDEGGF+PNLK+ + A+++I  +IEKAGY  GKD+ IALD 
Sbjct: 184 EVFHNLKKVLKGKGYNTAVGDEGGFAPNLKSNEEAIEVIVEAIEKAGYTPGKDIYIALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+  +K   Y+L+GE ++    EM  Y   L  +YPI SIEDGMSE+DW GWK+LT ++
Sbjct: 244 AATELYKDGFYVLEGEGVKKSAAEMVEYYEKLCAKYPIISIEDGMSEEDWDGWKLLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN ERL KGI+  VAN+ILIK NQIG+++ETLNTIE A+  GY +II
Sbjct: 304 GKKIQLVGDDLFVTNVERLQKGIDLGVANSILIKLNQIGTITETLNTIELARQNGYTTII 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED T+ADLAVA N G IKTG+ +R+DR+AKYNQL+RIEE L   A + G
Sbjct: 364 SHRSGETEDTTLADLAVAVNAGMIKTGAPSRTDRVAKYNQLLRIEEELDYTAIYKG 419


>gi|323701501|ref|ZP_08113174.1| enolase [Desulfotomaculum nigrificans DSM 574]
 gi|323533510|gb|EGB23376.1| enolase [Desulfotomaculum nigrificans DSM 574]
          Length = 428

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 257/420 (61%), Positives = 329/420 (78%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I++++ARE++DSRG+PT+EV+V LEDG+ GRA VPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   ISEVLAREILDSRGNPTLEVEVWLEDGTMGRAAVPSGASTGAYEAVELRDGDKNRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+ I   ++G DA DQ+ ID++MI++DGTPNK +LGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVENVNEIIGPEIIGMDAIDQIGIDQLMIEMDGTPNKGKLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+Y+GG +A  LPVP+MNILNGG HADN +D QEFMI+PVGA +  E +RMGA
Sbjct: 124 NFFGLPLYQYVGGVNAKELPVPMMNILNGGAHADNNVDIQEFMILPVGAPSFAEGLRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH+LK  LK +G +T VGDEGGF+PNLK+ + AL +I  +IEKAGY  G+D+ + LD 
Sbjct: 184 EIFHSLKSVLKGRGLNTAVGDEGGFAPNLKSNEEALAVIIEAIEKAGYKPGQDVFLGLDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS  +K  KY+L GE +    +EM  +   LVD+YP+ +IEDG++EDDW GW  LT  +
Sbjct: 244 AASEMYKDGKYVLAGEGVTYSSDEMIEFYKKLVDKYPVITIEDGLAEDDWEGWAKLTQTL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN ERL +GI   VAN+ILIK NQIG+++ETL+ IE A+ AGY +++
Sbjct: 304 GKKVQLVGDDLFVTNTERLARGIKSGVANSILIKVNQIGTLTETLDAIEMAKRAGYTAVV 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGET+D TIADLAVATN GQIKTG+ +R DR+AKYNQL+RIEE LG  AK+ G+ + 
Sbjct: 364 SHRSGETDDTTIADLAVATNAGQIKTGAPSRIDRVAKYNQLLRIEEDLGTMAKYRGKDVF 423


>gi|155581|gb|AAA27686.1| enolase [Zymomonas mobilis subsp. mobilis CP4]
          Length = 428

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 273/422 (64%), Positives = 333/422 (78%), Gaps = 4/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I  I  R+V+DSRG+PT+EVDV LEDGS GRA VPSGASTG+HEA ELRD +K R+ GKG
Sbjct: 4   IVSIHGRQVVDSRGNPTVEVDVTLEDGSFGRAAVPSGASTGVHEAVELRDGDKTRWGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+EI  A++G +A DQ LID+ MI LDGTPNK + GANAILGVSLAV+KAAA
Sbjct: 64  VTKAVHAVNNEIANAIIGLEAEDQELIDQTMIKLDGTPNKGKFGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+Y+GG +AH+LPVP+MNI+NGG+HADN +DFQEFMI PVGA +I EA+R+G 
Sbjct: 124 EARGLPLYRYVGGTAAHVLPVPMMNIVNGGMHADNPIDFQEFMIAPVGASSINEAVRIGT 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKKEL +KG +TNVGDEGGF+P+L +A SALD I +SI KAGY  G+D+ IALD 
Sbjct: 184 EVFHTLKKELSAKGMNTNVGDEGGFAPSLDSASSALDFIVDSISKAGYKPGEDVFIALDA 243

Query: 242 AASAFFKKEK--YILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           A+S F+ K++  Y LKGE  +L   ++  Y   L  +YPIYSIED ++EDD+  WKILT 
Sbjct: 244 ASSEFYNKDQNIYDLKGEGRKLTSAQLVDYYVELCGKYPIYSIED-LAEDDFEFWKILTE 302

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           K+G   QLVGDDLFVTN +RL  GI   +AN++L+K NQIGS+SETL  +  A  A Y  
Sbjct: 303 KLGDKVQLVGDDLFVTNVKRLSDGIERGIANSLLVKFNQIGSLSETLAAVNMANDASYTP 362

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ++SHRS ETED TIADLAVATNCGQIKTGSL RS+RIAKYNQL+RIEE LG  AK+AGRS
Sbjct: 363 VMSHRSVETEDTTIADLAVATNCGQIKTGSLCRSERIAKYNQLMRIEEELGSVAKYAGRS 422

Query: 420 IL 421
           +L
Sbjct: 423 VL 424


>gi|326402340|ref|YP_004282421.1| enolase [Acidiphilium multivorum AIU301]
 gi|325049201|dbj|BAJ79539.1| enolase [Acidiphilium multivorum AIU301]
          Length = 425

 Score =  539 bits (1388), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 265/420 (63%), Positives = 319/420 (75%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DI ARE++DSRG+PT+EVDV L+ G+ GRA VPSGASTG HEA ELRD E  R+ GKG
Sbjct: 4   IADITAREILDSRGNPTVEVDVILDSGAMGRAAVPSGASTGAHEAVELRDGEPARFGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V +A+  V  EI  A+ G DA +Q+ ID+ MIDLDGTPNKSRLGANAILGVSLAV+KAAA
Sbjct: 64  VQRAVEAVEGEIFDAIGGMDASEQVAIDETMIDLDGTPNKSRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+YLGG  A  LPVP+MNI+NGG HADN +D QEFMI PVGA +I EA+RMG+
Sbjct: 124 DEIGLPLYRYLGGVYARTLPVPMMNIINGGKHADNPIDIQEFMIQPVGAASIAEAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVF  LKK L   G++TNVGDEGGF+P LK+A+ AL  +  ++E AGY AG+D+  ALDC
Sbjct: 184 EVFQALKKILHDAGHNTNVGDEGGFAPGLKSAEEALGFMTRAVEAAGYRAGEDIAFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ F+K  +Y L+GE   L    M  Y+A L   +PI S+ED +SEDDW GW   T+ +
Sbjct: 244 AATEFYKDGRYHLEGEGKVLDAGGMTDYIAALAKSFPIISVEDPLSEDDWEGWAHFTSTL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   Q+VGDDLFVTNP RL +GI  + AN+ILIK NQIG++SETL  +E AQ AG  ++I
Sbjct: 304 GGAMQVVGDDLFVTNPTRLRRGIAAKSANSILIKVNQIGTLSETLEAVELAQRAGMTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIAD+AVATN GQIKTGSLARSDR+AKYNQLIRIE  L    +FAGR+IL
Sbjct: 364 SHRSGETEDATIADIAVATNAGQIKTGSLARSDRVAKYNQLIRIEAELDIAGRFAGRTIL 423


>gi|148259187|ref|YP_001233314.1| phosphopyruvate hydratase [Acidiphilium cryptum JF-5]
 gi|166232164|sp|A5FUW3|ENO_ACICJ RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|146400868|gb|ABQ29395.1| enolase [Acidiphilium cryptum JF-5]
          Length = 425

 Score =  538 bits (1387), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 264/420 (62%), Positives = 319/420 (75%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DI ARE++DSRG+PT+EVDV L+ G+ GRA VPSGASTG HEA ELRD E  R+ GKG
Sbjct: 4   IADITAREILDSRGNPTVEVDVILDSGAMGRAAVPSGASTGAHEAVELRDGEPARFGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V +A+  V  EI  A+ G DA +Q+ ID+ MIDLDGTPNK+RLGANAILGVSLAV+KAAA
Sbjct: 64  VQRAVEAVEGEIFDAIGGMDASEQVAIDETMIDLDGTPNKARLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+YLGG  A  LPVP+MNI+NGG HADN +D QEFMI PVGA +I EA+RMG+
Sbjct: 124 DEIGLPLYRYLGGVYARTLPVPMMNIINGGKHADNPIDIQEFMIQPVGAASIAEAVRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVF  LKK L   G++TNVGDEGGF+P LK+A+ AL  +  ++E AGY AG+D+  ALDC
Sbjct: 184 EVFQALKKILHDAGHNTNVGDEGGFAPGLKSAEEALGFMTRAVEAAGYRAGEDIAFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ F+K  +Y L+GE   L    M  Y+A L   +PI S+ED +SEDDW GW   T+ +
Sbjct: 244 AATEFYKDGRYHLEGEGKVLDAGGMTDYIAALAKSFPIISVEDPLSEDDWEGWAHFTSTL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   Q+VGDDLFVTNP RL +GI  + AN+ILIK NQIG++SETL  +E AQ AG  ++I
Sbjct: 304 GGAMQVVGDDLFVTNPTRLRRGIAAKSANSILIKVNQIGTLSETLEAVELAQRAGMTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIAD+AVATN GQIKTGSLARSDR+AKYNQLIRIE  L    +FAGR+IL
Sbjct: 364 SHRSGETEDATIADIAVATNAGQIKTGSLARSDRVAKYNQLIRIEAELDIAGRFAGRTIL 423


>gi|302383638|ref|YP_003819461.1| enolase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194266|gb|ADL01838.1| enolase [Brevundimonas subvibrioides ATCC 15264]
          Length = 425

 Score =  538 bits (1386), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 263/421 (62%), Positives = 327/421 (77%), Gaps = 1/421 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+AR+++DSRG+PT+EVDV L+DGS GRA VPSGASTG HEA ELRD +K R+ GKG
Sbjct: 4   IADIVARQILDSRGNPTVEVDVVLDDGSFGRAAVPSGASTGKHEAVELRDGDKDRWGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V  A+  VN EI  AL G DA DQ  ID+ +I LDGT NKSRLGANAILGVSLAV+KA+A
Sbjct: 64  VQNAVDAVNGEIFDALSGMDAEDQRRIDEALITLDGTENKSRLGANAILGVSLAVAKASA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +  LPL++Y+GG SA +LP P+MNI+NGG HADN +D QEFMI+P GAE+  E +RMG+
Sbjct: 124 ISVGLPLFRYVGGISARVLPTPMMNIINGGAHADNPIDIQEFMILPTGAESFSEGLRMGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK+LK  G++TNVGDEGGF+PNL +A+ AL  I  + + AGY AG+D  + LD 
Sbjct: 184 EIFHALKKQLKDAGHNTNVGDEGGFAPNLASAEEALSFITKAGQAAGYLAGEDFHLGLDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y + GE   L    M +YLA+L +++PI SIEDG +EDD+ GWK+LT+ +
Sbjct: 244 AATEFFKDGAYNMAGEGKILDGEGMVAYLADLCERFPIVSIEDGCAEDDFDGWKLLTDAL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   Q+VGDDLFVTNP RL  GI E +AN+ILIK NQIG++SETL+ ++ A  AGY +++
Sbjct: 304 GERVQIVGDDLFVTNPARLAAGIGEGLANSILIKVNQIGTLSETLDAVDMAHRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR AKYNQL+RIEE LG QA + G  +L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRTAKYNQLLRIEELLGDQASYYGDGML 423

Query: 422 I 422
           +
Sbjct: 424 L 424


>gi|320332621|ref|YP_004169332.1| Enolase [Deinococcus maricopensis DSM 21211]
 gi|319753910|gb|ADV65667.1| Enolase [Deinococcus maricopensis DSM 21211]
          Length = 423

 Score =  537 bits (1384), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 256/423 (60%), Positives = 325/423 (76%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGK 60
           M I +IIAREV+DSRG+PT+E +V LE G  GRA+VPSGASTG HEA ELRD  +RY GK
Sbjct: 1   MKIENIIAREVLDSRGNPTVEAEVTLESGFVGRAIVPSGASTGTHEALELRDGGERYLGK 60

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN EI   L+G DA  Q+ ID+ M+ LDGTPNK+RLG NA+L VS+A ++AA
Sbjct: 61  GVLKAVENVNTEIAPELIGMDASSQVAIDRAMLALDGTPNKARLGGNAMLAVSMATARAA 120

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           ++   +PLY+YLGG +A  LP+P+MN++NGG HADN++DFQEFM+MPVGA + REA+R G
Sbjct: 121 SEGLGVPLYRYLGGNNAKTLPLPMMNLINGGAHADNSVDFQEFMVMPVGAPSFREALRYG 180

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE FH LKK L ++GY+TNVGDEGGF+P+L + + AL+++  +IEKAGY  GKD+ IALD
Sbjct: 181 AETFHQLKKVLSARGYNTNVGDEGGFAPDLGSNEEALEVLLEAIEKAGYEPGKDIAIALD 240

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A S  +K  +Y L+GE   L   EM  + A+   +YPI SIEDG+ EDDW GWK+LT+ 
Sbjct: 241 PATSELYKDGQYHLEGEGRVLSSEEMVDFWADWASRYPIVSIEDGLHEDDWAGWKLLTDT 300

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG   QLVGDDLFVTNPERL +G+ E VAN+IL+K NQIG+++E ++ IE A+   Y ++
Sbjct: 301 IGERVQLVGDDLFVTNPERLGRGLREGVANSILVKVNQIGTLTEAMDAIELAKRHRYTTV 360

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           ISHRSGE+ED  IADLAVATN GQIKTGS +RSDRIAKYNQL+RIE  LG  A F GR+ 
Sbjct: 361 ISHRSGESEDAFIADLAVATNAGQIKTGSASRSDRIAKYNQLLRIEHQLGDAAVFLGRAA 420

Query: 421 LIH 423
           L+ 
Sbjct: 421 LLR 423


>gi|241764326|ref|ZP_04762354.1| Phosphopyruvate hydratase [Acidovorax delafieldii 2AN]
 gi|241366282|gb|EER60825.1| Phosphopyruvate hydratase [Acidovorax delafieldii 2AN]
          Length = 428

 Score =  537 bits (1383), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 263/419 (62%), Positives = 322/419 (76%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIVGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A+LG DA +Q  +DK +IDLDGT NKSRLGANA+L VS+AV++AAA
Sbjct: 64  VLKAVEHINTEISEAVLGLDASEQAFLDKTLIDLDGTDNKSRLGANAMLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+LD QEFMI+PVGA   REA+R GA
Sbjct: 124 EESGLPLYRYLGGMGGMQLPVPMMNVINGGAHANNSLDLQEFMIIPVGAPTFREALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  KG ST VGDEGGF+P+++  ++A+ LI  +IE AGY AG+ + + LDC
Sbjct: 184 EVFHALKKILHDKGISTAVGDEGGFAPSVENHEAAIQLILQAIEAAGYTAGEQIALGLDC 243

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AAS F+K   Y+L+GE  L L   +    LA  VD+YPI SIEDGM E DW GWKILT +
Sbjct: 244 AASEFYKDGMYVLEGEGGLRLTAQQWTDMLATWVDKYPIISIEDGMHEGDWEGWKILTER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G+N QLVGDDLFVTN   L +GI++ +AN+ILIK NQIG+++ET   IE A+ AGY ++
Sbjct: 304 LGNNVQLVGDDLFVTNTRILKEGIDKRIANSILIKINQIGTLTETFAAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ISHRSGETED TIAD+AV TN GQIKTGSL+RSDRIAKYNQL+RIEE LG  A + GR+
Sbjct: 364 ISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDIAHYPGRA 422


>gi|294788335|ref|ZP_06753578.1| phosphopyruvate hydratase [Simonsiella muelleri ATCC 29453]
 gi|294483766|gb|EFG31450.1| phosphopyruvate hydratase [Simonsiella muelleri ATCC 29453]
          Length = 428

 Score =  537 bits (1383), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 269/416 (64%), Positives = 326/416 (78%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IIDIVAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGEKEALELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+EI  AL+G DA +Q  ID+IMIDLDGT  K+RLGANA+L VSLAV++AAA
Sbjct: 64  VLKAVEHVNNEIAQALIGIDASEQSYIDQIMIDLDGTDTKARLGANAMLAVSLAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG     LPVP+MN++NGG HA+N+LD QEFMIMPVGA + REA+R GA
Sbjct: 124 EDAGLPLYRYLGGAGPMALPVPMMNVVNGGEHANNSLDIQEFMIMPVGAASFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   SKG+ T VGDEGGF+PNL + + AL LI  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EIFHMLKKLCDSKGFPTTVGDEGGFAPNLNSHEEALQLIMEAIEKAGYKAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F++  KY L  E       E A YL NLVD+YPI SIEDGM E+DW GW+ LT K+
Sbjct: 244 ASSEFYEGGKYHLSAEGKSYTSEEFADYLVNLVDKYPIISIEDGMDENDWAGWQYLTQKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  QLVGDDLFVTNP+ L +GI E VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GSRIQLVGDDLFVTNPKILAQGIKENVANALLVKVNQIGTLSETLKAVDLAKRNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE LG+ A + G
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELGESAYYPG 419


>gi|307266215|ref|ZP_07547757.1| enolase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326390581|ref|ZP_08212137.1| enolase [Thermoanaerobacter ethanolicus JW 200]
 gi|306918745|gb|EFN48977.1| enolase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325993406|gb|EGD51842.1| enolase [Thermoanaerobacter ethanolicus JW 200]
          Length = 429

 Score =  536 bits (1381), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 260/419 (62%), Positives = 332/419 (79%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EV+V L+ G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IIDIFAREILDSRGNPTVEVEVELDSGAVGRAAVPSGASTGAFEAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VND I   L+G +A+DQ+ IDK MI+LDGTPNKS+LGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVQNVNDIIAPELIGMEAQDQVAIDKAMIELDGTPNKSKLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+Y+GG +A  LPVP+MNILNGG HADN +D QEFMIMPVGA N REA+RM +
Sbjct: 124 EECGLPLYQYIGGVNAKTLPVPMMNILNGGKHADNNVDIQEFMIMPVGAPNFREALRMCS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LK  L SKG ST VGDEGGF+PNL + + A+ +I  +IEKAGY  G+D+++ALD 
Sbjct: 184 EVYHNLKNVLHSKGLSTTVGDEGGFAPNLTSNEEAIQVILEAIEKAGYVPGEDIVLALDP 243

Query: 242 AASAFFKKE-KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           A++  +K++ KY  +GE +   P EM  +   LV++YPI SIEDG++E+DW+GWK+LT +
Sbjct: 244 ASTELYKEDGKYHFEGEGIVRTPEEMVDFWEQLVNKYPIVSIEDGLAEEDWNGWKLLTER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN +RL KGI+  VAN+ILIK NQIG+++ETL+ IE A+ AGY ++
Sbjct: 304 LGKKIQLVGDDLFVTNTQRLSKGISMGVANSILIKLNQIGTLTETLDAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           +SHRSGETED TIADL V  N GQIKTG+ AR+DR+ KYNQL+RIEE+LG  A++ G++
Sbjct: 364 VSHRSGETEDSTIADLVVGVNAGQIKTGAPARTDRVVKYNQLLRIEEALGSTAQYLGKN 422


>gi|323701575|ref|ZP_08113247.1| enolase [Desulfotomaculum nigrificans DSM 574]
 gi|323533348|gb|EGB23215.1| enolase [Desulfotomaculum nigrificans DSM 574]
          Length = 427

 Score =  536 bits (1380), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 257/421 (61%), Positives = 325/421 (77%), Gaps = 1/421 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I+D+ ARE++DSRG+PT+E +V LEDG+ GRA VPSGASTG +EA ELRD +K RY GK
Sbjct: 3   IISDVFAREILDSRGNPTLEAEVWLEDGTVGRAAVPSGASTGAYEAVELRDGDKGRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV+KA+  VN  I   L+G D  DQ+ ID++MI+LDGTPNK +LGANAILGVSLAV+KAA
Sbjct: 63  GVIKAVDNVNKLIGPELIGMDVTDQIGIDRLMIELDGTPNKGKLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    LPLY+Y+GG +A  LPVP+MNILNGG HADN +D QEFMI+P GA +  E +RMG
Sbjct: 123 ANYCGLPLYQYIGGINAKELPVPMMNILNGGAHADNNVDIQEFMILPAGAHSFSEGLRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE+FH LK  LK +G +T VGDEGGF+PNLK+ + AL +I  +IEKAGY  G+D+ + LD
Sbjct: 183 AEIFHNLKAVLKGRGLNTAVGDEGGFAPNLKSNEEALAVIIEAIEKAGYKPGQDVFLGLD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            AA+  +K  KYIL+GE +    +EM  +   LVD+YP+ +IEDG+SEDDW GW  LT  
Sbjct: 243 VAATELYKDGKYILEGEGVTYTSDEMIDFYQRLVDKYPVITIEDGLSEDDWEGWAKLTRA 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN ERL KGI   VAN+ILIK NQIG+++ETL+ IE A+ AGY ++
Sbjct: 303 LGKKIQLVGDDLFVTNTERLAKGIKSGVANSILIKVNQIGTLTETLDAIEMAKRAGYTAV 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           +SHRSGET+D TIADLAVA N GQIKTG+ +R+DR+AKYNQL+RIEE LG+ A++ GR +
Sbjct: 363 VSHRSGETDDTTIADLAVAANAGQIKTGAPSRTDRVAKYNQLLRIEEELGELARYRGREV 422

Query: 421 L 421
            
Sbjct: 423 F 423


>gi|167037153|ref|YP_001664731.1| phosphopyruvate hydratase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|320115572|ref|YP_004185731.1| enolase [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|238687645|sp|B0K882|ENO_THEP3 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|166855987|gb|ABY94395.1| Phosphopyruvate hydratase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|319928663|gb|ADV79348.1| enolase [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 429

 Score =  536 bits (1380), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 260/419 (62%), Positives = 332/419 (79%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EV+V L+ G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IIDIFAREILDSRGNPTVEVEVELDSGAVGRAAVPSGASTGAFEAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VND I   L+G +A+DQ+ IDK MI+LDGTPNKS+LGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVQNVNDIIAPELIGMEAQDQVAIDKAMIELDGTPNKSKLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+Y+GG +A  LPVP+MNILNGG HADN +D QEFMIMPVGA N REA+RM +
Sbjct: 124 EECGLPLYQYIGGVNAKTLPVPMMNILNGGKHADNNVDIQEFMIMPVGAPNFREALRMCS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LK  L SKG ST VGDEGGF+PNL + + A+ +I  +IEKAGY  G+D+++ALD 
Sbjct: 184 EVYHNLKNVLHSKGLSTTVGDEGGFAPNLTSNEEAIQVILEAIEKAGYVPGEDIVLALDP 243

Query: 242 AASAFFKKE-KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           A++  +K++ KY  +GE +   P EM  +   LV++YPI SIEDG++E+DW+GWK+LT +
Sbjct: 244 ASTELYKEDGKYHFEGEGIVRTPEEMVDFWEQLVNKYPIVSIEDGLAEEDWNGWKLLTER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN +RL KGI+  VAN+ILIK NQIG+++ETL+ IE A+ AGY ++
Sbjct: 304 LGKKIQLVGDDLFVTNTQRLSKGISMGVANSILIKLNQIGTLTETLDAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           +SHRSGETED TIADL V  N GQIKTG+ AR+DR+ KYNQL+RIEE+LG  A++ G++
Sbjct: 364 VSHRSGETEDSTIADLVVGVNAGQIKTGAPARTDRVVKYNQLLRIEEALGSTAQYLGKN 422


>gi|225677413|ref|ZP_03788380.1| enolase [Wolbachia endosymbiont of Muscidifurax uniraptor]
 gi|225590557|gb|EEH11817.1| enolase [Wolbachia endosymbiont of Muscidifurax uniraptor]
          Length = 424

 Score =  536 bits (1380), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 265/414 (64%), Positives = 325/414 (78%), Gaps = 3/414 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQ-EKRYFGKG 61
           IN++ ARE++DSRG PT+EV++ L DG  GRA VPSGASTG  EA ELRDQ EKRY GKG
Sbjct: 5   INNVFAREILDSRGYPTVEVEIELCDGVIGRASVPSGASTGKLEALELRDQDEKRYCGKG 64

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN  I   + G +A DQ  IDK +I+LDGT NKS+LGANA LGVSLAV+KAAA
Sbjct: 65  VLKAVQAVNGIIADEIFGMNAADQNAIDKALIELDGTKNKSKLGANATLGVSLAVAKAAA 124

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + N+PLY+YLGG    ++PVPL+NI+NGG+HADN LDFQEFMI+PVGAE   EAIRM A
Sbjct: 125 NSFNMPLYRYLGGEQMSVMPVPLINIINGGVHADNKLDFQEFMILPVGAETFSEAIRMSA 184

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH L+  LK KGYSTNVGDEGGF+PN+++ + ALDLI  +IE AGY+A  D  + LD 
Sbjct: 185 EVFHNLRSILKKKGYSTNVGDEGGFAPNIESTEEALDLIIYAIESAGYSAQSDFALGLDV 244

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+  E  I K E+ +L   E+  Y  NLV++YPI SIED MSEDD+ GWK+LT K+
Sbjct: 245 ASSTFY--EDGIYKFEHRDLTSEELTEYYCNLVERYPIISIEDAMSEDDYEGWKLLTAKL 302

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  QLVGDDLFVTN E + KGI E++ANA+LIKPNQIG+++ET   IE A+  GY ++I
Sbjct: 303 GSKIQLVGDDLFVTNCELICKGIEEKMANAVLIKPNQIGTLTETFAAIEMAKSNGYKAVI 362

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           SHRSGETED TI+ +AVA+NCGQIKTGSL+RSDR+AKYN+LIRIE +LGK AK+
Sbjct: 363 SHRSGETEDTTISHIAVASNCGQIKTGSLSRSDRLAKYNELIRIESALGKDAKY 416


>gi|254419596|ref|ZP_05033320.1| phosphopyruvate hydratase [Brevundimonas sp. BAL3]
 gi|196185773|gb|EDX80749.1| phosphopyruvate hydratase [Brevundimonas sp. BAL3]
          Length = 425

 Score =  535 bits (1379), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 263/422 (62%), Positives = 332/422 (78%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFG-KG 61
           I DI+AR+++DSRG+PT+EVDV L+DGS GRA VPSGASTG HEA ELRD +K  +G KG
Sbjct: 4   IADIVARQILDSRGNPTVEVDVILDDGSFGRASVPSGASTGAHEAVELRDGDKDLWGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN EI  AL G DA DQ  ID+ MIDLDGTPNK+RLGANAILGVSLA +KA+A
Sbjct: 64  VQKAVDAVNGEIFDALSGMDAEDQRRIDEAMIDLDGTPNKARLGANAILGVSLAAAKASA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            ++ LPL++Y+GG SA +LP P+MNI+NGG HADN +D QEFMI+P GAE   +A+RMGA
Sbjct: 124 ISAGLPLHRYIGGVSARVLPTPMMNIINGGAHADNPIDIQEFMILPTGAETFTDALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK+LK  G++TNVGDEGGF+PNL +A+ AL  I  + + AGY AG+D  + LD 
Sbjct: 184 EIFHALKKQLKDAGHNTNVGDEGGFAPNLASAEEALSFITKAGQAAGYLAGEDFHLGLDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY++ GE   +    MA+YL +L +++PI SIED M+EDD+ GW++LT ++
Sbjct: 244 ASTEFFKDGKYVMAGEGKTVDAEGMAAYLVDLCERFPIVSIEDAMAEDDFDGWRLLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP RL  GI E +AN+ILIK NQIG++SETL+ ++ A  AGY +++
Sbjct: 304 GDRVQLVGDDLFVTNPARLAAGIGEGLANSILIKVNQIGTLSETLDAVDMAHRAGYTAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNCGQIKTGSLARSDR+AKYNQL+R+EE LG QA + G  +L
Sbjct: 364 SHRSGETEDSTIADLAVATNCGQIKTGSLARSDRVAKYNQLLRLEEMLGDQAVYFGDGML 423

Query: 422 IH 423
           + 
Sbjct: 424 LR 425


>gi|134300819|ref|YP_001114315.1| phosphopyruvate hydratase [Desulfotomaculum reducens MI-1]
 gi|134053519|gb|ABO51490.1| enolase [Desulfotomaculum reducens MI-1]
          Length = 428

 Score =  535 bits (1378), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 330/421 (78%), Gaps = 1/421 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I+D+ ARE++DSRG+PT+E +V LEDG+ GRA VPSGASTG +EA ELRD +K RY GK
Sbjct: 3   IISDVFAREILDSRGNPTLEAEVWLEDGTIGRAAVPSGASTGAYEAVELRDGDKGRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV++A+  VN+ I   L+G DA DQ+ ID++MI+LDGT NK +LGANAILGVSLAV+KAA
Sbjct: 63  GVVQAVENVNEIIGPELIGMDATDQIGIDRLMIELDGTHNKGKLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    LPLY+Y+GG +A  LPVP+MNILNGG HADN +D QEFM++PVGA++  E +RMG
Sbjct: 123 ANFLGLPLYQYIGGVNAKELPVPMMNILNGGAHADNNVDIQEFMVLPVGADSFSEGLRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE+FH LK  LK++G +T VGDEGGF+PNLK+ + AL +I  +IEKAGY  G+D+ + LD
Sbjct: 183 AEIFHNLKSVLKARGLNTAVGDEGGFAPNLKSNEEALAVIIEAIEKAGYKPGQDVFLGLD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            AA+  +K  KY+L+GE +     EM ++   LVD+YPI +IEDG+SEDDW GW  LT  
Sbjct: 243 VAATEMYKDGKYVLEGEGVTYTSEEMIAFYQKLVDKYPIITIEDGLSEDDWEGWAKLTQA 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN ERL +GI + VAN+ILIK NQIG+++ETL+ IE A+ AGY ++
Sbjct: 303 LGKKIQLVGDDLFVTNTERLSQGIKKGVANSILIKVNQIGTLTETLDAIEMAKRAGYTAV 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           +SHRSGET+D TIADL+VATN GQIKTG+ +R+DR+AKYNQL+RIEE LG  +++ G+ +
Sbjct: 363 VSHRSGETDDTTIADLSVATNAGQIKTGAPSRTDRVAKYNQLLRIEEELGDMSRYRGKEV 422

Query: 421 L 421
            
Sbjct: 423 F 423


>gi|300857054|ref|YP_003782038.1| enolase [Clostridium ljungdahlii DSM 13528]
 gi|300437169|gb|ADK16936.1| enolase [Clostridium ljungdahlii DSM 13528]
          Length = 432

 Score =  535 bits (1377), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 256/416 (61%), Positives = 329/416 (79%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I D++AR+++DSR +PT+EV+V LEDG+ GR+ VPSGASTG  EA ELRD + ++Y GKG
Sbjct: 7   IVDVMARQILDSRSNPTVEVEVVLEDGTVGRSAVPSGASTGAFEAVELRDGDTEKYKGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKAI  +N+ +   L+G +  DQ+LIDK MI+LDGT NK++LGANA LGVSLA ++AAA
Sbjct: 67  VLKAIDNINNYVAEELIGMNVFDQVLIDKTMIELDGTKNKAKLGANATLGVSLACARAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   L LY+Y+GG +A +LPVP+MNILNGG HADN +D QEFMIMP GA +  EA+RM +
Sbjct: 127 EYLGLSLYQYIGGVNAKVLPVPMMNILNGGKHADNNVDLQEFMIMPAGAPSFSEALRMSS 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLK  LKSKGY T VGDEGGF+PNLK+ + A+ +I  +IEKAGY  GKD+ IALD 
Sbjct: 187 EVYHTLKSLLKSKGYDTGVGDEGGFAPNLKSNEEAIQVIVEAIEKAGYTPGKDIFIALDP 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F++  KY LKGE   L P EM  +  ++ ++YPI S+EDGM+E+DW GW +LT K+
Sbjct: 247 ASSEFYEDGKYNLKGEGKVLTPAEMVDFYVDIANKYPIISLEDGMAEEDWEGWALLTEKL 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN ERL KGI+++VAN+ILIK NQIG+++ETLN IE A+ AGY +++
Sbjct: 307 GDKIQLVGDDLFVTNTERLKKGIDKKVANSILIKLNQIGTLTETLNAIEMAERAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQL+RIEE LG+ A++ G
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLLRIEEELGEVAEYRG 422


>gi|27262298|gb|AAN87430.1| Enolase [Heliobacillus mobilis]
 gi|111075003|gb|ABH04857.1| enolase [Heliobacillus mobilis]
          Length = 434

 Score =  535 bits (1377), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 257/422 (60%), Positives = 327/422 (77%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I ++ ARE++DSRG+PT+EV+V LEDG+ GRA VPSGASTG +EA ELRD +K RY GKG
Sbjct: 9   IAEVYAREILDSRGNPTVEVEVVLEDGTVGRAAVPSGASTGAYEAVELRDGDKERYLGKG 68

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  VN EI   ++G D   Q+ ID  +I+LDGTPNK RLGANAILGVS+A +KAAA
Sbjct: 69  VLNAVDNVNTEIAPEIIGWDVTRQMEIDSALIELDGTPNKGRLGANAILGVSMACAKAAA 128

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           Q   LPL++YLGG  A  LPVP+MNILNGG HADN +D QEFM+MPVGA++  E +RMG 
Sbjct: 129 QYQGLPLFQYLGGVFARELPVPMMNILNGGKHADNNVDIQEFMVMPVGAQSFSEGLRMGV 188

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH+LKK L+SKG +T VGDEGGF+PNLK+ + AL +I  +++ AGY AG+D+L+A+D 
Sbjct: 189 EVFHSLKKVLQSKGLNTAVGDEGGFAPNLKSNEEALKVILEAVQAAGYKAGEDILLAVDA 248

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS  +K  KY L+GE   +   EM  +  +LV++YPI SIEDG++EDDW GWK+LT+++
Sbjct: 249 AASEMYKDGKYHLEGEGKVMTSAEMVDFWEDLVNRYPIISIEDGLNEDDWDGWKLLTDRL 308

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN E+L KGI   V N+ILIK NQIG+++ETL  IE A+ AGY ++I
Sbjct: 309 GKRAQLVGDDLFVTNTEKLSKGIETGVGNSILIKVNQIGTITETLAAIEMARRAGYTAVI 368

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVA N GQIKTG+ +R+DR+AKYNQL+RIEE L +QA + G+   
Sbjct: 369 SHRSGETEDATIADLAVAVNAGQIKTGAPSRTDRVAKYNQLLRIEEELDEQATYRGKKTF 428

Query: 422 IH 423
            +
Sbjct: 429 FN 430


>gi|288575992|ref|ZP_05977960.2| phosphopyruvate hydratase [Neisseria mucosa ATCC 25996]
 gi|288566501|gb|EFC88061.1| phosphopyruvate hydratase [Neisseria mucosa ATCC 25996]
          Length = 483

 Score =  535 bits (1377), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 322/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 59  IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYLGKG 118

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  IDKIMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 119 VLKAVEHVNNQIAQALIGIDANEQSYIDKIMIELDGTENKGNLGANATLAVSMAVARAAA 178

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 179 EDSGLPLYRYLGGVGPMALPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 238

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK    KG+ T VGDEGGF+PNL +   AL L+  + E AGY AG D+L ALDC
Sbjct: 239 EIFHALKKLCDGKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYKAGDDVLFALDC 298

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YL  LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 299 ASSEFYKDGKYHLEAEGRSYTSAEFAEYLEGLVNEFPIISIEDGMDENDWEGWKLLTEKL 358

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+ + Y S++
Sbjct: 359 GSKVQLVGDDLFVTNPKILAQGIEKGVANALLVKVNQIGTLSETLQAVDLAKRSRYASVM 418

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A ++G++
Sbjct: 419 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAAYYSGKA 476


>gi|222110126|ref|YP_002552390.1| phosphopyruvate hydratase [Acidovorax ebreus TPSY]
 gi|254783248|sp|B9MEQ4|ENO_ACIET RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|221729570|gb|ACM32390.1| enolase [Acidovorax ebreus TPSY]
          Length = 428

 Score =  534 bits (1376), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 260/419 (62%), Positives = 323/419 (77%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIVGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A+LG DA +Q  +DK +IDLDGT NKSRLGANA+L VS+AV++AAA
Sbjct: 64  VLKAVEHINTEISEAVLGLDASEQAFLDKTLIDLDGTDNKSRLGANAMLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+LD QEFMI+PVGA + REA+R GA
Sbjct: 124 EESGLPLYRYLGGMGGMQLPVPMMNVINGGAHANNSLDLQEFMIIPVGAPSFREAVRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK +  KG ST VGDEGGF+P+++  ++A+ LI  +IE AGY AG+ + + LDC
Sbjct: 184 EVFHALKKIIHDKGMSTAVGDEGGFAPSVENHEAAIQLILQAIEAAGYTAGEQIALGLDC 243

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AAS F+K  +Y+L+GE  L L   +    LA   D+YPI SIEDGM+E DW GWK LT +
Sbjct: 244 AASEFYKDGQYVLEGEGGLRLTAQQWTDMLATWCDKYPIISIEDGMAEGDWDGWKTLTER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G N QLVGDDLFVTN + L +GI++ +AN+ILIK NQIG+++ET   IE A+ AGY ++
Sbjct: 304 LGQNVQLVGDDLFVTNTKILKEGIDKRIANSILIKINQIGTLTETFAAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ISHRSGETED TIAD+AV TN GQIKTGSL+RSDRIAKYNQL+RIEE LG  A + GR+
Sbjct: 364 ISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDIAFYPGRA 422


>gi|171057859|ref|YP_001790208.1| phosphopyruvate hydratase [Leptothrix cholodnii SP-6]
 gi|238689109|sp|B1Y4K4|ENO_LEPCP RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|170775304|gb|ACB33443.1| Phosphopyruvate hydratase [Leptothrix cholodnii SP-6]
          Length = 427

 Score =  534 bits (1376), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 324/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIVGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  +N EI  A+LG DA +Q  +DK +IDLDGT NK RLGANA+L VS+AV++AAA
Sbjct: 64  VLNAVKNINTEISEAVLGLDAAEQSFLDKTLIDLDGTDNKGRLGANAMLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y GG  A  LPVP+MN++NGG HA+N+LD QE MI+PVGA + REA+R GA
Sbjct: 124 EESGLPLYRYFGGMGAVQLPVPMMNVINGGAHANNSLDLQEMMIIPVGAPSFREAVRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  KG ST VGDEGGF+P++++ ++A+ LI  +I+KAGY AG+ + + LDC
Sbjct: 184 EVFHALKKILHDKGISTAVGDEGGFAPSVESHEAAIQLILQAIDKAGYRAGEQIALGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY L+GE L L   E    +A  VD+YPI SIEDGM+E DW GWK+LT+++
Sbjct: 244 AASEFYKDGKYHLEGEGLSLTAQEWTDMMAAWVDKYPIISIEDGMAEGDWDGWKLLTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G N Q+VGDDLFVTN + L +GI + +AN+ILIK NQIG++SET   IE A+ AGY ++I
Sbjct: 304 GKNVQIVGDDLFVTNTKILKEGIEKGIANSILIKINQIGTLSETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AVATN GQIKTGS++RSDR+AKYNQL+RIEE LG  A + GR+
Sbjct: 364 SHRSGETEDSTIADIAVATNAGQIKTGSMSRSDRMAKYNQLLRIEEDLGDVAVYPGRA 421


>gi|256751251|ref|ZP_05492131.1| enolase [Thermoanaerobacter ethanolicus CCSD1]
 gi|256749806|gb|EEU62830.1| enolase [Thermoanaerobacter ethanolicus CCSD1]
          Length = 427

 Score =  534 bits (1376), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 261/423 (61%), Positives = 331/423 (78%), Gaps = 2/423 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EV+V L+ G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IIDIFAREILDSRGNPTVEVEVELDSGAVGRAAVPSGASTGAFEAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VND I   L+G +A+DQ+ IDK MI+LDGTPNKS+LGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVQNVNDIIAPELIGMEAQDQVAIDKAMIELDGTPNKSKLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+Y+GG +A  LPVP+MNILNGG HADN +D QEFMIMPVGA N REA+RM +
Sbjct: 124 EECGLPLYQYIGGVNAKTLPVPMMNILNGGKHADNNVDIQEFMIMPVGAPNFREALRMCS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LK  L SKG ST VGDEGGF+PNL + + A+ +I  +IEKAGY  G+D+++ALD 
Sbjct: 184 EVYHNLKNVLHSKGLSTTVGDEGGFAPNLTSNEEAIQVILEAIEKAGYVPGEDIVLALDP 243

Query: 242 AASAFFKKE-KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AA+  +K++ KY  +GE +     EM  +   LV++YPI SIEDG++E+DW+GWK+LT +
Sbjct: 244 AATEMYKEDGKYHFEGEGIVRTSAEMVDFWEQLVNKYPIVSIEDGLAEEDWNGWKLLTER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN +RL KGI+  VAN+ILIK NQIG+++ETL+ IE A+ AGY ++
Sbjct: 304 LGKKIQLVGDDLFVTNTQRLSKGISMGVANSILIKLNQIGTLTETLDAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           +SHRSGETED TIADL V  N GQIKTG+ AR+DR+AKYNQL+RIEE LG  A++ G+  
Sbjct: 364 VSHRSGETEDSTIADLVVGVNAGQIKTGAPARTDRVAKYNQLLRIEEVLGSTAQYLGKKC 423

Query: 421 LIH 423
            + 
Sbjct: 424 FLQ 426


>gi|167039953|ref|YP_001662938.1| phosphopyruvate hydratase [Thermoanaerobacter sp. X514]
 gi|300915503|ref|ZP_07132815.1| enolase [Thermoanaerobacter sp. X561]
 gi|307724723|ref|YP_003904474.1| enolase [Thermoanaerobacter sp. X513]
 gi|238687636|sp|B0K6X6|ENO_THEPX RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|166854193|gb|ABY92602.1| Phosphopyruvate hydratase [Thermoanaerobacter sp. X514]
 gi|300888455|gb|EFK83605.1| enolase [Thermoanaerobacter sp. X561]
 gi|307581784|gb|ADN55183.1| enolase [Thermoanaerobacter sp. X513]
          Length = 429

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 331/419 (78%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EV+V L+ G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IIDIFAREILDSRGNPTVEVEVELDSGAVGRAAVPSGASTGAFEAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VND I   L+G +A+DQ+ IDK MI+LDGTPNKS+LGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVQNVNDIIAPELIGMEAQDQVAIDKAMIELDGTPNKSKLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+Y+GG +A  LPVP+MNILNGG HADN +D QEFMIMPVGA N REA+RM +
Sbjct: 124 EECGLPLYQYIGGVNAKTLPVPMMNILNGGKHADNNVDIQEFMIMPVGAPNFREALRMCS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LK  L SKG ST VGDEGGF+PNL + + A+ +I  +IEKAGY  G+D+++ALD 
Sbjct: 184 EVYHNLKNVLHSKGLSTTVGDEGGFAPNLTSNEEAIQVILEAIEKAGYVPGEDIVLALDP 243

Query: 242 AASAFFKKE-KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AA+  +K++ KY  +GE +     EM  +   LV++YPI SIEDG++E+DW+GWK+LT +
Sbjct: 244 AATEMYKEDGKYHFEGEGIVRTSAEMVDFWEQLVNKYPIVSIEDGLAEEDWNGWKLLTER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN +RL KGI+  VAN+ILIK NQIG+++ETL+ IE A+ AGY ++
Sbjct: 304 LGKKIQLVGDDLFVTNTQRLSKGISMGVANSILIKLNQIGTLTETLDAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           +SHRSGETED TIADL V  N GQIKTG+ AR+DR+AKYNQL+RIEE LG  A++ G++
Sbjct: 364 VSHRSGETEDSTIADLVVGVNAGQIKTGAPARTDRVAKYNQLLRIEEVLGSTAQYLGKN 422


>gi|224824525|ref|ZP_03697632.1| Phosphopyruvate hydratase [Lutiella nitroferrum 2002]
 gi|224603018|gb|EEG09194.1| Phosphopyruvate hydratase [Lutiella nitroferrum 2002]
          Length = 427

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 262/422 (62%), Positives = 324/422 (76%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+IARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IIDVIAREILDSRGNPTVEADVLLESGVMGRAAVPSGASTGAKEALELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA DQ  IDK +I+LDGT NK RLGANA+L VS+AV++AAA
Sbjct: 64  VLKAVENINTEICEAIIGLDASDQAFIDKTLIELDGTENKGRLGANAMLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG     LPVP+MN++NGG HA+N LD QEFMIMPVGA   REA+R GA
Sbjct: 124 EDAGLPLYRYLGGAGPMALPVPMMNVINGGAHANNTLDIQEFMIMPVGAATFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH+LKK    KGYST VGDEGGF+PNL T + A+ LI ++I+ AGY AG+D+++ALDC
Sbjct: 184 EIFHSLKKLCDQKGYSTTVGDEGGFAPNLATHEDAIKLILDAIDAAGYVAGQDVMLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  +Y L  E L L   +   YL  L + YPI SIEDGMSE DW GWKILT ++
Sbjct: 244 ASSEFYKDGQYHLSAEGLSLSSEQFVDYLETLANNYPIISIEDGMSEHDWDGWKILTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP  L +GI + +AN++L+K NQIG++SETL  ++ A+ +GY S++
Sbjct: 304 GKRVQLVGDDLFVTNPTILAEGIQQGLANSLLVKVNQIGTLSETLKAVDLAKRSGYTSVL 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADL+VATNC QIKTGSL+RSDR+AKYNQL+RIEE LG  A + GRS  
Sbjct: 364 SHRSGETEDSTIADLSVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELGDAAYYPGRSAF 423

Query: 422 IH 423
            H
Sbjct: 424 YH 425


>gi|315644540|ref|ZP_07897672.1| enolase [Paenibacillus vortex V453]
 gi|315280047|gb|EFU43344.1| enolase [Paenibacillus vortex V453]
          Length = 429

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 262/417 (62%), Positives = 331/417 (79%), Gaps = 1/417 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I+D+ AREV+DSRG+PT+EV+V LE G+ GRA+VPSGASTGIHEA ELRD++K RY GK
Sbjct: 3   IISDVYAREVLDSRGNPTVEVEVYLESGAIGRAIVPSGASTGIHEAVELRDEDKSRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN+ I   ++G DA DQL IDK+MI LDGTPNK +LGANAIL VS+AV++AA
Sbjct: 63  GVLKAVENVNEIIAPEVIGMDALDQLGIDKLMIALDGTPNKGKLGANAILAVSMAVARAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A   +LPLY YLGG +A  LPVP+MNI+NGG HADN +D QEFM++PVGA + +EA+RMG
Sbjct: 123 ADALDLPLYVYLGGFNAKQLPVPMMNIVNGGAHADNNVDVQEFMVLPVGAPSFKEALRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE+FH LK  LK KG +T VGDEGGF+PN  + + AL  I  +IEKAGY  G+D+L+ +D
Sbjct: 183 AEIFHNLKSVLKGKGLNTAVGDEGGFAPNFTSNEDALTSIIEAIEKAGYKPGEDVLLGMD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A++ FFK  KY+L+GE     P E    LA+ VD+YPI +IEDG SEDDW GWK+LT K
Sbjct: 243 VASTEFFKDGKYVLEGEGKSFTPAEFVDLLASWVDKYPIVTIEDGCSEDDWEGWKLLTEK 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G+  QLVGDDLFVTN ERL KGINE + N+ILIK NQIG+++ET + IE A+ AGY ++
Sbjct: 303 LGNKIQLVGDDLFVTNTERLEKGINEGIGNSILIKVNQIGTLTETFDAIEMAKRAGYTAV 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ISHRSGE+ED TIAD+AVATN GQIKTG+ +R+DR+AKYNQL+RIE+ LG+ A++ G
Sbjct: 363 ISHRSGESEDSTIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDQLGELAQYNG 419


>gi|239816419|ref|YP_002945329.1| enolase [Variovorax paradoxus S110]
 gi|259645938|sp|C5CSV6|ENO_VARPS RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|239802996|gb|ACS20063.1| enolase [Variovorax paradoxus S110]
          Length = 427

 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 257/417 (61%), Positives = 321/417 (76%), Gaps = 1/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGKG 61
           I DI+ RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD  +KRY GKG
Sbjct: 4   IVDIVGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGDKKRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  ++LG DA +Q  +D+ MIDLDGT NK RLGANA L VS+AV++AAA
Sbjct: 64  VLKAVENINTEISESVLGLDASEQAFLDRTMIDLDGTDNKGRLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y GG     LPVP+MN++NGG HA+N+LD QEFMI+PVGA + REA+R GA
Sbjct: 124 EESGLPLYRYFGGMGGMQLPVPMMNVINGGAHANNSLDLQEFMIIPVGAPSFREAVRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+P++++ ++A+ LI  +I+KAG+ AG+ + + LDC
Sbjct: 184 EVFHALKKILGDRGISTAVGDEGGFAPSVESHEAAIQLILEAIDKAGFVAGEQIALGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y+L GENL L     A  LA  VD+YPI SIEDGM E DW GWK+LT ++
Sbjct: 244 AASEFYKDGNYVLSGENLTLSAGNWADMLATWVDKYPIISIEDGMHEGDWDGWKLLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN + L +GI++ +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKRVQLVGDDLFVTNTKILQEGIDKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           SHRSGETED TIAD+AV TN GQIKTGSL+RSDRIAKYNQL+RIEE LG  A + GR
Sbjct: 364 SHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDIASYPGR 420


>gi|99035086|ref|ZP_01314875.1| hypothetical protein Wendoof_01000292 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 424

 Score =  533 bits (1374), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 263/415 (63%), Positives = 326/415 (78%), Gaps = 3/415 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQ-EKRYFGK 60
            IN++ ARE++DSRG PTIEV++ L DG+ GRA VPSGASTG  EA ELRDQ EKRY GK
Sbjct: 4   IINNVFAREILDSRGYPTIEVEIELCDGAIGRASVPSGASTGKLEALELRDQDEKRYCGK 63

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN  I   ++G +A DQ  IDK +I+LDGT NKS+LGANA LGVSLAV+KAA
Sbjct: 64  GVLKAVQAVNGIIADEIIGMNAADQNAIDKALIELDGTKNKSKLGANATLGVSLAVAKAA 123

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A +  +PLY+YLGG    ++PVPL+NI+NGG+HADN LDFQEFMI+PVGAE   EAIR+ 
Sbjct: 124 ANSFKMPLYRYLGGKQTSVMPVPLINIINGGVHADNKLDFQEFMILPVGAETFSEAIRIS 183

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFH L+  LK KGYSTNVGDEGGF+PN+++ + ALDLI  +IE AGY+A  D  + LD
Sbjct: 184 AEVFHNLRSILKKKGYSTNVGDEGGFAPNIESTEEALDLIIYAIESAGYSAQSDFALGLD 243

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A+S F+  E  I K E+ +L   E+  Y  NLV++YPI SIED MSEDD+ GWK+LT K
Sbjct: 244 VASSTFY--EDGIYKFEHRDLTSEELTEYYCNLVERYPIISIEDAMSEDDYEGWKLLTAK 301

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +GS  QLVGDDLFVTN E + KGI E++ANA+LIKPNQIG+++ET   IE A+  GY ++
Sbjct: 302 LGSKIQLVGDDLFVTNCELICKGIEEKMANAVLIKPNQIGTLTETFAAIEMAKSNGYKAV 361

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           +SHRSGETED TI+ +AVA+NCGQIKTGSL+RSDR+AKYN+LIRIE +LGK AK+
Sbjct: 362 VSHRSGETEDTTISHIAVASNCGQIKTGSLSRSDRLAKYNELIRIESALGKDAKY 416


>gi|187928065|ref|YP_001898552.1| phosphopyruvate hydratase [Ralstonia pickettii 12J]
 gi|238691796|sp|B2U9C3|ENO_RALPJ RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|187724955|gb|ACD26120.1| Phosphopyruvate hydratase [Ralstonia pickettii 12J]
          Length = 427

 Score =  533 bits (1373), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 264/418 (63%), Positives = 327/418 (78%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +D+ +IDLDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDRTLIDLDGTENKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  +PVP+MNI+NGG HA+N+LD QEFM+MPVG  + REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQMPVPMMNIVNGGAHANNSLDIQEFMVMPVGQSSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK L  KG ST VGDEGGF+PN  + +  L+ I ++IE+AGY AG+D+L+ALDC
Sbjct: 184 EIFHALKKILADKGMSTAVGDEGGFAPNFASNEECLNTILSAIEQAGYKAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY L+GE L+L   + A+YLANL D++PI SIEDGM E DW GWK LT+K+
Sbjct: 244 AASEFYKDGKYHLEGEGLQLSSEDFANYLANLADKFPIVSIEDGMHESDWAGWKALTDKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN + L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTKILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV TN GQIKTGSL+RSDR+AKYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRMAKYNQLLRIEEDLGDIASYPGKS 421


>gi|241662672|ref|YP_002981032.1| phosphopyruvate hydratase [Ralstonia pickettii 12D]
 gi|309781228|ref|ZP_07675965.1| phosphopyruvate hydratase [Ralstonia sp. 5_7_47FAA]
 gi|240864699|gb|ACS62360.1| enolase [Ralstonia pickettii 12D]
 gi|308920049|gb|EFP65709.1| phosphopyruvate hydratase [Ralstonia sp. 5_7_47FAA]
          Length = 427

 Score =  533 bits (1372), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 264/418 (63%), Positives = 326/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +D+ +IDLDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDRTLIDLDGTENKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  +PVP+MNI+NGG HA+N+LD QEFM+MPVG  + REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQMPVPMMNIVNGGAHANNSLDIQEFMVMPVGQSSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK L  KG ST VGDEGGF+PN  + +  L+ I ++IE+AGY AG+D+L+ALDC
Sbjct: 184 EIFHALKKILADKGMSTAVGDEGGFAPNFASNEECLNTILSAIEQAGYKAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY L+GE L+L   + A+YLANL D++PI SIEDGM E DW GWK LT K+
Sbjct: 244 AASEFYKDGKYHLEGEGLQLSSEDFANYLANLADKFPIVSIEDGMHESDWAGWKALTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN + L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTKILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV TN GQIKTGSL+RSDR+AKYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRMAKYNQLLRIEEDLGDIASYPGKS 421


>gi|297544976|ref|YP_003677278.1| enolase [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|296842751|gb|ADH61267.1| enolase [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 429

 Score =  533 bits (1372), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 260/419 (62%), Positives = 328/419 (78%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EV+V L+ G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IIDIFAREILDSRGNPTVEVEVELDSGAVGRAAVPSGASTGAFEAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VND I   L+G +A+DQ+ IDK MI+LDGTPNKS+LGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVRNVNDVIAPELIGMEAQDQVAIDKTMIELDGTPNKSKLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+Y+GG +A  LPVP+MNILNGG HADN +D QEFMIMPVGA N REA+RM +
Sbjct: 124 EECGLPLYQYIGGVNAKTLPVPMMNILNGGKHADNNVDIQEFMIMPVGAPNFREALRMCS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LK  L SKG ST VGDEGGF+PNL + + A+ +I  +IEKAGY  G D+++ALD 
Sbjct: 184 EVYHNLKNVLHSKGLSTTVGDEGGFAPNLTSNEEAIQVILEAIEKAGYVPGDDVVLALDP 243

Query: 242 AASAFFKKE-KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           A++  +K++ KY  +GE +     EM  +   LV++YPI SIEDG++E+DW GWK+LT +
Sbjct: 244 ASTELYKEDGKYHFEGEGIVRTSEEMVDFWEQLVNKYPIVSIEDGLAEEDWEGWKLLTER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN +RL KGIN  VAN+ILIK NQIG+++ETL+ IE A+ AGY ++
Sbjct: 304 LGEKIQLVGDDLFVTNTQRLSKGINMGVANSILIKLNQIGTLTETLDAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           +SHRSGETED TIADL V  N GQIKTG+ AR+DR+ KYNQL+RIEE LG  A++ G++
Sbjct: 364 VSHRSGETEDSTIADLVVGVNAGQIKTGAPARTDRVVKYNQLLRIEEVLGSTAQYLGKN 422


>gi|296134196|ref|YP_003641443.1| enolase [Thermincola sp. JR]
 gi|296032774|gb|ADG83542.1| enolase [Thermincola potens JR]
          Length = 428

 Score =  533 bits (1372), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 259/417 (62%), Positives = 327/417 (78%), Gaps = 1/417 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I D++ARE++DSRG+PTIEVDV LEDG+ GRA VPSGASTG HEA ELRD +K RY GK
Sbjct: 3   IIADVLAREILDSRGNPTIEVDVILEDGTLGRAAVPSGASTGAHEAVELRDGDKDRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV  A+  VND I   ++G +A DQ+ ID+++I LDGTPNK +LGANAILGVS+AV+KA+
Sbjct: 63  GVQNAVKNVNDIIAPEIIGFNALDQVGIDQMLIGLDGTPNKGKLGANAILGVSMAVAKAS 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A+   LPLY+YLGG +A  LPVP+MNILNGG HADN +D QEFM+MPVGA++  EA+RM 
Sbjct: 123 AEFLGLPLYQYLGGFNAKELPVPMMNILNGGKHADNNVDIQEFMVMPVGAQSFAEALRMC 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFH LK  LK KG +T VGDEGGF+PNLK+ + AL +I  +I KAGY  G+D+++ALD
Sbjct: 183 AEVFHNLKAVLKGKGLNTAVGDEGGFAPNLKSNEEALAVIIEAINKAGYKPGQDIMLALD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            AA+  +K+ KY+L+GE      +EM  +   LV +YPI SIEDG+SEDDW GW+ LT +
Sbjct: 243 VAATELYKEGKYVLEGEGKTRSSDEMIDFYEELVGKYPIISIEDGLSEDDWEGWQKLTAR 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN ERL KGI+   ANAILIK NQIG+++ET + IE A+ AGY ++
Sbjct: 303 LGKKIQLVGDDLFVTNTERLKKGIDNATANAILIKVNQIGTLTETFDAIEMAKRAGYTAV 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           +SHRSGETED TIAD+AVATN GQIKTG+ +R+DR+AKYNQL+RIEE L + A++ G
Sbjct: 363 VSHRSGETEDTTIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEEELAEIAQYKG 419


>gi|325982466|ref|YP_004294868.1| enolase [Nitrosomonas sp. AL212]
 gi|325531985|gb|ADZ26706.1| enolase [Nitrosomonas sp. AL212]
          Length = 427

 Score =  533 bits (1372), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 261/418 (62%), Positives = 323/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I ++IARE++DSRG+PTIE DV LE G  GRA VPSGAS G  EA ELRD + +RY GKG
Sbjct: 4   IVEVIAREILDSRGNPTIEADVTLESGVLGRASVPSGASVGTKEAMELRDGDAQRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EI  ALLG DA DQ  ID+ +IDLDG+ NKSRLGANAIL VSLAV+KAAA
Sbjct: 64  VLKAVKNVNTEISEALLGLDATDQSFIDQTVIDLDGSENKSRLGANAILAVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG ++  +PVPLMN++NGG HA+N +D QEFMI+P+G  N  +AIR GA
Sbjct: 124 EESGLPLYRYLGGAASMSMPVPLMNLINGGAHANNNIDMQEFMIVPLGISNFHDAIRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVF TLKK + +K   T VGDEGGF+PNL+  ++AL LI  +I++AGY  GKD+ I +DC
Sbjct: 184 EVFGTLKKLINNKNMPTTVGDEGGFAPNLENNEAALQLIVEAIDQAGYQPGKDIAIGVDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S FF  +KY L  +NL+L   +   YL + VD+YPI SIEDGMSE DW GWK+LT K+
Sbjct: 244 ASSEFFHDDKYHLSSDNLQLTSAQFVDYLLSWVDKYPIISIEDGMSEHDWDGWKLLTQKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G + QLVGDD+FVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GDSIQLVGDDIFVTNARILQEGIKQGIANSILIKVNQIGTLTETFAAIEMAKCAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AVA N  QIKTGSL+RSDR+AKYNQL+RIEE+LG   K+AGRS
Sbjct: 364 SHRSGETEDTTIADIAVAANALQIKTGSLSRSDRLAKYNQLLRIEENLGDTVKYAGRS 421


>gi|121593416|ref|YP_985312.1| phosphopyruvate hydratase [Acidovorax sp. JS42]
 gi|134034101|sp|A1W4R1|ENO_ACISJ RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|120605496|gb|ABM41236.1| enolase [Acidovorax sp. JS42]
          Length = 428

 Score =  532 bits (1371), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 325/419 (77%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIVGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A+LG DA +Q  +DK +IDLDGT NKSRLGANA+L VS+AV++AAA
Sbjct: 64  VLKAVEHINTEISEAVLGLDASEQGFLDKTLIDLDGTDNKSRLGANAMLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG  +  LPVP+MN++NGG HA+N+LD QEFMI+PVGA + REA+R GA
Sbjct: 124 EESGLPLYRYLGGMGSVQLPVPMMNVINGGAHANNSLDLQEFMIIPVGAPSFREAVRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK +  KG ST VGDEGGF+P+++  ++A+ LI  +IE AGY AG+ + + LDC
Sbjct: 184 EVFHALKKIIHDKGMSTAVGDEGGFAPSVENHEAAIQLILQAIEAAGYTAGEQIALGLDC 243

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AAS F+K   Y+L+GE  L+L   +    LA+  D+YPI SIEDGM E DW GWKILT +
Sbjct: 244 AASEFYKDGMYVLEGEGGLQLTAQQWTDMLASWCDKYPIISIEDGMHEGDWDGWKILTER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G N QLVGDDLFVTN + L +GI++ +AN+ILIK NQIG+++ET   IE A+ AGY ++
Sbjct: 304 LGHNVQLVGDDLFVTNTKILKEGIDKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ISHRSGETED TIAD+AV TN GQIKTGSL+RSDRIAKYNQL+RIEE LG  A + GR+
Sbjct: 364 ISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDIAFYPGRA 422


>gi|261404076|ref|YP_003240317.1| enolase [Paenibacillus sp. Y412MC10]
 gi|329928000|ref|ZP_08282004.1| phosphopyruvate hydratase [Paenibacillus sp. HGF5]
 gi|261280539|gb|ACX62510.1| enolase [Paenibacillus sp. Y412MC10]
 gi|328938104|gb|EGG34501.1| phosphopyruvate hydratase [Paenibacillus sp. HGF5]
          Length = 429

 Score =  532 bits (1371), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 261/417 (62%), Positives = 330/417 (79%), Gaps = 1/417 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I+D+ AREV+DSRG+PT+EV+V LE G+ GRA+VPSGASTG+HEA ELRD +K RY GK
Sbjct: 3   IISDVYAREVLDSRGNPTVEVEVYLESGAIGRAIVPSGASTGVHEAVELRDDDKSRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN+ I   ++G DA DQL IDK+MI LDGTPNK +LGANAIL VS+AV++AA
Sbjct: 63  GVLKAVENVNEIIAPEVIGMDALDQLGIDKLMIALDGTPNKGKLGANAILAVSMAVARAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A   +LPLY YLGG +A  LPVP+MNI+NGG HADN +D QEFM++PVGA + +EA+RMG
Sbjct: 123 ADALDLPLYVYLGGFNAKQLPVPMMNIVNGGAHADNNVDVQEFMVLPVGAPSFKEALRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE+FH LK  LK KG +T VGDEGGF+PN  + + AL  I  +IEKAGY  G+D+L+ +D
Sbjct: 183 AEIFHNLKSVLKGKGLNTAVGDEGGFAPNFTSNEDALSSIIEAIEKAGYKPGEDVLLGMD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A++ FFK  KY+L+GE     P E    LA+ VD+YPI +IEDG SEDDW GWK+LT K
Sbjct: 243 VASTEFFKDGKYVLEGEGKSFTPAEFVDLLASWVDKYPIVTIEDGCSEDDWEGWKLLTEK 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G+  QLVGDDLFVTN ERL KGINE + N+ILIK NQIG+++ET + IE A+ AGY ++
Sbjct: 303 LGNKIQLVGDDLFVTNTERLEKGINEGIGNSILIKVNQIGTLTETFDAIEMAKRAGYTAV 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ISHRSGE+ED TIAD+AVATN GQIKTG+ +R+DR+AKYNQL+RIE+ LG+ A++ G
Sbjct: 363 ISHRSGESEDSTIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDQLGELAQYNG 419


>gi|255065886|ref|ZP_05317741.1| phosphopyruvate hydratase [Neisseria sicca ATCC 29256]
 gi|255049797|gb|EET45261.1| phosphopyruvate hydratase [Neisseria sicca ATCC 29256]
          Length = 428

 Score =  532 bits (1371), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 321/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  IDKIMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVEHVNNQIAQALIGIDANEQSYIDKIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDSGLPLYRYLGGAGPMALPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK    KG+ T VGDEGGF+PNL +   AL L+  + E AGY AG D+L ALDC
Sbjct: 184 EIFHALKKLCDGKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYKAGDDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YL  LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGRSYTSAEFAEYLEGLVNEFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+ + Y S++
Sbjct: 304 GSKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLQAVDLAKRSRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAAYYPGKA 421


>gi|329119629|ref|ZP_08248310.1| enolase [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464226|gb|EGF10530.1| enolase [Neisseria bacilliformis ATCC BAA-1200]
          Length = 428

 Score =  532 bits (1371), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 267/418 (63%), Positives = 323/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IIDILAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDAARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+A VN+EI  AL+G DA +Q  IDKIMI+LDGT NK RLGANA L VS+AV++AAA
Sbjct: 64  VLKAVAHVNNEIAQALIGIDASEQSYIDKIMIELDGTENKGRLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG     +PVP+MN++NGG HA+N+LD QEFMIMPVGA   REA+R GA
Sbjct: 124 EDAGLPLYRYLGGAGPMAMPVPMMNVINGGAHANNSLDIQEFMIMPVGAPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK    KGY T VGDEGGF+PNL T + AL L+  ++E AGY  G+D+L ALDC
Sbjct: 184 EVFHALKKLCDRKGYPTTVGDEGGFAPNLSTHEEALQLMQEAVEAAGYKTGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L  E L L   E A YLA L D+YPI SIEDGM E+D  GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLSAEKLALTGAEFADYLARLADKYPIVSIEDGMDENDREGWKLLTAKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + +ANA+L+K NQIG++SETL  +E A+ + Y SI+
Sbjct: 304 GGRVQLVGDDLFVTNPKILAEGIKDGIANALLVKVNQIGTLSETLKAVELAKRSRYTSIM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE LG+ A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELGEAAWYPGKA 421


>gi|163849331|ref|YP_001637375.1| phosphopyruvate hydratase [Chloroflexus aurantiacus J-10-fl]
 gi|189037205|sp|A9WCM4|ENO_CHLAA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|163670620|gb|ABY36986.1| Phosphopyruvate hydratase [Chloroflexus aurantiacus J-10-fl]
          Length = 426

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 262/419 (62%), Positives = 325/419 (77%), Gaps = 1/419 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I  I+AREV+DSRG+PTIEVDV LE G  GRA+VPSGASTG HEA ELRD +K RY GK
Sbjct: 4   LIEAIVAREVLDSRGNPTIEVDVRLESGDVGRAIVPSGASTGAHEALELRDGDKSRYNGK 63

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN++I  AL+G DA DQ+ +D+ +I LDGTPNKS+LGANAILGVSLA +KAA
Sbjct: 64  GVLKAVQAVNEDIAEALIGFDAADQIALDQELIALDGTPNKSKLGANAILGVSLAAAKAA 123

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    LPLY+YLGG  AH+LPVP+MNI+NGG HA N+ DFQEFMIMPVGAE+ RE +R G
Sbjct: 124 AAAFGLPLYRYLGGVYAHVLPVPMMNIMNGGQHATNSTDFQEFMIMPVGAESFREGLRWG 183

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE++H LKK +  +G+ST VGDEGGF+P+L T D+ L LI  +IEKAGY  G+ ++IALD
Sbjct: 184 AEIYHMLKKVIHDRGFSTTVGDEGGFAPSLPTNDAPLQLIMEAIEKAGYRPGEQIVIALD 243

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A +  F+  KY LK E   L   EM  Y  +LV++YPI S+EDG++EDDW GW +L  K
Sbjct: 244 PATTEIFEDGKYHLKREGRSLSSAEMVDYWVDLVNRYPIISLEDGLAEDDWEGWALLRAK 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDD  VTN +RL + I  + AN+ILIK NQIGS++ETL+ I+ AQ +G+ ++
Sbjct: 304 LGDRVQLVGDDFLVTNVQRLQRAIEAKAANSILIKLNQIGSLTETLSAIQLAQRSGWTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           +SHRSGE+ED TIADL VATN GQIKTG+ AR+DRIAKYNQL+RIEE LG  A++AGRS
Sbjct: 364 VSHRSGESEDVTIADLVVATNAGQIKTGAPARTDRIAKYNQLLRIEEELGSAARYAGRS 422


>gi|298368390|ref|ZP_06979708.1| phosphopyruvate hydratase [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282393|gb|EFI23880.1| phosphopyruvate hydratase [Neisseria sp. oral taxon 014 str. F0314]
          Length = 428

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 321/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+EI  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VSLAV++AAA
Sbjct: 64  VLKAVEHVNNEISQALIGIDANEQSYIDRIMIELDGTDNKGNLGANATLAVSLAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y+GG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDSGLPLYRYIGGAGPMALPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK    KG+ T VGDEGGF+PNL T + AL L+  ++  AGY  G+D+L A+DC
Sbjct: 184 EVFHALKKLCNDKGFPTTVGDEGGFAPNLNTHEEALQLMQEAVVAAGYKPGEDVLFAMDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YLA+LV +YPI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGKAYSSEEFADYLADLVSKYPIISIEDGMDENDWAGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GGKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLQAVDLAKRNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAAYYPGKA 421


>gi|295696723|ref|YP_003589961.1| enolase [Bacillus tusciae DSM 2912]
 gi|295412325|gb|ADG06817.1| enolase [Bacillus tusciae DSM 2912]
          Length = 428

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 251/416 (60%), Positives = 321/416 (77%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I +I AREV+DSRG+PT+EV+V LE G+TGRA+VPSGASTG HEA ELRD  +RY GKGV
Sbjct: 5   IYEITAREVLDSRGNPTVEVEVELEGGATGRAIVPSGASTGAHEAVELRDGGERYGGKGV 64

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN+ I   L+G DA DQ+ ID++MIDLDGTPNK RLGANAILGVS+AV+ AA+Q
Sbjct: 65  RKAVEHVNETIGPELIGQDALDQVGIDRLMIDLDGTPNKGRLGANAILGVSMAVAHAASQ 124

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
              LPLY YLGG +A  LPVP+MNILNGG HADN +D QEFMI+PVGA   REA+RMGAE
Sbjct: 125 AVGLPLYVYLGGFAARTLPVPMMNILNGGKHADNNVDIQEFMILPVGASTFREALRMGAE 184

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFH LKK L  KG +T VGDEGGF+P+L + + AL +I  ++EKAGY  G+D+++A+D A
Sbjct: 185 VFHALKKVLSEKGLATAVGDEGGFAPSLGSNEEALQVIVRAVEKAGYRPGEDVMLAVDVA 244

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           +S  +K  +Y+  GE +     EM ++   L+ +YPI S+EDG++EDDW GW+ LT ++G
Sbjct: 245 SSELYKDGRYVFAGEGVTRTAEEMIAFYERLIAKYPIVSVEDGLAEDDWEGWEALTARLG 304

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTN  RL  GI+  VAN+IL+K NQIG+++ET   IE A+ +GY ++IS
Sbjct: 305 KKVQLVGDDLFVTNTSRLRTGIDRGVANSILVKVNQIGTLTETFEAIEMAKRSGYTAVIS 364

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           HRSGETED TIAD+AVA   GQIKTG+ +R+DR+AKYNQL+RIE++L    ++AGR
Sbjct: 365 HRSGETEDVTIADIAVAAQTGQIKTGAPSRTDRVAKYNQLLRIEDALTYTGRYAGR 420


>gi|163793244|ref|ZP_02187220.1| Phosphopyruvate hydratase [alpha proteobacterium BAL199]
 gi|159181890|gb|EDP66402.1| Phosphopyruvate hydratase [alpha proteobacterium BAL199]
          Length = 428

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 258/420 (61%), Positives = 326/420 (77%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DI ARE++DSRG+PT+EVDV LE G+ GRA VPSGASTG +EA E RD + KRY GKG
Sbjct: 4   IIDITAREILDSRGNPTVEVDVTLETGALGRAGVPSGASTGAYEAVEKRDGDAKRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V +A+  VN EI  AL G +A +QLLID+ +I+LDGT NKSRLGANA+LGVS+AV+KA A
Sbjct: 64  VQQAVDAVNGEIFDALSGREAAEQLLIDRALIELDGTENKSRLGANALLGVSMAVAKAQA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPL++Y+GG  AH+LP P+MNI+NGG HADN +DFQEFMIMPV     REA+R G+
Sbjct: 124 DEMGLPLWRYVGGAYAHVLPTPMMNIINGGAHADNPIDFQEFMIMPVAFPTFREALRAGS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH L+K L + G++TNVGDEGGF+P++K+AD AL  +  +IE AGY  G+D++IALD 
Sbjct: 184 EIFHALRKHLSAAGHNTNVGDEGGFAPDMKSADEALAAVMKAIEAAGYRPGEDVMIALDP 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY+L+GE   L    M    A+L  +YPI SIED +SEDDW G+K LT ++
Sbjct: 244 ASTEFFKDGKYVLEGEGKTLDAAGMIKLYADLAARYPIVSIEDALSEDDWDGFKALTAEL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  Q+VGDDLFVTN +RL +GI E+  NAIL+K NQIG++SETL T+  AQ A + +++
Sbjct: 304 GSKVQIVGDDLFVTNSKRLKRGIAEKSGNAILVKVNQIGTLSETLETVSMAQRARFGTVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATN GQIKTGSL+RSDR AKYNQL+RIEE+LG   ++AGR+ L
Sbjct: 364 SHRSGETEDATIADLAVATNAGQIKTGSLSRSDRTAKYNQLLRIEEALGAAGRYAGRASL 423


>gi|289578739|ref|YP_003477366.1| enolase [Thermoanaerobacter italicus Ab9]
 gi|289528452|gb|ADD02804.1| enolase [Thermoanaerobacter italicus Ab9]
          Length = 429

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 260/419 (62%), Positives = 328/419 (78%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EV+V L+ G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IIDIFAREILDSRGNPTVEVEVELDSGAVGRAAVPSGASTGAFEAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VND I   L+G +A+DQ+ IDK MI+LDGTPNKS+LGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVRNVNDIIAPELIGMEAQDQVAIDKAMIELDGTPNKSKLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+Y+GG +A  LPVP+MNILNGG HADN +D QEFMIMPVGA N REA+RM +
Sbjct: 124 EECGLPLYQYIGGVNAKTLPVPMMNILNGGKHADNNVDIQEFMIMPVGAPNFREALRMCS 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LK  L SKG ST VGDEGGF+PNL + + A+ +I  +IEKAGY  G D+++ALD 
Sbjct: 184 EVYHNLKNVLHSKGLSTTVGDEGGFAPNLTSNEEAIQVILEAIEKAGYVPGDDVVLALDP 243

Query: 242 AASAFFKKE-KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           A++  +K++ KY  +GE +     EM  +   LV++YPI SIEDG++E+DW GWK+LT +
Sbjct: 244 ASTELYKEDGKYHFEGEGIVRTSEEMVDFWEQLVNKYPIVSIEDGLAEEDWEGWKLLTER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN +RL KGIN  VAN+ILIK NQIG+++ETL+ IE A+ AGY ++
Sbjct: 304 LGEKIQLVGDDLFVTNTQRLSKGINMGVANSILIKLNQIGTLTETLDAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           +SHRSGETED TIADL V  N GQIKTG+ AR+DR+ KYNQL+RIEE LG  A++ G++
Sbjct: 364 VSHRSGETEDSTIADLVVGVNAGQIKTGAPARTDRVVKYNQLLRIEEVLGSTAQYLGKN 422


>gi|253998571|ref|YP_003050634.1| phosphopyruvate hydratase [Methylovorus sp. SIP3-4]
 gi|313200644|ref|YP_004039302.1| enolase [Methylovorus sp. MP688]
 gi|253985250|gb|ACT50107.1| enolase [Methylovorus sp. SIP3-4]
 gi|312439960|gb|ADQ84066.1| enolase [Methylovorus sp. MP688]
          Length = 428

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 259/422 (61%), Positives = 319/422 (75%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DIIARE+IDSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IVDIIAREIIDSRGNPTVEADVLLESGIIGRAAVPSGASTGTKEAVELRDGDTGRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VN EI  A++G D  +Q  ID  +IDLDGT NKSRLGANAIL VS+A ++AAA
Sbjct: 64  VLQAVENVNTEIAEAIVGLDVEEQSFIDTTLIDLDGTENKSRLGANAILAVSMACARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LP P+MNI+NGG HA+N++D QEFMI+P G  + REA+R GA
Sbjct: 124 EESGLPLYRYLGGSGFMQLPTPMMNIINGGAHAENSVDMQEFMIIPAGLPSFREALRAGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  KG +T VGDEGGF+P+L + +SA+ LI  +I  AGY  G+D+L+ LDC
Sbjct: 184 EVFHALKKTLHKKGLATTVGDEGGFAPDLPSNESAIQLILEAISAAGYEPGRDILLGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K   Y L+ E L+L   + + YLA  VD+YPI SIEDGMSE DW GWK+LT+++
Sbjct: 244 ASSEFYKNGMYHLESEGLQLTSAQFSDYLATWVDKYPIISIEDGMSEHDWDGWKLLTDRM 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G N QLVGDDLFVTN + L +GI + VAN++LIK NQIG+++ET  TIE A+ AGY S+I
Sbjct: 304 GKNVQLVGDDLFVTNAKILREGIQKGVANSVLIKVNQIGTLTETFQTIETAKRAGYTSVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIAD++VATN  QIKTGSL+RS+RIAKYNQL+RIEE LG    +AG    
Sbjct: 364 SHRSGETEDTTIADISVATNALQIKTGSLSRSERIAKYNQLLRIEEELGDATSYAGIDAF 423

Query: 422 IH 423
            H
Sbjct: 424 YH 425


>gi|83858354|ref|ZP_00951876.1| hypothetical protein OA2633_02606 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853177|gb|EAP91029.1| hypothetical protein OA2633_02606 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 425

 Score =  531 bits (1369), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 262/419 (62%), Positives = 320/419 (76%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA E RD   RY GKGV
Sbjct: 4   IVDIAAREILDSRGNPTVEVDVFLEDGSMGRAAVPSGASTGAHEAVEKRDGGDRYKGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
           L+A+  V  EI  A+ G DAR+Q  ID+I+I LDGT NK+RLGANA+LGVSLA +KAAA 
Sbjct: 64  LEAVTAVETEIFEAIAGIDAREQRTIDEILIGLDGTENKARLGANALLGVSLATAKAAAL 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S LPLY+Y+GG +A +LP P+MNILNGG HADN +DFQEFMIMP G     EA+R GAE
Sbjct: 124 ASGLPLYRYVGGANARVLPAPMMNILNGGAHADNPVDFQEFMIMPTGLATFSEALRCGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           +FH LK +LK+ G +TNVGDEGGF+P+LK+A++ LD I  +IE AGY  G D+ +ALD A
Sbjct: 184 IFHALKSQLKADGLNTNVGDEGGFAPDLKSAEACLDAIMKAIETAGYEPGSDVTLALDVA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ FFK  KY+++G       +E A YL  L   YPI SIEDGM+EDDW GWK +T+ + 
Sbjct: 244 STEFFKDGKYVMEGAGRTCTSDEFAEYLKELATNYPIISIEDGMAEDDWEGWKAVTSMLD 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
            + QLVGDDLFVTNPERL  GI    ANA+L+K NQIG++SET++ +E A  +GY +++S
Sbjct: 304 GDVQLVGDDLFVTNPERLAHGIEVGAANALLVKVNQIGTLSETMDAVEMALRSGYGAVMS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           HRSGETED TIADLAVA NCGQIKTGSLARSDR AKYNQL+RIE  LG  A +AGR+ +
Sbjct: 364 HRSGETEDTTIADLAVALNCGQIKTGSLARSDRTAKYNQLLRIEAELGDAAIYAGRTAI 422


>gi|328956754|ref|YP_004374140.1| phosphopyruvate hydratase [Carnobacterium sp. 17-4]
 gi|328673078|gb|AEB29124.1| phosphopyruvate hydratase [Carnobacterium sp. 17-4]
          Length = 432

 Score =  531 bits (1369), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 261/421 (61%), Positives = 328/421 (77%), Gaps = 6/421 (1%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
           FI DI+AREV+DSRG+PTIEV+V  E G+ GR MVPSGASTG HEA ELRD +K RY GK
Sbjct: 3   FITDILAREVLDSRGNPTIEVEVYTESGAFGRGMVPSGASTGEHEAIELRDGDKARYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN+ I  AL+G D RDQ+ IDK MI+LDGTPNKS+LGANAILGVS+AV++AA
Sbjct: 63  GVLKAVENVNNVISEALIGFDVRDQMAIDKTMIELDGTPNKSKLGANAILGVSIAVARAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A   ++PLY+YLGG +  +LP P+MNI+NGG HADN++DFQEFMIMPVGA + +EA+RMG
Sbjct: 123 ADYLDVPLYQYLGGFNTKVLPTPMMNIINGGSHADNSIDFQEFMIMPVGAPSFKEALRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFH L   LKS+G +T+VGDEGGF+PNL + +   ++I  +IEKAGY  G+D+++A+D
Sbjct: 183 AEVFHALAGILKSRGLATSVGDEGGFAPNLSSNEEGFEVIIEAIEKAGYKPGEDVMLAMD 242

Query: 241 CAASAFFKKEKYIL----KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKI 296
            A+S F+  EK +      GE  E    EM     NLV++YPI SIEDG+ E+DW G K 
Sbjct: 243 AASSEFYNSEKGVYDLADSGEG-EKTAEEMIEIYKNLVEKYPIISIEDGLDENDWEGTKK 301

Query: 297 LTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAG 356
           LT  +G   Q+VGDDLFVTN E+L K I++ VAN+ILIK NQIG+++ET + IE A+ AG
Sbjct: 302 LTEVLGDKVQIVGDDLFVTNTEKLAKAIDKGVANSILIKVNQIGTLTETFDAIEMAKKAG 361

Query: 357 YPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFA 416
           Y ++ISHRSGETED TIAD+AVATN GQIKTGSL+R+DRIAKYNQL+RIE+ LG  A + 
Sbjct: 362 YTAVISHRSGETEDSTIADIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGDLAVYE 421

Query: 417 G 417
           G
Sbjct: 422 G 422


>gi|89901426|ref|YP_523897.1| phosphopyruvate hydratase [Rhodoferax ferrireducens T118]
 gi|119369379|sp|Q21V37|ENO_RHOFD RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|89346163|gb|ABD70366.1| enolase [Rhodoferax ferrireducens T118]
          Length = 427

 Score =  531 bits (1369), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 256/418 (61%), Positives = 323/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIVGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGDKTRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A+LG DA +Q  +DK +IDLDGT NKSRLGANA+L VS+AV++AAA
Sbjct: 64  VLKAVEHINTEISEAVLGLDASEQAFLDKTLIDLDGTDNKSRLGANAMLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y GG  A  +PVP+MN++NGG HA+N+LD QEFMI+P+GA + REA+R GA
Sbjct: 124 EESGLPLYRYFGGMGAVQMPVPMMNVVNGGAHANNSLDIQEFMIIPLGAPSFREALRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK +  KG ST VGDEGGF+P++ + + A+ LI  +I+ AGY AG+ + I LDC
Sbjct: 184 EVFHALKKIIHDKGMSTAVGDEGGFTPSVASHEEAIQLILQAIDSAGYTAGEQIAIGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY L  E L L   E    LA  VD+YPI SIEDGM+E+DW GWKILT+++
Sbjct: 244 AASEFYKDGKYQLGAEGLSLNAQEWTDMLATWVDKYPIISIEDGMAENDWDGWKILTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   Q+VGDDLFVTN +   +GI++ +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GQQVQIVGDDLFVTNTKIFKEGIDKGIANSILIKINQIGTLTETFACIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV TN GQIKTGSL+RSDR+AKYNQL+RIEE LG+ A + GR+
Sbjct: 364 SHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRMAKYNQLLRIEEDLGEIAFYPGRA 421


>gi|150015491|ref|YP_001307745.1| phosphopyruvate hydratase [Clostridium beijerinckii NCIMB 8052]
 gi|189037207|sp|A6LR09|ENO_CLOB8 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|149901956|gb|ABR32789.1| Phosphopyruvate hydratase [Clostridium beijerinckii NCIMB 8052]
          Length = 430

 Score =  531 bits (1368), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 254/422 (60%), Positives = 329/422 (77%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D++AR+++DSR  PT+EV++ LEDG+ GRA VPSGASTG++EA ELRD +K ++ GKG
Sbjct: 7   IVDVVARQILDSRCFPTVEVEIYLEDGTIGRAAVPSGASTGMYEAVELRDGDKDKFLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL AI  VN+ I   L+GC+  +Q  IDK++I+LDGT NKS+LGANAILGVSLAV+ AAA
Sbjct: 67  VLNAIRNVNEIIAEELIGCNVFEQTYIDKMLIELDGTNNKSKLGANAILGVSLAVANAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + ++PLY+Y+GG ++ +LPVP+MNILNGG HADN++D QEFMIMP GA    EA+RM A
Sbjct: 127 NSLDMPLYRYIGGVNSKVLPVPMMNILNGGSHADNSVDLQEFMIMPAGAPTFSEALRMCA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK L  KGYST +GDEGGF+PNLK+   ALD+I  +I KAGY AG+++ IA+D 
Sbjct: 187 EVYHTLKKILNDKGYSTGIGDEGGFAPNLKSNQEALDVIIEAIGKAGYKAGEEIFIAIDA 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S ++K  KY+L+ E   L   EM  +  + V++YPI SIEDGM+E+DW GWK++T ++
Sbjct: 247 ASSEYYKDGKYVLEHEGRTLTSAEMVDFFEDWVNKYPIISIEDGMAEEDWEGWKLITERL 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN ERL KGI+  VAN+ILIK NQIG+++ETLN IE A  AGY +++
Sbjct: 307 GKKVQLVGDDLFVTNTERLEKGIDLGVANSILIKLNQIGTLTETLNAIEMANRAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQL+RIEE L   A++ GR   
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLLRIEEELNDVAEYRGRKAF 426

Query: 422 IH 423
            +
Sbjct: 427 FN 428


>gi|163789788|ref|ZP_02184225.1| enolase [Carnobacterium sp. AT7]
 gi|159875010|gb|EDP69077.1| enolase [Carnobacterium sp. AT7]
          Length = 432

 Score =  531 bits (1368), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 261/422 (61%), Positives = 328/422 (77%), Gaps = 6/422 (1%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
           FI DI+AREV+DSRG+PTIEV+V  E G+ GR MVPSGASTG HEA ELRD +K RY GK
Sbjct: 3   FITDILAREVLDSRGNPTIEVEVYTESGAFGRGMVPSGASTGEHEAIELRDGDKSRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN+ I  AL+G D RDQ+ IDK MI+LDGTPNKS+LGANAILGVS+AV++AA
Sbjct: 63  GVLKAVENVNNVISEALIGFDVRDQMAIDKTMIELDGTPNKSKLGANAILGVSIAVARAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A   ++PLY+YLGG +  +LP P+MNI+NGG HADN++DFQEFMIMPVGA + +EA+RMG
Sbjct: 123 ADYLDVPLYQYLGGFNTKVLPTPMMNIINGGSHADNSIDFQEFMIMPVGAPSFKEALRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFH L   LK+KG +T+VGDEGGF+PNL + +   ++I  +IEKAGY  G+D+++A+D
Sbjct: 183 AEVFHALAGILKAKGLATSVGDEGGFAPNLSSNEEGFEVIIEAIEKAGYKPGEDVMLAMD 242

Query: 241 CAASAFFKKEKYIL----KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKI 296
            A+S F+  EK +      GE  E   +EM     NLV++YPI SIEDG+ E+DW G K 
Sbjct: 243 AASSEFYNSEKGVYDLADSGEG-EKTADEMIEIYKNLVEKYPIISIEDGLDENDWEGTKK 301

Query: 297 LTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAG 356
           LT  +G   Q+VGDDLFVTN E+L K I   VAN+ILIK NQIGS++ET + IE A+ AG
Sbjct: 302 LTEVLGDKVQIVGDDLFVTNTEKLSKAIEMGVANSILIKVNQIGSLTETFDAIEMAKKAG 361

Query: 357 YPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFA 416
           Y ++ISHRSGETED TIAD++VATN GQIKTGSL+R+DRIAKYNQL+RIE+ LG  A + 
Sbjct: 362 YTAVISHRSGETEDSTIADISVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGDLAVYE 421

Query: 417 GR 418
           G+
Sbjct: 422 GK 423


>gi|42520362|ref|NP_966277.1| enolase [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|59797595|sp|Q73HQ2|ENO_WOLPM RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|42410100|gb|AAS14211.1| enolase [Wolbachia endosymbiont of Drosophila melanogaster]
          Length = 424

 Score =  531 bits (1368), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 262/414 (63%), Positives = 324/414 (78%), Gaps = 3/414 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQ-EKRYFGKG 61
           IN++ ARE++DSRG PTIEV++ L DG+ GRA VPSGASTG  E  ELRDQ EKRY GKG
Sbjct: 5   INNVFAREILDSRGYPTIEVEIELCDGAIGRASVPSGASTGKLEVLELRDQDEKRYCGKG 64

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN  I   ++G +A DQ  IDK +I+LDGT NKS+LGANA LGVSLAV+KAAA
Sbjct: 65  VLKAVQAVNGIIADEIIGMNAADQNAIDKALIELDGTKNKSKLGANATLGVSLAVAKAAA 124

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +  +PLY+YLGG    ++PVPL+NI+NGG+HADN LDFQEFMI+PVGAE   EAIR+ A
Sbjct: 125 NSFKMPLYRYLGGKQTSVMPVPLINIINGGVHADNKLDFQEFMILPVGAETFSEAIRISA 184

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH L+  LK KGYSTNVGDEGGF+PN+++ + ALDLI   IE AGY+A  D  + LD 
Sbjct: 185 EVFHNLRSILKKKGYSTNVGDEGGFAPNIESTEEALDLIIYVIESAGYSAQSDFALGLDV 244

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+  E  I K E+ +L   E+  Y  NLV++YPI SIED MSEDD+ GWK+LT K+
Sbjct: 245 ASSTFY--EDGIYKFEHRDLTSEELTEYYCNLVERYPIISIEDAMSEDDYEGWKLLTAKL 302

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  QLVGDDLFVTN E + KGI E++ANA+LIKPNQIG+++ET   IE A+  GY +++
Sbjct: 303 GSKIQLVGDDLFVTNCELICKGIEEKMANAVLIKPNQIGTLTETFAAIEMAKSNGYKAVV 362

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           SHRSGETED TI+ +AVA+NCGQIKTGSL+RSDR+AKYN+LIRIE +LGK AK+
Sbjct: 363 SHRSGETEDTTISHIAVASNCGQIKTGSLSRSDRLAKYNELIRIESALGKDAKY 416


>gi|167628773|ref|YP_001679272.1| enolase [Heliobacterium modesticaldum Ice1]
 gi|167591513|gb|ABZ83261.1| enolase [Heliobacterium modesticaldum Ice1]
          Length = 429

 Score =  531 bits (1367), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 261/422 (61%), Positives = 321/422 (76%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I +I ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   IAEIYAREILDSRGNPTVEVDVVLEDGTRGRAAVPSGASTGAYEAVELRDGDKERYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V  A+  VN EI   L+G D   Q+ ID+ MI+LDGTPNK RLGANAILGVS+A +KAAA
Sbjct: 64  VQNAVDNVNLEIAPELIGWDVTRQMEIDRRMIELDGTPNKGRLGANAILGVSMACAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           Q   LPLY+YLGG  A  LPVP+MNILNGG HADN +D QEFM+MPVGA +  E +RMG 
Sbjct: 124 QFVGLPLYQYLGGVFARELPVPMMNILNGGKHADNNVDIQEFMVMPVGATSFSEGLRMGV 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK LK KG +T VGDEGGF+PNL + + AL +I  +++ AGYN G D+L+A+D 
Sbjct: 184 EVFHALKKVLKGKGMNTAVGDEGGFAPNLSSNEEALQVIIEAVKAAGYNPGTDILLAVDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS  +K  KY L+GE       EM  Y  +LV++YPI SIEDG++EDDW GWK+LT+++
Sbjct: 244 AASEMYKDGKYHLEGEGKVKSSAEMVDYWEDLVNRYPIISIEDGLNEDDWDGWKLLTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN E+L KG+   V N+ILIK NQIG+++ETL  IE A+ AGY S+I
Sbjct: 304 GKRVQLVGDDLFVTNTEKLEKGMEMGVGNSILIKVNQIGTITETLAAIEMARRAGYTSVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVA N GQIKTG+ +R+DR+AKYNQL+RIEE L +QA + G+   
Sbjct: 364 SHRSGETEDATIADLAVAVNAGQIKTGAPSRTDRVAKYNQLLRIEEELDEQALYRGKKTF 423

Query: 422 IH 423
            +
Sbjct: 424 FN 425


>gi|261381117|ref|ZP_05985690.1| phosphopyruvate hydratase [Neisseria subflava NJ9703]
 gi|284795918|gb|EFC51265.1| phosphopyruvate hydratase [Neisseria subflava NJ9703]
          Length = 428

 Score =  531 bits (1367), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 321/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVDHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDSGLPLYRYLGGAGPMALPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   +KG+ T VGDEGGF+PNL +   AL LI  + E AGY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDAKGFPTTVGDEGGFAPNLNSHKEALQLIVEATEAAGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YL  LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGRSYTSAEFAEYLEGLVNEFPIVSIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GGKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAAYYPGKA 421


>gi|320449109|ref|YP_004201205.1| phosphopyruvate hydratase [Thermus scotoductus SA-01]
 gi|320149278|gb|ADW20656.1| phosphopyruvate hydratase [Thermus scotoductus SA-01]
          Length = 422

 Score =  530 bits (1366), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 256/415 (61%), Positives = 326/415 (78%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I ++ AREV+DSRG PT+E +V LE G+ GRAMVPSGASTG HEA ELRD  +RY GKGV
Sbjct: 4   IVNVKAREVLDSRGFPTVEAEVELEGGARGRAMVPSGASTGTHEALELRDGGRRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            +A+A + + I   L+G DA DQ  +D+ M++LDGTPNK+ LGANAIL VSLA ++AAA+
Sbjct: 64  RRAVAHILERIAPELIGLDALDQEGVDRAMLELDGTPNKANLGANAILAVSLATARAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
              LPLY+YLGG  A  LPVPLMN++NGG HADN +DFQEFM++P G E+  EA+R+GAE
Sbjct: 124 ALGLPLYRYLGGVQAVTLPVPLMNVINGGKHADNRVDFQEFMLVPAGVESFSEALRVGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLK  LK KGYSTNVGDEGGF+P+L++ + A++L+  +IE+AGY  G+++ +ALD A
Sbjct: 184 VFHTLKGVLKEKGYSTNVGDEGGFAPDLRSNEEAIELLLLAIERAGYTPGQEVSLALDPA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           AS  +++ KY L+GE   L   EM  + A  VD+YPI SIEDG++EDDW GW++LT ++G
Sbjct: 244 ASELYQEGKYHLEGEGRVLSSEEMVEFWATWVDKYPIRSIEDGLAEDDWEGWRLLTERLG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTNP+RL +GI + VANAIL+K NQIG++SETL  I  AQ +GY ++IS
Sbjct: 304 GRVQLVGDDLFVTNPDRLRQGIQQGVANAILVKVNQIGTLSETLEAIRLAQRSGYRAVIS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           HRSGETED  IADLAVA N GQIKTGSL+RSDR++KYNQL+RIEE LG+ A+F G
Sbjct: 364 HRSGETEDSFIADLAVAVNAGQIKTGSLSRSDRLSKYNQLLRIEEELGRAARFLG 418


>gi|255038119|ref|YP_003088740.1| enolase [Dyadobacter fermentans DSM 18053]
 gi|254950875|gb|ACT95575.1| enolase [Dyadobacter fermentans DSM 18053]
          Length = 423

 Score =  530 bits (1366), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 263/417 (63%), Positives = 326/417 (78%), Gaps = 2/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKR-YFGKG 61
           I  + AR+++DSRG+PTIEVD+  E+G  GRA VPSGASTG HEA ELRD +K  Y GKG
Sbjct: 4   IQSVHARQILDSRGNPTIEVDIRTENGYLGRAAVPSGASTGKHEAVELRDDDKSVYVGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VND I   L+GC   +Q LIDKIM++LDGTPNK++LGANAILGVSLA +KAAA
Sbjct: 64  VLKAVENVNDIIFPELIGCSVFEQNLIDKIMLELDGTPNKAKLGANAILGVSLAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           Q +NLPLY+Y+GG +A+ LPVP+MNILNGG HADN++DFQEFMIMP  A+   +A+RMG 
Sbjct: 124 QEANLPLYRYVGGTNANTLPVPMMNILNGGSHADNSIDFQEFMIMPAKADTFSQALRMGV 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLK  LKSKGYSTNVGDEGGF+PN+K+ + A++++  +IEKAGY  G+++ IA+D 
Sbjct: 184 EVFHTLKTVLKSKGYSTNVGDEGGFAPNIKSNEEAIEVVLQAIEKAGYKPGEEIFIAMDA 243

Query: 242 AASAFFKKEKY-ILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           A S F++   Y   K +  +L  +EMA Y    V +YPI SIEDGM EDDW GWK LT+ 
Sbjct: 244 AVSEFYEDGLYHFKKSDGRKLSSDEMADYWTQWVAKYPIISIEDGMDEDDWAGWKTLTDS 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG  CQLVGDDLFVTN  RL +GI  ++ANA+L+K NQIGS++ET++T+  A+   Y SI
Sbjct: 304 IGKKCQLVGDDLFVTNVTRLQQGIESQIANAVLVKVNQIGSLTETIDTVNLAKRNSYKSI 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           +SHRSGETED TIADLAVA N GQIKTGS +RSDR+AKYNQL+RIEE LG+ A F G
Sbjct: 364 MSHRSGETEDATIADLAVALNTGQIKTGSASRSDRMAKYNQLLRIEEELGESAYFPG 420


>gi|296314527|ref|ZP_06864468.1| phosphopyruvate hydratase [Neisseria polysaccharea ATCC 43768]
 gi|296838838|gb|EFH22776.1| phosphopyruvate hydratase [Neisseria polysaccharea ATCC 43768]
          Length = 428

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 321/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   SKG+ T VGDEGGF+PNL +   AL L+  + E AGY AGKD+L ALDC
Sbjct: 184 EIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYKAGKDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YL  LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGRFYTSAEFAEYLEGLVNEFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GGKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAAYYPGKA 421


>gi|311898048|dbj|BAJ30456.1| putative enolase [Kitasatospora setae KM-6054]
          Length = 426

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 326/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +K RYFGKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEALELRDGDKNRYFGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M+DLD TP+KS LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMLDLDATPDKSSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R G 
Sbjct: 124 EASDLPLFRYLGGPNAHVLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEAVRWGV 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLK  LK +G ST +GDEGGF+PNL +   ALDLI  +I+KAGY  GKD+ +ALD 
Sbjct: 184 EVYHTLKGVLKERGLSTGLGDEGGFAPNLDSNREALDLITEAIKKAGYTPGKDVALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS FFK   Y  +G+   L   ++ +Y A LV  YP+ SIED + E DW GWK +T+ I
Sbjct: 244 AASEFFKDGAYQFEGK--ALSSADLIAYYAELVADYPLVSIEDPLDESDWDGWKAITDAI 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL KGI    ANA+L+K NQIGS++ETL+ +E AQ  GY  ++
Sbjct: 302 GDKVQLVGDDLFVTNPERLRKGIETGTANALLVKVNQIGSLTETLDAVELAQRNGYRCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A++AGRS
Sbjct: 362 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAEYAGRS 419


>gi|120610009|ref|YP_969687.1| phosphopyruvate hydratase [Acidovorax citrulli AAC00-1]
 gi|134034099|sp|A1TLS5|ENO_ACIAC RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|120588473|gb|ABM31913.1| enolase [Acidovorax citrulli AAC00-1]
          Length = 428

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 258/419 (61%), Positives = 322/419 (76%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIVGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A+LG DA +Q  +DK +IDLDGT NKSRLGANA+L VS+AV++AAA
Sbjct: 64  VLKAVEHINTEISEAVLGLDASEQAFLDKTLIDLDGTDNKSRLGANAMLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+LD QEFMI+PVGA + REA+R GA
Sbjct: 124 EESGLPLYRYLGGMGGLQLPVPMMNVINGGAHANNSLDLQEFMIIPVGAPSFREAVRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK +  KG ST VGDEGGF+P+++  ++A+ LI  +I+ AGY AG+ + + LDC
Sbjct: 184 EVFHALKKIINDKGMSTAVGDEGGFAPSVENHEAAIQLILQAIDAAGYTAGEQIALGLDC 243

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AAS F+K   Y+L+GE  + L   +    LA  VD+YPI SIEDGM+E DW GWK LT +
Sbjct: 244 AASEFYKDGHYVLEGEGGIRLTAQQWTDMLATWVDKYPIISIEDGMAEGDWDGWKHLTER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G N QLVGDDLFVTN   L +GI++++ N+ILIK NQIG+++ET   IE A+ AGY ++
Sbjct: 304 LGKNVQLVGDDLFVTNTRILKEGIDKDIGNSILIKINQIGTLTETFAAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ISHRSGETED TIAD+AV TN GQIKTGSL+RSDRIAKYNQL+RIEE LG  A + GR+
Sbjct: 364 ISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDIAHYPGRA 422


>gi|254670474|emb|CBA06162.1| Enolase [Neisseria meningitidis alpha153]
 gi|261392431|emb|CAX49976.1| enolase (2-phosphoglycerate dehydratase; 2-phospho-D-glycerate
           hydro-lyase) [Neisseria meningitidis 8013]
 gi|325204289|gb|ADY99742.1| phosphopyruvate hydratase [Neisseria meningitidis M01-240355]
          Length = 428

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 322/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   SKG+ T VGDEGGF+PNL +   AL L+  + E AGY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YL +LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGRSYTNAEFAEYLESLVNEFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GGKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAAYYPGKA 421


>gi|161870159|ref|YP_001599329.1| phosphopyruvate hydratase [Neisseria meningitidis 053442]
 gi|254805089|ref|YP_003083310.1| Enolase [Neisseria meningitidis alpha14]
 gi|189037224|sp|A9LZL4|ENO_NEIM0 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|161595712|gb|ABX73372.1| enolase [Neisseria meningitidis 053442]
 gi|254668631|emb|CBA06248.1| Enolase [Neisseria meningitidis alpha14]
          Length = 428

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 322/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   SKG+ T VGDEGGF+PNL +   AL L+  + E AGY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YL +LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGRSYTNAEFAEYLESLVNEFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GGKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAADYPGKA 421


>gi|332526689|ref|ZP_08402791.1| enolase [Rubrivivax benzoatilyticus JA2]
 gi|332111092|gb|EGJ11124.1| enolase [Rubrivivax benzoatilyticus JA2]
          Length = 427

 Score =  530 bits (1364), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 256/418 (61%), Positives = 318/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIVGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGDKGRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  +N EI  A+LG DA +Q  +DK ++DLDGT NK RLGANA L VS+AV++AAA
Sbjct: 64  VLRAVEHINTEISEAVLGLDASEQAFLDKTLVDLDGTENKGRLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y GG     LPVP+MN++NGG HA+N LD QEFMI+PVGA + REAIR GA
Sbjct: 124 EESGLPLYRYFGGMGRMSLPVPMMNVINGGAHANNNLDLQEFMILPVGAPSFREAIRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK + +KG  T+VGDEGGF+PN+   ++A+ LI  +I+KAGY  G+ + + LDC
Sbjct: 184 EVFHALKKIIDAKGMPTSVGDEGGFAPNVANHEAAIQLILEAIDKAGYTPGEQIALGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY L GE L L   E    LA   D+YPI SIEDGM E DW GWK+LT ++
Sbjct: 244 AASEFYKDGKYHLDGEGLVLSAGEWTDMLATWADKYPIISIEDGMHEGDWDGWKLLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN + L +GI + +AN+ILIK NQIG+++ET + IE A+ AGY ++I
Sbjct: 304 GGKLQLVGDDLFVTNTKILEEGIRKGIANSILIKINQIGTLTETFSAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV TN GQIKTGS++RSDRIAKYNQL+RIEE LG+ A + GRS
Sbjct: 364 SHRSGETEDSTIADIAVGTNAGQIKTGSMSRSDRIAKYNQLLRIEEDLGEIASYPGRS 421


>gi|94984113|ref|YP_603477.1| phosphopyruvate hydratase [Deinococcus geothermalis DSM 11300]
 gi|119369320|sp|Q1J2H6|ENO_DEIGD RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|94554394|gb|ABF44308.1| Enolase [Deinococcus geothermalis DSM 11300]
          Length = 422

 Score =  530 bits (1364), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 252/421 (59%), Positives = 322/421 (76%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGK 60
           M I  +IAREV+DSRG+PT+E +V L+ G +GRA+VPSGASTG HEA ELRD + RY GK
Sbjct: 1   MNIEKVIAREVLDSRGNPTVEAEVFLDSGFSGRAIVPSGASTGTHEALELRDGDGRYGGK 60

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVL+A+  VN+ +  AL+G DA +Q  +D  M+ LDGTPNK RLG NAIL VSLA ++AA
Sbjct: 61  GVLRAVQNVNEVLAPALVGLDASEQGAVDAAMLALDGTPNKGRLGGNAILAVSLATARAA 120

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    +PLY+YLGG +A  LPVP+MN++NGG HADN +DFQEFM+MPVGA   REA+R G
Sbjct: 121 ANELGVPLYRYLGGSNAKTLPVPMMNVINGGAHADNNVDFQEFMVMPVGAPTFREALRYG 180

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE FH LKK L  +GY+TNVGDEGGF+P+LK+ + AL+++  +IEKAGY  GKD+ IALD
Sbjct: 181 AETFHALKKVLAGRGYNTNVGDEGGFAPDLKSNEEALEVLLEAIEKAGYEPGKDIAIALD 240

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A +  ++  +Y L+ E   L   EM  + A+ V +YPI SIEDG++EDDW GW++LT +
Sbjct: 241 PATTELYRDGQYHLESEGRSLSTAEMVDFWADWVSRYPIVSIEDGLAEDDWDGWRLLTER 300

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTNPERL +GI   V NAIL+K NQIG+++E+++ IE A+ + Y +I
Sbjct: 301 LGDRVQLVGDDLFVTNPERLARGIETGVGNAILVKVNQIGTLTESMDAIELAKRSRYGTI 360

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           ISHRSGE+ED  IADLAVATN GQIKTGS +RSDRIAKYNQL+RIE+ LG +A + GR  
Sbjct: 361 ISHRSGESEDAFIADLAVATNAGQIKTGSASRSDRIAKYNQLLRIEDGLGDRAVYLGRRA 420

Query: 421 L 421
           L
Sbjct: 421 L 421


>gi|312892309|ref|ZP_07751804.1| enolase [Mucilaginibacter paludis DSM 18603]
 gi|311295093|gb|EFQ72267.1| enolase [Mucilaginibacter paludis DSM 18603]
          Length = 431

 Score =  530 bits (1364), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 261/424 (61%), Positives = 326/424 (76%), Gaps = 5/424 (1%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I ++ AR+++DSRG+PTIEV+V  E+G+ GRA VPSGASTG+HEA ELRD +K +Y GK
Sbjct: 3   IIINVHARQILDSRGNPTIEVEVLTENGALGRAAVPSGASTGVHEAVELRDNDKTKYMGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+A VND I  AL G D  +Q  IDK+MI+LDGTPNK  LGANAILGVSLAV+KAA
Sbjct: 63  GVLKAVANVNDTIAPALKGFDVFEQNSIDKLMIELDGTPNKGNLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           AQ S  PLY+Y+GG +A+ LP+P+MNI+NGG H+D  + FQEFMIMPVGA +  EA+R G
Sbjct: 123 AQESRQPLYRYVGGVNANTLPIPMMNIVNGGSHSDAPIAFQEFMIMPVGAPSFSEALRWG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFH LKK L  +G ST VGDEGGF+P   + +  ++ I  +IEKAGY  G+D+ +A D
Sbjct: 183 AEVFHNLKKILHDRGLSTAVGDEGGFAPTFDSTEDGVETILKAIEKAGYKVGEDICLAFD 242

Query: 241 CAASAFFKKEKY---ILKGENLELQPN-EMASYLANLVDQYPIYSIEDGMSEDDWHGWKI 296
           CAAS F+   KY     +GE   ++ + E A YLA L ++YP+ SIEDGM+EDDW GWK+
Sbjct: 243 CAASEFYVDGKYDYTKFEGEKGAIRSSAEQAEYLAQLAEKYPVISIEDGMAEDDWDGWKL 302

Query: 297 LTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAG 356
           LT+KIG   QLVGDDLFVTN +RL  GI++ V N+IL+K NQIGS++ET++ +  AQ  G
Sbjct: 303 LTDKIGDKVQLVGDDLFVTNVKRLQMGIDQGVGNSILVKVNQIGSLTETIDAVSLAQTNG 362

Query: 357 YPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFA 416
           Y S++SHRSGETED TIADLAVA NCGQIKTGS +RSDRIAKYNQL+RIEE LG  AKF 
Sbjct: 363 YTSVMSHRSGETEDATIADLAVALNCGQIKTGSASRSDRIAKYNQLLRIEEELGANAKFI 422

Query: 417 GRSI 420
           G++ 
Sbjct: 423 GKNF 426


>gi|332972916|gb|EGK10858.1| enolase [Desmospora sp. 8437]
          Length = 428

 Score =  530 bits (1364), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 249/417 (59%), Positives = 325/417 (77%), Gaps = 1/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+  REV+DSRG+PT+EV+V L+ G+ GRA+VPSGASTG HEA ELRD ++ RY GKG
Sbjct: 4   IIDVHGREVLDSRGNPTVEVEVILDTGAVGRAIVPSGASTGAHEAVELRDGDRERYQGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VN+ I   L G DA DQ+ +D+ MI LDGTPNK +LGANAILGVS+AV++AAA
Sbjct: 64  VLQAVQNVNEVIAPELEGMDALDQVGVDRAMIRLDGTPNKGKLGANAILGVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +T  LPL+ YLGG ++ +LPVP+MNILNGG HADN +D QEFM+MPVGAE+ RE +RMG 
Sbjct: 124 ETVGLPLFTYLGGFNSKVLPVPMMNILNGGAHADNNVDIQEFMVMPVGAESFREGLRMGT 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LK  LK KG ST+VGDEGGF+PNL + + AL  I N+I++AGY  G D+L+ALD 
Sbjct: 184 EIFHHLKAVLKEKGLSTSVGDEGGFAPNLSSNEEALQTIVNAIQRAGYQPGTDVLLALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++  +K+  Y L+GE +    +EM +Y   LV +YPI SIEDG++EDDW GWK LT ++
Sbjct: 244 ASTELYKEGSYHLEGEGVTKSADEMIAYYEELVQKYPIISIEDGLAEDDWEGWKKLTQRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN +RLH+GI + V N+IL+K NQIG+++ET + ++ A  AGY ++I
Sbjct: 304 GEKVQLVGDDLFVTNTDRLHQGIEKGVGNSILVKVNQIGTLTETFDAVQMAARAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           SHRSGETED TIAD+AVAT  GQIKTG+ +R+DR+AKYNQL+RIEE L +  ++ G+
Sbjct: 364 SHRSGETEDTTIADIAVATGAGQIKTGAPSRTDRVAKYNQLLRIEEELERSGQYPGK 420


>gi|332969344|gb|EGK08369.1| enolase [Kingella kingae ATCC 23330]
          Length = 428

 Score =  529 bits (1363), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 264/418 (63%), Positives = 325/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IM+DLDGT NK+ LGANA L VSLAV++AAA
Sbjct: 64  VLKAVEHVNNDIAQALIGIDASEQAYIDQIMLDLDGTDNKANLGANATLAVSLAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG     LPVP+MN++NGG HA+N+LD QEFMIMPVGA + REA+R GA
Sbjct: 124 EDAGLPLYRYLGGAGHMALPVPMMNVINGGEHANNSLDIQEFMIMPVGATSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   SKG+ T VGDEGGF+PNL + + AL LI  ++E+AGY AG+D+L+ALDC
Sbjct: 184 EIFHNLKKLCDSKGFPTTVGDEGGFAPNLNSHEEALQLIVEAVEQAGYKAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L  EN      E A YLA+L  ++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLSAENKAFTSAEFADYLADLASKFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  +E A+   Y S++
Sbjct: 304 GGKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVELAKRNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE LG  A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELGDIAYYPGKA 421


>gi|253682583|ref|ZP_04863380.1| phosphopyruvate hydratase [Clostridium botulinum D str. 1873]
 gi|253562295|gb|EES91747.1| phosphopyruvate hydratase [Clostridium botulinum D str. 1873]
          Length = 433

 Score =  529 bits (1363), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 257/418 (61%), Positives = 324/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AR+++DSRG+PT+EV+V LEDG+ GRA VPSGASTGI EA ELRD +K RY GK 
Sbjct: 7   IVDVYARQILDSRGNPTVEVEVELEDGTVGRAAVPSGASTGIFEAVELRDNDKSRYMGKS 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ I   L+G +A DQ+ IDKIMI+LDGT NK +LGANA+LGVSLA ++AAA
Sbjct: 67  VEKAVENVNEIIAEELVGLNAFDQVAIDKIMIELDGTDNKGKLGANAMLGVSLACARAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   + LY+Y+GG +A +LPVP+MNI+NGG HADN +D QEFMIMP GA N   A+RM A
Sbjct: 127 EYLGISLYQYIGGVNAKVLPVPMMNIMNGGSHADNNVDLQEFMIMPAGARNFSHALRMCA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E++HTLK  LK KG ST VGDEGGF+PNL + + A+ +I  ++EKAGY  G+++ IALD 
Sbjct: 187 EIYHTLKNILKDKGLSTGVGDEGGFAPNLNSNEEAIQVIIEAVEKAGYKPGEEVFIALDP 246

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           A+S FF  +  KY LKGE  EL P EM  Y A LV++YPI SIEDGM+E+DW GWK++T 
Sbjct: 247 ASSEFFNTDTNKYELKGEGRELTPAEMVEYYAKLVEKYPIISIEDGMAEEDWEGWKLMTE 306

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           K+G   QLVGDDLFVTN +RL  GI  +VAN+ILIK NQIG+++ETLNTIE A+ AGY +
Sbjct: 307 KLGGKIQLVGDDLFVTNTKRLSMGIERKVANSILIKLNQIGTLTETLNTIEMAERAGYTA 366

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIADL VA N GQIKTG+ AR++R+AKYNQL+RIEE L    ++ G
Sbjct: 367 VVSHRSGETEDTTIADLVVAVNAGQIKTGAPARTERVAKYNQLLRIEEELNTMGEYRG 424


>gi|300691891|ref|YP_003752886.1| enolase, phosphopyruvate hydratase [Ralstonia solanacearum PSI07]
 gi|299078951|emb|CBJ51611.1| enolase, phosphopyruvate hydratase [Ralstonia solanacearum PSI07]
          Length = 427

 Score =  529 bits (1363), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 261/418 (62%), Positives = 324/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKGRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +D+ +IDLDGT NK RLGANA L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDRTLIDLDGTENKGRLGANATLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  +PVP+MNI+NGG HA+N+LD QEFM+MPVG ++ REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQMPVPMMNIVNGGAHANNSLDIQEFMVMPVGQQSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK +  KG ST VGDEGGF+PN  + +  L+ I ++IE+AGY AG+D+L+ALDC
Sbjct: 184 EIFHALKKIISDKGMSTAVGDEGGFAPNFASNEECLNTILSAIERAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F++  KY L+GE L+L   + A+YLANL D++PI SIEDGM E DW GWK+LT ++
Sbjct: 244 AASEFYRDGKYHLEGEGLQLSSVDFANYLANLADKFPIVSIEDGMHEGDWDGWKVLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI   +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GQRVQLVGDDLFVTNTRILKEGIERGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV TN GQIKTGSL+RSDRIAKYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDIASYPGKS 421


>gi|329903711|ref|ZP_08273587.1| Enolase [Oxalobacteraceae bacterium IMCC9480]
 gi|327548232|gb|EGF32931.1| Enolase [Oxalobacteraceae bacterium IMCC9480]
          Length = 428

 Score =  529 bits (1363), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 319/418 (76%), Gaps = 2/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DIIARE+IDSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +  RYFGKG
Sbjct: 4   IVDIIAREIIDSRGNPTVECDVLLESGVMGRASVPSGASTGSREAIELRDGDMSRYFGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA  F+N EI  A++G DA +Q  +D+ +IDLDGT NK+R+GANA L VS+AV+KAAA
Sbjct: 64  VLKACEFINTEISEAIMGLDANEQAFLDRTLIDLDGTDNKARIGANATLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y GG  A  +PVP+MN++NGG HADN LD QEFMI+PVGA + +EAIR GA
Sbjct: 124 EESGLPLYRYFGGSGAMQMPVPMMNVINGGAHADNNLDIQEFMIIPVGAPSFKEAIRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKK LKSKG +T+VGDEGGF+PN+   + A+ LI  +IE+AGY  G  + + LDC
Sbjct: 184 EVFHTLKKILKSKGLATSVGDEGGFAPNVDNHEMAIKLIIQAIEEAGYEPGTQIALGLDC 243

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AAS F+K  KY L GE  L L   +  + LA   D+YPI SIEDGM+E+DW GW ILT  
Sbjct: 244 AASEFYKDGKYQLAGEGGLALSSTDFTNLLATWCDKYPIISIEDGMAENDWEGWAILTES 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN + L +GI++ +AN+ILIK NQIG+++ET   IE A+ AGY ++
Sbjct: 304 LGKKIQLVGDDLFVTNTKILREGIDKNIANSILIKINQIGTLTETFAAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           ISHRSGETED TIAD+AV TN  QIKTGS++RSDR+AKYNQL+RIEE LG  A + GR
Sbjct: 364 ISHRSGETEDSTIADIAVGTNALQIKTGSMSRSDRMAKYNQLLRIEEDLGDIASYPGR 421


>gi|307329344|ref|ZP_07608507.1| enolase [Streptomyces violaceusniger Tu 4113]
 gi|306885012|gb|EFN16035.1| enolase [Streptomyces violaceusniger Tu 4113]
          Length = 426

 Score =  529 bits (1362), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 329/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEALELRDGDKNRYHGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD TP+KS LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATPDKSSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI PVGAE+  EA+R GA
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPVGAESFSEAVRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLK  LK +G ST +GDEGGF+PNL +   ALDLI  +I+KAGY  G+D+ +ALD 
Sbjct: 184 EVYHTLKSVLKERGLSTGLGDEGGFAPNLGSNREALDLILEAIKKAGYQPGQDIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G++      EM SY A LV  YP+ S+ED ++E+DW GWK +T ++
Sbjct: 244 AASEFYKDGSYEFEGKS--RTAAEMTSYYAELVAAYPLVSLEDPLNEEDWDGWKTITEQL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI+ + ANA+L+K NQIGS++ETL+ +E AQ +GY  ++
Sbjct: 302 GDKVQLVGDDLFVTNPERLARGIDNDTANALLVKVNQIGSLTETLDAVELAQRSGYKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|295838363|ref|ZP_06825296.1| phosphopyruvate hydratase [Streptomyces sp. SPB74]
 gi|295826980|gb|EDY42772.2| phosphopyruvate hydratase [Streptomyces sp. SPB74]
          Length = 428

 Score =  529 bits (1362), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 330/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 6   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDANRYQGKG 65

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD TP+KS LGANAILGVSLAV+ AA+
Sbjct: 66  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMSDLDATPDKSSLGANAILGVSLAVAHAAS 125

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 126 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEAVRWGA 185

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LK +G ST +GDEGGF+PNL +  +ALDLI  +I++AGY  G+D+ +ALDC
Sbjct: 186 EVYHTLKKVLKERGLSTGLGDEGGFAPNLDSNRAALDLIVEAIKEAGYVPGRDVALALDC 245

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY+ +G+  E    +M  Y  +LV  YP+ SIED + EDDW GW  +T ++
Sbjct: 246 AASEFYKDGKYLFEGQ--ERSAAQMTEYYEDLVASYPLVSIEDPLFEDDWAGWATVTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI+E+ ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 304 GDKVQLVGDDLFVTNPERLQRGIDEKSANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIK+G+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 364 SHRSGETEDVTIADLAVATNCGQIKSGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 421


>gi|59801045|ref|YP_207757.1| phosphopyruvate hydratase [Neisseria gonorrhoeae FA 1090]
 gi|194098859|ref|YP_002001923.1| phosphopyruvate hydratase [Neisseria gonorrhoeae NCCP11945]
 gi|239999144|ref|ZP_04719068.1| phosphopyruvate hydratase [Neisseria gonorrhoeae 35/02]
 gi|240013948|ref|ZP_04720861.1| phosphopyruvate hydratase [Neisseria gonorrhoeae DGI18]
 gi|240016390|ref|ZP_04722930.1| phosphopyruvate hydratase [Neisseria gonorrhoeae FA6140]
 gi|240080509|ref|ZP_04725052.1| phosphopyruvate hydratase [Neisseria gonorrhoeae FA19]
 gi|240115879|ref|ZP_04729941.1| phosphopyruvate hydratase [Neisseria gonorrhoeae PID18]
 gi|240118177|ref|ZP_04732239.1| phosphopyruvate hydratase [Neisseria gonorrhoeae PID1]
 gi|240121517|ref|ZP_04734479.1| phosphopyruvate hydratase [Neisseria gonorrhoeae PID24-1]
 gi|240123725|ref|ZP_04736681.1| phosphopyruvate hydratase [Neisseria gonorrhoeae PID332]
 gi|240125916|ref|ZP_04738802.1| phosphopyruvate hydratase [Neisseria gonorrhoeae SK-92-679]
 gi|240128428|ref|ZP_04741089.1| phosphopyruvate hydratase [Neisseria gonorrhoeae SK-93-1035]
 gi|260440306|ref|ZP_05794122.1| phosphopyruvate hydratase [Neisseria gonorrhoeae DGI2]
 gi|268594979|ref|ZP_06129146.1| phosphopyruvate hydratase [Neisseria gonorrhoeae 35/02]
 gi|268596642|ref|ZP_06130809.1| phosphopyruvate hydratase [Neisseria gonorrhoeae FA19]
 gi|268601554|ref|ZP_06135721.1| enolase [Neisseria gonorrhoeae PID18]
 gi|268603893|ref|ZP_06138060.1| enolase [Neisseria gonorrhoeae PID1]
 gi|268682356|ref|ZP_06149218.1| enolase [Neisseria gonorrhoeae PID332]
 gi|268684514|ref|ZP_06151376.1| enolase [Neisseria gonorrhoeae SK-92-679]
 gi|268686824|ref|ZP_06153686.1| enolase [Neisseria gonorrhoeae SK-93-1035]
 gi|291043598|ref|ZP_06569314.1| phosphopyruvate hydratase [Neisseria gonorrhoeae DGI2]
 gi|293398909|ref|ZP_06643074.1| phosphopyruvate hydratase [Neisseria gonorrhoeae F62]
 gi|66774125|sp|Q5F8Z2|ENO_NEIG1 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|238690213|sp|B4RMD8|ENO_NEIG2 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|59717940|gb|AAW89345.1| putative enolase (2-phosphoglycerate dehydratase) [Neisseria
           gonorrhoeae FA 1090]
 gi|193934149|gb|ACF29973.1| phosphopyruvate hydratase [Neisseria gonorrhoeae NCCP11945]
 gi|268548368|gb|EEZ43786.1| phosphopyruvate hydratase [Neisseria gonorrhoeae 35/02]
 gi|268550430|gb|EEZ45449.1| phosphopyruvate hydratase [Neisseria gonorrhoeae FA19]
 gi|268585685|gb|EEZ50361.1| enolase [Neisseria gonorrhoeae PID18]
 gi|268588024|gb|EEZ52700.1| enolase [Neisseria gonorrhoeae PID1]
 gi|268622640|gb|EEZ55040.1| enolase [Neisseria gonorrhoeae PID332]
 gi|268624798|gb|EEZ57198.1| enolase [Neisseria gonorrhoeae SK-92-679]
 gi|268627108|gb|EEZ59508.1| enolase [Neisseria gonorrhoeae SK-93-1035]
 gi|291012061|gb|EFE04050.1| phosphopyruvate hydratase [Neisseria gonorrhoeae DGI2]
 gi|291610323|gb|EFF39433.1| phosphopyruvate hydratase [Neisseria gonorrhoeae F62]
 gi|317164435|gb|ADV07976.1| phosphopyruvate hydratase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 428

 Score =  529 bits (1362), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 321/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   SKG+ T VGDEGGF+PNL +   AL L+  + E AGY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLMVEAAEAAGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YL  LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGRSYTNAEFAEYLEGLVNEFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GKKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKCNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAAYYPGKA 421


>gi|160947582|ref|ZP_02094749.1| hypothetical protein PEPMIC_01517 [Parvimonas micra ATCC 33270]
 gi|158446716|gb|EDP23711.1| hypothetical protein PEPMIC_01517 [Parvimonas micra ATCC 33270]
          Length = 429

 Score =  528 bits (1361), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 259/419 (61%), Positives = 324/419 (77%), Gaps = 1/419 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I +I AREV+DSRG+PT+EV+V  E+G+ G A+VPSGASTG+HEA ELRD +K RY GK
Sbjct: 3   LIVEIYAREVLDSRGNPTVEVEVTTENGTVGSAIVPSGASTGVHEAVELRDGDKTRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           G L A+  VN+ I   L+G D  DQ+ ID+ +I +DGT NKS+LGANAILGVS+AV++AA
Sbjct: 63  GTLNAVNNVNEIIAEELIGFDVFDQVGIDRALIQIDGTENKSKLGANAILGVSMAVARAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A  S+ PLY+Y+GG +A  LPVP+MNILNGG HADN +D QEFM+MP GA + +EA+RMG
Sbjct: 123 AIESDTPLYEYIGGVNAKTLPVPMMNILNGGEHADNNVDIQEFMVMPAGACSFKEALRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            EVFH LK  LKSKGY+T VGDEGGF+PNL + + AL  I  +IEKAGY AGKD+ +ALD
Sbjct: 183 TEVFHNLKSVLKSKGYNTAVGDEGGFAPNLNSNEEALKTIMEAIEKAGYVAGKDIFLALD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A+S  ++  KY  KGE       E+ +Y  +LV++YPI SIEDG+SEDDW GWK+LT K
Sbjct: 243 VASSEMYENGKYNFKGEGKIYSSEELVNYYCDLVEKYPIISIEDGLSEDDWDGWKLLTEK 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG+  QLVGDDLFVTN  RL+ GI + +AN+ILIK NQIG+++ETL+ IE A+  GY  +
Sbjct: 303 IGNKVQLVGDDLFVTNYSRLNMGIEKGIANSILIKLNQIGTITETLDAIELAKTHGYTCV 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ISHRSGETED TIADLAVA N GQIKTGS +R+DRI KYNQL+RIE+ LG+ +KF G S
Sbjct: 363 ISHRSGETEDTTIADLAVAVNAGQIKTGSASRTDRICKYNQLLRIEDRLGENSKFLGLS 421


>gi|326316158|ref|YP_004233830.1| enolase [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323372994|gb|ADX45263.1| enolase [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 428

 Score =  528 bits (1361), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 257/419 (61%), Positives = 322/419 (76%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIVGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A+LG DA +Q  +DK +IDLDGT NKSRLGANA+L VS+AV++AAA
Sbjct: 64  VLKAVEHINTEISEAVLGLDASEQAFLDKTLIDLDGTDNKSRLGANAMLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+LD QEFMI+PVGA + REA+R GA
Sbjct: 124 EESGLPLYRYLGGMGGMQLPVPMMNVINGGAHANNSLDLQEFMIIPVGAPSFREAVRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK +  KG ST VGDEGGF+P+++  ++A+ LI  +I+ AGY AG+ + + LDC
Sbjct: 184 EVFHALKKIINDKGMSTAVGDEGGFAPSVENHEAAIQLILQAIDAAGYTAGEQIALGLDC 243

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AAS F+K   Y+L+GE  + L   +    LA  VD+YPI SIEDGM+E DW GWK LT +
Sbjct: 244 AASEFYKDGHYVLEGEGGIRLTAQQWTDMLATWVDKYPIISIEDGMAEGDWDGWKHLTER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G N QLVGDDLFVTN + L +GI++ + N+ILIK NQIG+++ET   IE A+ AGY ++
Sbjct: 304 LGKNVQLVGDDLFVTNTKILKEGIDKGIGNSILIKINQIGTLTETFAAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ISHRSGETED TIAD++V TN GQIKTGSL+RSDRIAKYNQL+RIEE LG  A + GR+
Sbjct: 364 ISHRSGETEDSTIADISVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDIAHYPGRA 422


>gi|297193967|ref|ZP_06911365.1| enolase [Streptomyces pristinaespiralis ATCC 25486]
 gi|297152026|gb|EDY66996.2| enolase [Streptomyces pristinaespiralis ATCC 25486]
          Length = 428

 Score =  528 bits (1361), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 261/418 (62%), Positives = 327/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD  + RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEALELRDGDQNRYQGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD TP+KS LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATPDKSSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R G 
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGT 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LK KG ST +GDEGGF+PNL +  +ALDLI  +I++AGY  GKD+ +ALD 
Sbjct: 184 EVYHTLKKVLKQKGLSTGLGDEGGFAPNLDSNRAALDLILEAIKEAGYAPGKDIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G+       EM  Y A LVD YP+ SIED + EDDW GW+ +T K+
Sbjct: 244 AASEFYKDGSYEFEGK--ARSAAEMTEYYAELVDSYPLVSIEDPLFEDDWAGWQTITEKL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTNPERL +GI+E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GAKVQLVGDDLFVTNPERLARGIDEGAANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|291166601|gb|EFE28647.1| phosphopyruvate hydratase [Filifactor alocis ATCC 35896]
          Length = 430

 Score =  528 bits (1361), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 256/420 (60%), Positives = 329/420 (78%), Gaps = 3/420 (0%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFG 59
           MFI ++ ARE++DSRG+PT+EV+VCLE G  GRA VPSGASTG++EA ELRD +K RY G
Sbjct: 1   MFITEVYAREILDSRGNPTVEVEVCLESGVIGRAAVPSGASTGVYEAVELRDGDKSRYLG 60

Query: 60  KGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKA 119
           KGVLKA+  VN+ I   L G    DQ+ ID+ MI LDGT NK  LGANAILGVS+AV++A
Sbjct: 61  KGVLKAVENVNEVIAPKLEGWSVFDQVGIDEFMIALDGTENKGTLGANAILGVSMAVARA 120

Query: 120 AAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRM 179
           AA+   LPLY+YLGG +A  LPVP+MNILNGG HADN +D QEFM+MPVGA++ +EA+RM
Sbjct: 121 AAEELGLPLYQYLGGVNAKTLPVPMMNILNGGQHADNNVDIQEFMVMPVGADSWKEALRM 180

Query: 180 GAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIAL 239
           GAE+FH LK  LKSKG +T+VGDEGGF+PNL + + AL  I  +IEKAGY  G ++ IA+
Sbjct: 181 GAEIFHALKSVLKSKGLNTSVGDEGGFAPNLSSNEEALSSIVEAIEKAGYQPGTEVKIAM 240

Query: 240 DCAASAFF--KKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           D AAS+F+  +K+KY+L GE  E    EM ++   LV++YPI SIEDG+ E+DW G+K++
Sbjct: 241 DAAASSFYDAEKKKYVLAGEGKEYSSEEMVAFYEKLVEKYPIISIEDGLDENDWDGFKLM 300

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T  +GS  Q+VGDDLFVTN ++L +GI + +ANAILIK NQIG+++ETL+ IE A+ AGY
Sbjct: 301 TEHLGSKIQIVGDDLFVTNTKKLAEGIEKGIANAILIKLNQIGTITETLDAIEMAKRAGY 360

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +++SHRSGETED TIADL VATN GQIKTG+ +R+DR+AKYNQLIRIEE L   +++ G
Sbjct: 361 TAVVSHRSGETEDTTIADLVVATNAGQIKTGAPSRTDRVAKYNQLIRIEEELEGISQYLG 420


>gi|17545848|ref|NP_519250.1| phosphopyruvate hydratase [Ralstonia solanacearum GMI1000]
 gi|21263577|sp|Q8Y0B5|ENO_RALSO RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|17428142|emb|CAD14831.1| probable enolase (2-phosphoglycerate dehydratase)
           (2-phospho-d-glycerate hydro-lyase) protein [Ralstonia
           solanacearum GMI1000]
          Length = 427

 Score =  528 bits (1361), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 324/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKGRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +D+ +IDLDGT NK RLGANA L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDRTLIDLDGTENKGRLGANATLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  +PVP+MNI+NGG HA+N+LD QEFM+MPVG ++ REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQMPVPMMNIVNGGAHANNSLDIQEFMVMPVGQQSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK +  KG ST VGDEGGF+PN  + +  L+ I ++IEKAGY  G+D+L+ALDC
Sbjct: 184 EIFHALKKIIADKGMSTAVGDEGGFAPNFASNEECLNTILSAIEKAGYRPGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F++  KY L GE L+L   + A+YLANL D++PI SIEDGM E DW GWK+LT K+
Sbjct: 244 AASEFYRDGKYHLDGEGLQLSSVDFANYLANLADKFPIVSIEDGMHESDWDGWKVLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GNKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV TN GQIKTGSL+RSDRIAKYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDIASYPGKS 421


>gi|134298015|ref|YP_001111511.1| phosphopyruvate hydratase [Desulfotomaculum reducens MI-1]
 gi|134050715|gb|ABO48686.1| enolase [Desulfotomaculum reducens MI-1]
          Length = 427

 Score =  528 bits (1361), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 251/421 (59%), Positives = 324/421 (76%), Gaps = 1/421 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I+DI ARE++DSRG+PT+E +V LEDG+ GRA VPSGASTG +EA ELRD +K RY GK
Sbjct: 3   IISDIFAREILDSRGNPTLEAEVWLEDGTVGRAAVPSGASTGAYEAVELRDGDKGRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN+ +   L+G D  DQ+ ID+ MI+LDGTPNK +LGANAILGVSLAV+KAA
Sbjct: 63  GVLKAVNHVNEILGPELIGMDVTDQIGIDQRMIELDGTPNKGKLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    +PLY+Y+GG +A  LPVP+MNILNGG HADN +D QEFM++PVGA++  E +RMG
Sbjct: 123 ANFLGMPLYQYIGGVNAKELPVPMMNILNGGAHADNNVDIQEFMVLPVGADSFSEGLRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE+FH LK  LK++G +T VGDEGGF+PNLK+ + AL +I  +IEKAGY  G+D+ + LD
Sbjct: 183 AEIFHNLKAVLKARGLNTAVGDEGGFAPNLKSNEEALAVIIEAIEKAGYKPGQDVFLGLD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            AA+  +K   Y+L+GE +     +M  +   +V+++PI +IEDG+SE+DW GW  LT  
Sbjct: 243 VAATELYKGGNYVLEGEGVTYTSEQMIEFYQRMVEKFPIITIEDGLSEEDWEGWAKLTQA 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN ERL KGI   VAN+ILIK NQIG+++ETL+ IE A+ AGY ++
Sbjct: 303 LGKKVQLVGDDLFVTNTERLDKGIKSAVANSILIKLNQIGTLTETLDAIEMAKRAGYTAV 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           +SHRSGET D TIADLAVATN GQIKTG+ +R+DR+AKYNQL+RIEE L   AK+ G+ +
Sbjct: 363 VSHRSGETADTTIADLAVATNAGQIKTGAPSRTDRVAKYNQLLRIEEELSTMAKYRGKDV 422

Query: 421 L 421
            
Sbjct: 423 F 423


>gi|304387416|ref|ZP_07369607.1| enolase [Neisseria meningitidis ATCC 13091]
 gi|304338509|gb|EFM04628.1| enolase [Neisseria meningitidis ATCC 13091]
          Length = 428

 Score =  528 bits (1361), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 321/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   SKG+ T VGDEGGF+PNL +   AL L+  + E  GY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAVGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YL +LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGRSYTNAEFAEYLESLVNEFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GGKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAAYYPGKA 421


>gi|302519713|ref|ZP_07272055.1| phosphopyruvate hydratase [Streptomyces sp. SPB78]
 gi|302428608|gb|EFL00424.1| phosphopyruvate hydratase [Streptomyces sp. SPB78]
          Length = 428

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 329/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 6   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDANRYQGKG 65

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD TP+KS LGANAILGVSLAV+ AA+
Sbjct: 66  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMSDLDATPDKSSLGANAILGVSLAVAHAAS 125

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 126 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEAVRWGA 185

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LK +G ST +GDEGGF+PNL +  +ALDLI  +I++AGY  G+D+ +ALDC
Sbjct: 186 EVYHTLKKVLKERGLSTGLGDEGGFAPNLDSNRAALDLIVEAIKEAGYVPGRDVALALDC 245

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY  +G++      EM SY   LV  YP+ SIED + EDDW GW  +T ++
Sbjct: 246 AASEFYKDGKYRFEGQD--RTAAEMTSYYEELVGAYPLVSIEDPLFEDDWEGWATVTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI+E+ ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 304 GDKVQLVGDDLFVTNPERLQRGIDEKSANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIK+G+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 364 SHRSGETEDVTIADLAVATNCGQIKSGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 421


>gi|153955987|ref|YP_001396752.1| phosphopyruvate hydratase [Clostridium kluyveri DSM 555]
 gi|219856328|ref|YP_002473450.1| hypothetical protein CKR_2985 [Clostridium kluyveri NBRC 12016]
 gi|189037208|sp|A5N2N5|ENO_CLOK5 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|254783244|sp|B9E6B1|ENO_CLOK1 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|146348845|gb|EDK35381.1| Hypothetical protein CKL_3378 [Clostridium kluyveri DSM 555]
 gi|219570052|dbj|BAH08036.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 430

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 255/416 (61%), Positives = 323/416 (77%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AR+++DSR +PT+EV+V LEDG+ GRA VPSGASTG  EA ELRD++K +Y GKG
Sbjct: 7   IVDVTARQILDSRANPTVEVEVILEDGTEGRAAVPSGASTGAFEAVELRDEDKEKYMGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+ I   L+G +  DQ+LIDK M++LDGT NK +LGANA LGVSLA ++AAA
Sbjct: 67  VLKAVENVNNYIAEELIGMNVFDQVLIDKTMLELDGTHNKGKLGANATLGVSLACARAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   L LY+Y+GG +A +LPVP+MNI+NGG HADN +D QEFMIMPVGA +  EA+RM +
Sbjct: 127 KYLGLSLYQYIGGVNAKVLPVPMMNIVNGGKHADNNVDLQEFMIMPVGAPSFTEALRMSS 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLK  LKSKG  T VGDEGGF+PNL + + A+ +I  ++EKAGY  GKD+ IALD 
Sbjct: 187 EVYHTLKSLLKSKGQDTGVGDEGGFAPNLNSNEEAIQIIVEAVEKAGYVPGKDIFIALDP 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++  ++  KY LK E   L   EM  Y   LV++YPI SIED M+E+DW GW ILT K+
Sbjct: 247 ASTEIYEDGKYNLKSEGKVLSSEEMVDYYVTLVNKYPIISIEDAMAEEDWEGWSILTEKL 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN ERL KGI+++VAN+ILIK NQIG+++ETLN IE A+ AGY +++
Sbjct: 307 GDKVQLVGDDLFVTNTERLKKGIDKKVANSILIKLNQIGTLTETLNAIEMAERAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQL+RIEE LG+ A++ G
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLLRIEEELGETAEYRG 422


>gi|302340221|ref|YP_003805427.1| enolase [Spirochaeta smaragdinae DSM 11293]
 gi|301637406|gb|ADK82833.1| enolase [Spirochaeta smaragdinae DSM 11293]
          Length = 431

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 324/419 (77%), Gaps = 4/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I  I ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG+HEA ELRD +K R+ GKG
Sbjct: 4   IEFIEAREILDSRGNPTVEVDVVLEDGSMGRAAVPSGASTGVHEAVELRDGDKSRFMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VND +   L+G D  DQ+ ID+ MI+LDGT NK++LGANAILGVS+AV++AAA
Sbjct: 64  VLKAVENVNDTLAGELVGLDVLDQVDIDRTMIELDGTENKAKLGANAILGVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PL+KYLG   A +LPVP+ NILNGG HADN++DFQEFM+MPVGA+N+R  IRM A
Sbjct: 124 DFLGVPLFKYLGAYHATVLPVPMANILNGGSHADNSVDFQEFMVMPVGAQNVRGGIRMIA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LK  LK KGYST VGDEGGF+PNLK+ + A +LI  +IEKAGY  G+D++IALD 
Sbjct: 184 EVFHNLKSILKDKGYSTAVGDEGGFAPNLKSNEEACELILQAIEKAGYRPGEDVMIALDP 243

Query: 242 AASAFF--KKEKYILKGEN-LELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILT 298
           AAS F+  K  KY L+     E    EMA Y A+  ++YPI S+EDGM+EDDW GWK LT
Sbjct: 244 AASEFYDEKSGKYKLRWSTGAEYSSTEMADYWASWTEKYPIISLEDGMAEDDWEGWKYLT 303

Query: 299 NKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYP 358
           +KIG   QLVGDDLFVTN +RL KGI+E +AN+ILIK NQIG+++ET   ++ A+ AGY 
Sbjct: 304 DKIGKKVQLVGDDLFVTNTKRLRKGISEGIANSILIKVNQIGTLTETFEAVDMAKRAGYT 363

Query: 359 SIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           +++SHRSGETED  IADL V    GQIKTGSL+R+DR+AKYNQL+RIE+ L   A++ G
Sbjct: 364 AVVSHRSGETEDSFIADLVVGLETGQIKTGSLSRTDRLAKYNQLMRIEDYLEGVAEYPG 422


>gi|58698888|ref|ZP_00373755.1| enolase [Wolbachia endosymbiont of Drosophila ananassae]
 gi|58534597|gb|EAL58729.1| enolase [Wolbachia endosymbiont of Drosophila ananassae]
          Length = 432

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 260/414 (62%), Positives = 325/414 (78%), Gaps = 3/414 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQ-EKRYFGKG 61
           IN++ ARE++DSRG PTIEV++ L DG+ GRA VPSGASTG  EA ELRDQ EKRY GKG
Sbjct: 13  INNVFAREILDSRGYPTIEVEIELCDGAIGRASVPSGASTGKLEALELRDQDEKRYCGKG 72

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN  I   ++G +A DQ  IDK +I+LDGT NKS+LGANA LGVSLAV+KAAA
Sbjct: 73  VLKAVQAVNGIIADEIIGMNAADQNAIDKALIELDGTKNKSKLGANATLGVSLAVAKAAA 132

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +  +PLY+YLGG    ++PVPL+NI+NGG+HADN LDFQEFMI+PVGAE   EAIR+ A
Sbjct: 133 NSFKMPLYRYLGGKQTSVMPVPLINIINGGVHADNKLDFQEFMILPVGAETFSEAIRISA 192

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH L+  LK KGYSTNVGDEGGF+PN+++ + ALDLI  +IE AGY+A  D  + LD 
Sbjct: 193 EVFHNLRSILKKKGYSTNVGDEGGFAPNIESTEEALDLIIYAIESAGYSAQSDFALGLDV 252

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+  E  I + E+  L   E+  Y  NLV++YPI SIED MSEDD+ GWK+LT K+
Sbjct: 253 ASSTFY--EDGIYEFESKGLTSEELTEYYCNLVERYPIISIEDAMSEDDYEGWKLLTAKL 310

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTN E + KGI E++ANA+LIKPNQIG+++ET   IE A+  GY +++
Sbjct: 311 GNKIQLVGDDLFVTNCELICKGIEEKMANAVLIKPNQIGTLTETFAAIEMAKSNGYKAVV 370

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           SHRSGETED TI+ +AVA+NCGQIKTGSL+RSDR+AKYN+L+RIE +LGK AK+
Sbjct: 371 SHRSGETEDTTISHIAVASNCGQIKTGSLSRSDRLAKYNELMRIESTLGKDAKY 424


>gi|315186508|gb|EFU20267.1| enolase [Spirochaeta thermophila DSM 6578]
          Length = 433

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 261/421 (61%), Positives = 324/421 (76%), Gaps = 4/421 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGK 60
            I  + ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG+HEA ELRD  +KRY GK
Sbjct: 3   MIEYVEAREILDSRGNPTVEVDVVLEDGSMGRAAVPSGASTGVHEAVELRDGDKKRYMGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN+ I   + G DA DQ+ ID+ +I+LDGT NK +LGANAILGVS+AV++AA
Sbjct: 63  GVLKAVENVNNIIAPEIEGLDALDQVDIDRTLIELDGTENKGKLGANAILGVSMAVARAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    +PL++YLG   A++LPVP+ NILNGG HADN++DFQEFM+MPVGA + +E +RM 
Sbjct: 123 ADFLGIPLFRYLGAYKANVLPVPMANILNGGAHADNSVDFQEFMVMPVGAPSFKEGLRMI 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            EVFHTLK  LK  GYST VGDEGGF+PNLK+ + A++LI  SIEKAGY  G D++IALD
Sbjct: 183 TEVFHTLKGILKENGYSTTVGDEGGFAPNLKSNEEAVELILKSIEKAGYKPGDDVMIALD 242

Query: 241 CAASAFF--KKEKYIL-KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
            A S  +  +K+KY+L K    EL   +MA      V +YPI SIEDGM+EDDW GWKIL
Sbjct: 243 PATSELYDPEKKKYVLKKSTGQELSSEQMADLWETWVKKYPIVSIEDGMAEDDWEGWKIL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T++IG   QLVGDDLFVTN  RL +GI + VANAILIK NQIG+++ET   +E A+ AGY
Sbjct: 303 TDRIGDRVQLVGDDLFVTNSTRLAQGIEKGVANAILIKVNQIGTLTETFEAVEMAKTAGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +I+SHRSGETED+ IADL VA   GQIKTGSL+RSDR++KYNQL+RIEE LG  A++ G
Sbjct: 363 TAIVSHRSGETEDNFIADLVVALGTGQIKTGSLSRSDRLSKYNQLLRIEEILGDTAEYPG 422

Query: 418 R 418
           +
Sbjct: 423 K 423


>gi|225630076|ref|YP_002726867.1| Enolase [Wolbachia sp. wRi]
 gi|254783279|sp|C0R5N4|ENO_WOLWR RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|225592057|gb|ACN95076.1| Enolase [Wolbachia sp. wRi]
          Length = 424

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 260/415 (62%), Positives = 325/415 (78%), Gaps = 3/415 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQ-EKRYFGK 60
            IN++ ARE++DSRG PTIEV++ L DG+ GRA VPSGASTG  EA ELRDQ EKRY GK
Sbjct: 4   IINNVFAREILDSRGYPTIEVEIELCDGAIGRASVPSGASTGKLEALELRDQDEKRYCGK 63

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN  I   ++G +A DQ  IDK +I+LDGT NKS+LGANA LGVSLAV+KAA
Sbjct: 64  GVLKAVQAVNGIIADEIIGMNAADQNAIDKALIELDGTKNKSKLGANATLGVSLAVAKAA 123

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A +  +PLY+YLGG    ++PVPL+NI+NGG+HADN LDFQEFMI+PVGAE   EAIR+ 
Sbjct: 124 ANSFKMPLYRYLGGKQTSVMPVPLINIINGGVHADNKLDFQEFMILPVGAETFSEAIRIS 183

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFH L+  LK KGYSTNVGDEGGF+PN+++ + ALDLI  +IE AGY+A  D  + LD
Sbjct: 184 AEVFHNLRSILKKKGYSTNVGDEGGFAPNIESTEEALDLIIYAIESAGYSAQSDFALGLD 243

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A+S F+  E  I + E+  L   E+  Y  NLV++YPI SIED MSEDD+ GWK+LT K
Sbjct: 244 VASSTFY--EDGIYEFESKGLTSEELTEYYCNLVERYPIISIEDAMSEDDYEGWKLLTAK 301

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G+  QLVGDDLFVTN E + KGI E++ANA+LIKPNQIG+++ET   IE A+  GY ++
Sbjct: 302 LGNKIQLVGDDLFVTNCELICKGIEEKMANAVLIKPNQIGTLTETFAAIEMAKSNGYKAV 361

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           +SHRSGETED TI+ +AVA+NCGQIKTGSL+RSDR+AKYN+L+RIE +LGK AK+
Sbjct: 362 VSHRSGETEDTTISHIAVASNCGQIKTGSLSRSDRLAKYNELMRIESTLGKDAKY 416


>gi|110799305|ref|YP_695948.1| phosphopyruvate hydratase [Clostridium perfringens ATCC 13124]
 gi|110802210|ref|YP_698617.1| phosphopyruvate hydratase [Clostridium perfringens SM101]
 gi|168207667|ref|ZP_02633672.1| enolase [Clostridium perfringens E str. JGS1987]
 gi|168211752|ref|ZP_02637377.1| enolase [Clostridium perfringens B str. ATCC 3626]
 gi|168215116|ref|ZP_02640741.1| enolase [Clostridium perfringens CPE str. F4969]
 gi|168218205|ref|ZP_02643830.1| enolase [Clostridium perfringens NCTC 8239]
 gi|182626592|ref|ZP_02954338.1| enolase [Clostridium perfringens D str. JGS1721]
 gi|119369312|sp|Q0TQZ2|ENO_CLOP1 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|119369313|sp|Q0STE0|ENO_CLOPS RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|110673952|gb|ABG82939.1| enolase [Clostridium perfringens ATCC 13124]
 gi|110682711|gb|ABG86081.1| phosphopyruvate hydratase [Clostridium perfringens SM101]
 gi|170660999|gb|EDT13682.1| enolase [Clostridium perfringens E str. JGS1987]
 gi|170710286|gb|EDT22468.1| enolase [Clostridium perfringens B str. ATCC 3626]
 gi|170713453|gb|EDT25635.1| enolase [Clostridium perfringens CPE str. F4969]
 gi|177908072|gb|EDT70645.1| enolase [Clostridium perfringens D str. JGS1721]
 gi|182379803|gb|EDT77282.1| enolase [Clostridium perfringens NCTC 8239]
          Length = 431

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 253/422 (59%), Positives = 325/422 (77%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D++AR+++DSR  PT+EV+V LEDG+ GRA VPSGASTGI+EA ELRD +K +Y GKG
Sbjct: 7   IIDVVARQILDSRCFPTVEVEVYLEDGTVGRAAVPSGASTGIYEAVELRDGDKDKYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+A VND I   ++G +  DQ  IDK +I+LDGT NK +LGANAILGVSLAV++AAA
Sbjct: 67  VEKAVANVNDTIAEEIIGLNVLDQAYIDKTLIELDGTKNKGKLGANAILGVSLAVAQAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY+Y+GG +A +LPVP+MNI+NGG HADN++D QEFMIMPVG +    A+R  A
Sbjct: 127 NYLGMPLYQYIGGVNAKVLPVPMMNIINGGSHADNSVDIQEFMIMPVGFDCFERAVRACA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LKK L SKGYST VGDEGGF+PNLK+   A+++I  +IEKAGY  GK+  IA+D 
Sbjct: 187 EVYHALKKTLNSKGYSTGVGDEGGFAPNLKSNAEAIEVILEAIEKAGYEPGKEFFIAIDA 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S ++K  KY+L+ E   L   EM  +  + V++YPI SIEDGM+E+DW GWK++T ++
Sbjct: 247 ASSEYYKDGKYVLEHEGKTLTAAEMVDFFEDWVNKYPIISIEDGMAEEDWEGWKLMTERL 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN ERL  GI + +AN+ILIK NQIG+++ETLN IE A  AGY +++
Sbjct: 307 GKKVQLVGDDLFVTNTERLKTGIEKGIANSILIKLNQIGTLTETLNAIEMANRAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQLIRI E LG+ A++ GR+  
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLIRINEELGEVAEYRGRNAF 426

Query: 422 IH 423
            +
Sbjct: 427 FN 428


>gi|58584379|ref|YP_197952.1| enolase [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|75508015|sp|Q5GTG4|ENO_WOLTR RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|58418695|gb|AAW70710.1| Enolase [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 425

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 255/414 (61%), Positives = 323/414 (78%), Gaps = 3/414 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQ-EKRYFGKG 61
           IN++ ARE++DSRG PT+EV++ L DG+TGRA VPSGASTG  EA ELRDQ EKRY GKG
Sbjct: 6   INNVFAREILDSRGYPTVEVEIELCDGATGRASVPSGASTGKLEALELRDQDEKRYCGKG 65

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN  I  A++G DA DQ  IDK +I+LDGT NKS+LGANA LGVSLA +KAAA
Sbjct: 66  VLKAVKAVNGVIANAIIGMDAADQSTIDKALIELDGTRNKSKLGANATLGVSLASAKAAA 125

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +  +PLY+YLGG  A+++P PL+NI+NGG+HADN LDFQEFMI+P+GAE   EAIRM A
Sbjct: 126 NSFKMPLYRYLGGEQANVMPFPLINIINGGVHADNKLDFQEFMILPIGAEAFSEAIRMSA 185

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH L+  L+ +GYSTNVGDEGGF+PN+++ + ALDLI ++IE A Y+      + LD 
Sbjct: 186 EVFHNLRSILRKRGYSTNVGDEGGFAPNIESTEEALDLIVHAIESASYSTQNHFALGLDV 245

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K + Y  K  N EL   E+  Y  NLV++YPI S+ED MSEDD+ GWK+LT K+
Sbjct: 246 ASSTFYKNKIY--KFANKELTSEELVEYYYNLVEKYPITSMEDAMSEDDYEGWKLLTAKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  QLVGDDLFVTN E + KGI E++ANA+LIKPNQIG+++ET   I   +  GY ++I
Sbjct: 304 GSKVQLVGDDLFVTNCELIRKGIEEKMANAVLIKPNQIGTLTETFTAIGMTKSGGYKAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           SHRSGETED TI+ +A+A+NCGQIKTGSL+RSDR+AKYN+LIRIE +L + AK+
Sbjct: 364 SHRSGETEDTTISHIAIASNCGQIKTGSLSRSDRLAKYNELIRIEGTLERNAKY 417


>gi|333026472|ref|ZP_08454536.1| putative phosphopyruvate hydratase [Streptomyces sp. Tu6071]
 gi|332746324|gb|EGJ76765.1| putative phosphopyruvate hydratase [Streptomyces sp. Tu6071]
          Length = 447

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 329/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 25  IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDANRYQGKG 84

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD TP+KS LGANAILGVSLAV+ AA+
Sbjct: 85  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMSDLDATPDKSSLGANAILGVSLAVAHAAS 144

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 145 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEAVRWGA 204

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LK +G ST +GDEGGF+PNL +  +ALDLI  +I++AGY  G+D+ +ALDC
Sbjct: 205 EVYHTLKKVLKERGLSTGLGDEGGFAPNLDSNRAALDLIVEAIKEAGYVPGRDVALALDC 264

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY  +G++      EM SY   LV  YP+ SIED + EDDW GW  +T ++
Sbjct: 265 AASEFYKDGKYRFEGQDRTAA--EMTSYYEELVGAYPLVSIEDPLFEDDWEGWATVTERL 322

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI+E+ ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 323 GDKVQLVGDDLFVTNPERLQRGIDEKSANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 382

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIK+G+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 383 SHRSGETEDVTIADLAVATNCGQIKSGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 440


>gi|255994715|ref|ZP_05427850.1| phosphopyruvate hydratase [Eubacterium saphenum ATCC 49989]
 gi|255993428|gb|EEU03517.1| phosphopyruvate hydratase [Eubacterium saphenum ATCC 49989]
          Length = 429

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 267/420 (63%), Positives = 331/420 (78%), Gaps = 3/420 (0%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFG 59
           + I DI AREV+DSRG+PT+EV+V L DGS GRA+VPSGASTG+HEA ELRDQ+K RY G
Sbjct: 2   VIIEDIHAREVLDSRGNPTVEVEVALSDGSLGRAIVPSGASTGVHEALELRDQDKDRYNG 61

Query: 60  KGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKA 119
           KG LKA+  + + I   L+G    DQ+LID  MIDLDGT NK  LGANA+LGVS+AV+ A
Sbjct: 62  KGTLKAVENIEEIIAEKLIGIGPFDQVLIDNFMIDLDGTENKKNLGANAMLGVSMAVASA 121

Query: 120 AAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRM 179
           AA +  +PL++YLGG +A +LP P+MNILNGG HADN +D QEFMIMPVGA+++REAIRM
Sbjct: 122 AAASLKMPLFQYLGGVNAKVLPTPMMNILNGGSHADNTVDIQEFMIMPVGADSVREAIRM 181

Query: 180 GAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIAL 239
           GAE+F  LKK LK K   T VGDEGGF+PNLKT + A+ +I  + EKAGY AG+D+ IA+
Sbjct: 182 GAEIFAALKKVLKDKNMITTVGDEGGFAPNLKTNEDAIKVILEATEKAGYKAGEDIKIAI 241

Query: 240 DCAASAFFKKEK--YILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           D A+S F+  +K  YIL+GE   +  +EM  Y A L ++YPI SIEDG++EDDW GWK L
Sbjct: 242 DAASSEFYDNDKKVYILEGEGKTMTSSEMVDYYAELCEKYPIISIEDGLAEDDWGGWKEL 301

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T K+GS  QLVGDDLFVTN +RL +GI + +AN+ILIK NQIG+++ETL+ IE A+ AGY
Sbjct: 302 TEKLGSKVQLVGDDLFVTNTKRLKQGIEKGIANSILIKVNQIGTLTETLDAIEMAKKAGY 361

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            ++ISHRSGETED TIADLAVATN GQIKTGSL+R+DRIAKYNQLIRIEE +G  A++ G
Sbjct: 362 TAVISHRSGETEDTTIADLAVATNAGQIKTGSLSRTDRIAKYNQLIRIEELIGPAAEYLG 421


>gi|240113123|ref|ZP_04727613.1| phosphopyruvate hydratase [Neisseria gonorrhoeae MS11]
 gi|254493920|ref|ZP_05107091.1| enolase [Neisseria gonorrhoeae 1291]
 gi|268599207|ref|ZP_06133374.1| enolase [Neisseria gonorrhoeae MS11]
 gi|226512960|gb|EEH62305.1| enolase [Neisseria gonorrhoeae 1291]
 gi|268583338|gb|EEZ48014.1| enolase [Neisseria gonorrhoeae MS11]
          Length = 428

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 321/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   SKG+ T VGDEGGF+PNL +   AL L+  + E AGY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLMVEAAEVAGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YL  LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGRSYTNAEFAEYLEGLVNEFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GKKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKCNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAAYYPGKA 421


>gi|331268760|ref|YP_004395252.1| phosphopyruvate hydratase [Clostridium botulinum BKT015925]
 gi|329125310|gb|AEB75255.1| Phosphopyruvate hydratase [Clostridium botulinum BKT015925]
          Length = 433

 Score =  528 bits (1359), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 257/418 (61%), Positives = 324/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AR+++DSRG+PT+EV+V LEDG+ GRA VPSGASTGI EA ELRD +K RY GK 
Sbjct: 7   IVDVYARQILDSRGNPTVEVEVELEDGTVGRAAVPSGASTGIFEAVELRDNDKSRYMGKS 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ I   L+G +A DQ+ IDKIMI+LDGT NK +LGANA+LGVSLA ++AAA
Sbjct: 67  VEKAVENVNEIIAEELVGLNAFDQVAIDKIMIELDGTDNKGKLGANAMLGVSLACARAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   + LY+Y+GG +A +LPVP+MNI+NGG HADN +D QEFMIMP GA N   A+RM A
Sbjct: 127 EYLGISLYQYIGGVNAKVLPVPMMNIMNGGSHADNNVDLQEFMIMPAGARNFSHALRMCA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E++HTLK  LK KG ST VGDEGGF+PNL + + A+ +I  ++EKAGY  G+++ IALD 
Sbjct: 187 EIYHTLKNILKDKGLSTGVGDEGGFAPNLDSNEEAIQVIIEAVEKAGYKPGEEVFIALDP 246

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           A+S FF  +  KY LKGE  EL P EM  Y A LV++YPI SIEDGM+E+DW GWK++T 
Sbjct: 247 ASSEFFNTDTNKYELKGEGRELTPAEMVEYYAKLVEKYPIISIEDGMAEEDWDGWKLMTE 306

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           K+G   QLVGDDLFVTN +RL  GI  +VAN+ILIK NQIG+++ETLNTIE A+ AGY +
Sbjct: 307 KLGGKIQLVGDDLFVTNTKRLSMGIERKVANSILIKLNQIGTLTETLNTIEMAERAGYTA 366

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIADL VA N GQIKTG+ AR++R+AKYNQL+RIEE L    ++ G
Sbjct: 367 VVSHRSGETEDTTIADLVVAVNAGQIKTGAPARTERVAKYNQLLRIEEELNTMGEYRG 424


>gi|227538071|ref|ZP_03968120.1| phosphopyruvate hydratase [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227242147|gb|EEI92162.1| phosphopyruvate hydratase [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 433

 Score =  528 bits (1359), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 258/422 (61%), Positives = 321/422 (76%), Gaps = 5/422 (1%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGK 60
            I D+ AR+++DSRG+PTIEVDV  ++G TGRA VPSGASTG HEA ELRD  +K+Y GK
Sbjct: 3   LIIDVRARQILDSRGNPTIEVDVTTQNGFTGRAAVPSGASTGAHEAVELRDGDKKKYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN +I  AL G D  +Q  IDK+MIDLDGT NK +LGANAILGVSLAV+KAA
Sbjct: 63  GVLKAVENVNTKIAKALEGVDVFEQNAIDKLMIDLDGTENKGKLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           AQ S  PLY+Y+GG +A+ LP+P+MNI+NGG H+D  + FQEFMIMPVGA +  EA+R G
Sbjct: 123 AQESGQPLYRYVGGVNANTLPIPMMNIINGGSHSDAPIAFQEFMIMPVGAPSFSEALRWG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            EVFH LKK L  +G ST VGDEGGF+P  +  + A++ +  +I  AGY  GKD+ +ALD
Sbjct: 183 TEVFHNLKKILHDRGLSTAVGDEGGFAPTFEGTEDAIETVLKAISAAGYKPGKDICLALD 242

Query: 241 CAASAFFKKEKY---ILKGENLELQP-NEMASYLANLVDQYPIYSIEDGMSEDDWHGWKI 296
           CA+S FFK  KY     +G    ++   +   YLA L ++YPI SIEDGM+EDDW GWK+
Sbjct: 243 CASSEFFKSNKYDYTKFEGAKGAVRTIEQQVDYLAELTEKYPIISIEDGMAEDDWKGWKL 302

Query: 297 LTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAG 356
           LT+KIG   QLVGDDLFVTN +RL +GI++   N+IL+K NQIGS++ET+N +  AQ +G
Sbjct: 303 LTDKIGDRVQLVGDDLFVTNTKRLQQGIDQHTGNSILVKVNQIGSLTETINAVSLAQTSG 362

Query: 357 YPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFA 416
           Y S++SHRSGETED TIADLAVA NCGQIKTGS +RSDRIAKYNQL+RIEE LG  A+F 
Sbjct: 363 YTSVMSHRSGETEDTTIADLAVALNCGQIKTGSASRSDRIAKYNQLLRIEEELGANARFI 422

Query: 417 GR 418
           G+
Sbjct: 423 GK 424


>gi|310829935|ref|YP_003962292.1| phosphopyruvate hydratase [Eubacterium limosum KIST612]
 gi|308741669|gb|ADO39329.1| phosphopyruvate hydratase [Eubacterium limosum KIST612]
          Length = 431

 Score =  528 bits (1359), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 259/419 (61%), Positives = 325/419 (77%), Gaps = 4/419 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGK 60
           +I DI+AREV+DSRG+PTIEVDV LEDGS GR+MVPSGASTG  EA ELRD  + RY GK
Sbjct: 4   YIEDIMAREVLDSRGNPTIEVDVYLEDGSMGRSMVPSGASTGAFEAVELRDGDDSRYMGK 63

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN  +   L+G DA DQ+ +D+ MI +DGTPNK ++GANAILG+S+A + AA
Sbjct: 64  GVLKAVENVN-YMAEHLVGMDALDQVALDEAMIAIDGTPNKGKMGANAILGISMANAYAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A++  LPL++YLGG +   LP P+MNILNGG HADN +D QEFMIMPVGA+N  EA+RMG
Sbjct: 123 AESLGLPLFRYLGGVNGKTLPTPMMNILNGGEHADNNVDIQEFMIMPVGAKNFSEALRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           +E+FH LKK L+ KG  T+VGDEGGF+PNL++ + AL+ I   I+ AGY  G D+ +A+D
Sbjct: 183 SEIFHNLKKVLQKKGLVTSVGDEGGFAPNLESNEEALEAIIEGIQAAGYRPGDDVRLAMD 242

Query: 241 CAASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILT 298
            AAS  + KE  KYILKGE  EL  +EM  +   L+ +YPI SIEDG+ E+DW GWKI+T
Sbjct: 243 VAASEMYNKESGKYILKGEGKELTTDEMIDFYERLITKYPIISIEDGLDEEDWEGWKIMT 302

Query: 299 NKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYP 358
            ++G   QLVGDDLFVTN ERL KGI+  VAN+ILIK NQIG+++ETL+ IE A+ AGY 
Sbjct: 303 ERLGKKIQLVGDDLFVTNTERLKKGIDLGVANSILIKVNQIGTLTETLDAIEMAKRAGYT 362

Query: 359 SIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           +I+SHRSGETED TIADL VA N GQIKTG+ +R+DR+AKYNQL+RIEE LG+ A + G
Sbjct: 363 AIVSHRSGETEDVTIADLVVAMNAGQIKTGAPSRTDRVAKYNQLLRIEEYLGQTAIYGG 421


>gi|254384874|ref|ZP_05000210.1| phosphopyruvate hydratase [Streptomyces sp. Mg1]
 gi|194343755|gb|EDX24721.1| phosphopyruvate hydratase [Streptomyces sp. Mg1]
          Length = 426

 Score =  528 bits (1359), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 261/418 (62%), Positives = 327/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RYFGKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYFGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATDNKGSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK L +KG ST +GDEGGF+PNL++  +ALDLI  +I++AGY  GKD+ +ALD 
Sbjct: 184 EVYHTLKKVLHTKGLSTGLGDEGGFAPNLESNRAALDLIVEAIKQAGYVPGKDIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY  +G++      EM  Y   LV  YP+ SIED + EDDW GWK LT+K+
Sbjct: 244 AASEFYKDGKYEFEGQS--RSAAEMTEYYEELVSAYPMVSIEDPLYEDDWAGWKTLTDKL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  Q+VGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GTKVQIVGDDLFVTNPERLARGIEEGSANALLVKVNQIGSLTETLDAVEMAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVA NCGQIKTG+ ARSDR+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVAVNCGQIKTGAPARSDRVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|168185505|ref|ZP_02620140.1| phosphopyruvate hydratase [Clostridium botulinum C str. Eklund]
 gi|169296577|gb|EDS78710.1| phosphopyruvate hydratase [Clostridium botulinum C str. Eklund]
          Length = 433

 Score =  528 bits (1359), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 256/418 (61%), Positives = 325/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AR+++DSRG+PT+EV+V LEDG+ GRA VPSGASTGI EA ELRD +K RY GKG
Sbjct: 7   IVDVYARQILDSRGNPTVEVEVELEDGTVGRAAVPSGASTGIFEAVELRDNDKSRYMGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ I   L+G +  DQ+ IDKIMI+LDGT NK +LGANA+LGVSLA ++AAA
Sbjct: 67  VEKAVENVNEIIADELVGLNVFDQVAIDKIMIELDGTDNKGKLGANAMLGVSLACARAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   + LY+Y+GG ++ +LPVP+MNI+NGG HADN +D QEFMIMP GA++   A+RM  
Sbjct: 127 EYLGISLYQYIGGVNSKVLPVPMMNIMNGGSHADNNVDLQEFMIMPAGAKSFSHALRMCT 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E++HTLK  LK KG ST VGDEGGF+PNL++ + A+ +I  ++EKAGY  G+++ IALD 
Sbjct: 187 EIYHTLKDILKGKGLSTGVGDEGGFAPNLESNEEAIQVIIEAVEKAGYKPGEEVFIALDP 246

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           A+S FF  E  KY LKGE  EL P EM  Y A LV++YPI SIEDGM+E+DW GWK++T 
Sbjct: 247 ASSEFFNTETNKYELKGEGRELTPAEMVEYYAKLVEKYPIISIEDGMAEEDWDGWKLMTE 306

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           K+G   QLVGDDLFVTN ERL  GI  +VAN+ILIK NQIG+++ETLNTIE A+ AGY +
Sbjct: 307 KLGGKIQLVGDDLFVTNTERLSMGIERKVANSILIKLNQIGTLTETLNTIEMAERAGYTA 366

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIADL VA N GQIKTG+ AR++R+AKYNQL+RIEE L    ++ G
Sbjct: 367 VVSHRSGETEDTTIADLVVAVNAGQIKTGAPARTERVAKYNQLLRIEEELNTMGEYRG 424


>gi|169343209|ref|ZP_02864224.1| enolase [Clostridium perfringens C str. JGS1495]
 gi|169298668|gb|EDS80747.1| enolase [Clostridium perfringens C str. JGS1495]
          Length = 431

 Score =  528 bits (1359), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 253/422 (59%), Positives = 324/422 (76%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D++AR+++DSR  PT+EV+V LEDG+ GRA VPSGASTGI+EA ELRD +K +Y GKG
Sbjct: 7   IIDVVARQILDSRCFPTVEVEVYLEDGTVGRAAVPSGASTGIYEAVELRDGDKDKYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+A VND I   ++G +  DQ  IDK +I+LDGT NK +LGANAILGVSLAV++AAA
Sbjct: 67  VEKAVANVNDTIAEEIIGLNVLDQAYIDKTLIELDGTKNKGKLGANAILGVSLAVAQAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY+Y+GG +A +LPVP+MNI+NGG HADN++D QEFMIMPVG +    A+R  A
Sbjct: 127 NYLGMPLYQYIGGVNAKVLPVPMMNIINGGSHADNSVDIQEFMIMPVGFDCFERAVRACA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LKK L SKGYST VGDEGGF+PNLK+   A+++I  +IEKAGY  GK+  IA+D 
Sbjct: 187 EVYHALKKTLNSKGYSTGVGDEGGFAPNLKSNAEAIEVILEAIEKAGYEPGKEFFIAIDA 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S ++K  KY+L+ E   L   EM  +  + V++YPI SIEDGM+E+DW GWK++T ++
Sbjct: 247 ASSEYYKDGKYVLEHEGKTLTAAEMVDFFEDWVNKYPIISIEDGMAEEDWEGWKLMTERL 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN ERL  GI + +AN+ILIK NQIG+++ETLN IE A  AGY +++
Sbjct: 307 GKKVQLVGDDLFVTNTERLKTGIEKGIANSILIKLNQIGTLTETLNAIEMANRAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQLIRI E LG+ A++ GR   
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLIRINEELGEVAEYRGRDAF 426

Query: 422 IH 423
            +
Sbjct: 427 FN 428


>gi|18310281|ref|NP_562215.1| phosphopyruvate hydratase [Clostridium perfringens str. 13]
 gi|21263576|sp|Q8XKU4|ENO_CLOPE RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|18144961|dbj|BAB81005.1| enolase [Clostridium perfringens str. 13]
          Length = 431

 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 253/422 (59%), Positives = 325/422 (77%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D++AR+++DSR  PT+EV+V LEDG+ GRA VPSGASTGI+EA ELRD +K +Y GKG
Sbjct: 7   IIDVVARQILDSRCFPTVEVEVYLEDGTVGRAAVPSGASTGIYEAVELRDGDKDKYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+A VND I   ++G +  DQ  IDK +I+LDGT NK +LGANAILGVSLAV++AAA
Sbjct: 67  VEKAVANVNDTIAEEIIGLNVLDQAYIDKTLIELDGTNNKGKLGANAILGVSLAVAQAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY+Y+GG +A +LPVP+MNI+NGG HADN++D QEFMIMPVG +    A+R  A
Sbjct: 127 NYLGMPLYQYIGGVNAKVLPVPMMNIINGGSHADNSVDIQEFMIMPVGFDCFERAVRACA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LKK L SKGYST VGDEGGF+PNLK+   A+++I  +IEKAGY  GK+  IA+D 
Sbjct: 187 EVYHALKKTLNSKGYSTGVGDEGGFAPNLKSNAEAIEVILEAIEKAGYEPGKEFFIAIDA 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S ++K  KY+L+ E   L   EM  +  + V++YPI SIEDGM+E+DW GWK++T ++
Sbjct: 247 ASSEYYKDGKYVLEHEGKTLTAAEMVDFFEDWVNKYPIISIEDGMAEEDWEGWKLMTERL 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN ERL  GI + +AN+ILIK NQIG+++ETLN IE A  AGY +++
Sbjct: 307 GKKVQLVGDDLFVTNTERLKTGIEKGIANSILIKLNQIGTLTETLNAIEMANRAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQLIRI E LG+ A++ GR+  
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLIRINEELGEVAEYRGRNAF 426

Query: 422 IH 423
            +
Sbjct: 427 FN 428


>gi|15677152|ref|NP_274305.1| phosphopyruvate hydratase [Neisseria meningitidis MC58]
 gi|13124130|sp|Q9JZ53|ENO_NEIMB RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|7226525|gb|AAF41661.1| enolase [Neisseria meningitidis MC58]
 gi|316984075|gb|EFV63053.1| phosphopyruvate hydratase [Neisseria meningitidis H44/76]
 gi|325134471|gb|EGC57116.1| phosphopyruvate hydratase [Neisseria meningitidis M13399]
 gi|325140488|gb|EGC63009.1| phosphopyruvate hydratase [Neisseria meningitidis CU385]
 gi|325144572|gb|EGC66871.1| phosphopyruvate hydratase [Neisseria meningitidis M01-240013]
 gi|325200087|gb|ADY95542.1| phosphopyruvate hydratase [Neisseria meningitidis H44/76]
 gi|325205939|gb|ADZ01392.1| phosphopyruvate hydratase [Neisseria meningitidis M04-240196]
          Length = 428

 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 320/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   SKG+ T VGDEGGF+PNL +   AL L+  + E AGY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YL  LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGRSYTNAEFAEYLEGLVNEFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GGRVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A +  ++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAADYPSKA 421


>gi|293376193|ref|ZP_06622438.1| phosphopyruvate hydratase [Turicibacter sanguinis PC909]
 gi|325838898|ref|ZP_08166704.1| phosphopyruvate hydratase [Turicibacter sp. HGF1]
 gi|292645180|gb|EFF63245.1| phosphopyruvate hydratase [Turicibacter sanguinis PC909]
 gi|325490639|gb|EGC92950.1| phosphopyruvate hydratase [Turicibacter sp. HGF1]
          Length = 429

 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 323/418 (77%), Gaps = 2/418 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
           +I D+ AREV+DSRG+PT+EV+V  E GS GRA+VPSGASTGI+EA ELRD +K RY GK
Sbjct: 3   YIVDVYAREVLDSRGNPTVEVEVTTESGSFGRALVPSGASTGIYEAVELRDGDKSRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVL A+  VND I   L+G D  DQ  ID++MI LDGT NK +LGANAILGVS+AV+ AA
Sbjct: 63  GVLNAVKNVNDIIAPELVGMDVTDQCGIDRLMIALDGTKNKGKLGANAILGVSMAVAHAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    LPLY+YLGG ++  LP P+MNI+NGG HADN +DFQEFMIMPVGA   +EAIRMG
Sbjct: 123 ADFVGLPLYRYLGGFNSKELPTPMMNIINGGEHADNNIDFQEFMIMPVGAPTFKEAIRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFH LK  L   G +T VGDEGGF+PNL++ ++A+ +I  +IEKAGY  GKD++IA+D
Sbjct: 183 AEVFHALKSVLHGMGLNTAVGDEGGFAPNLESNEAAIKVILEAIEKAGYVPGKDVMIAMD 242

Query: 241 CAASAFFKKEKYILKGENLEL-QPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
            A+S F+K  KY+L GE  ++    E+  + A L ++YPI SIEDG+ +DDW GW  LT 
Sbjct: 243 VASSEFYKDGKYVLAGEGGKVFTSEELCDFYAELCEKYPIISIEDGLDQDDWAGWDYLTK 302

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           KIG   QLVGDD FVTN ERL +GI + VAN+ILIK NQIG+++ET   IE A+ AGY +
Sbjct: 303 KIGDKVQLVGDDFFVTNTERLAEGIEKNVANSILIKVNQIGTLTETFEAIEMAKKAGYTA 362

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIAD+AVATN GQIKTGS++R+DRIAKYNQL+RIE+ LG+QA + G
Sbjct: 363 VVSHRSGETEDATIADIAVATNAGQIKTGSMSRTDRIAKYNQLLRIEDELGQQAVYNG 420


>gi|218768309|ref|YP_002342821.1| phosphopyruvate hydratase [Neisseria meningitidis Z2491]
 gi|13124126|sp|Q9JU46|ENO_NEIMA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|121052317|emb|CAM08647.1| enolase [Neisseria meningitidis Z2491]
 gi|319410554|emb|CBY90922.1| enolase (2-phosphoglycerate dehydratase; 2-phospho-D-glycerate
           hydro-lyase) [Neisseria meningitidis WUE 2594]
 gi|325130349|gb|EGC53115.1| phosphopyruvate hydratase [Neisseria meningitidis OX99.30304]
          Length = 428

 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 320/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   SKG+ T VGDEGGF+PNL +   AL L+  + E AGY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YL  LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGRSYTNAEFAEYLEGLVNEFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GGKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A +  ++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAADYPSKA 421


>gi|219850578|ref|YP_002465011.1| phosphopyruvate hydratase [Chloroflexus aggregans DSM 9485]
 gi|254783241|sp|B8GAX5|ENO_CHLAD RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|219544837|gb|ACL26575.1| Phosphopyruvate hydratase [Chloroflexus aggregans DSM 9485]
          Length = 431

 Score =  527 bits (1357), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 325/419 (77%), Gaps = 1/419 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I  IIAREV+DSRG+PTIEVDV LE G  GRA+VPSGASTG HEA ELRD +K RY GK
Sbjct: 4   LIEAIIAREVLDSRGNPTIEVDVRLESGDVGRAIVPSGASTGAHEALELRDGDKSRYNGK 63

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN++I  AL+G DA DQ+ +D  +I LDGTPNKS+LGANAILGVSLA +KAA
Sbjct: 64  GVLKAVQAVNEDIAEALIGFDAADQIALDNELIALDGTPNKSKLGANAILGVSLAAAKAA 123

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    LPLY+YLGG  AH+LPVP+MNI+NGG HA N+ DFQEFMIMPVGA++ RE +R G
Sbjct: 124 AAAFGLPLYRYLGGVYAHVLPVPMMNIMNGGQHATNSTDFQEFMIMPVGADSFREGLRWG 183

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE++H LKK +  +G+ST VGDEGGF+P+L T D+ L LI  +IEKAGY  G+ + IALD
Sbjct: 184 AEIYHALKKVIHDRGFSTTVGDEGGFAPSLPTNDAPLQLIMEAIEKAGYRPGEQIYIALD 243

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A +  ++  KY LK E   L   EM  Y  +LV++YPI SIEDG++EDDW GW++L +K
Sbjct: 244 PATTEIYEDGKYHLKREGRVLTSAEMVDYWVDLVNRYPIISIEDGLAEDDWEGWQLLRSK 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDD  VTN +RL + I+   AN+ILIK NQIGS++ETL+ I+ AQ +G+ ++
Sbjct: 304 LGHKIQLVGDDFLVTNVQRLRRAIDARAANSILIKLNQIGSLTETLSAIQLAQRSGWTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           +SHRSGE+ED TIADL VATN GQIKTG+ AR+DRIAKYNQL+RIEE LG  A++AGR+
Sbjct: 364 VSHRSGESEDVTIADLVVATNAGQIKTGAPARTDRIAKYNQLLRIEEELGSAAQYAGRN 422


>gi|149279586|ref|ZP_01885715.1| enolase [Pedobacter sp. BAL39]
 gi|149229622|gb|EDM35012.1| enolase [Pedobacter sp. BAL39]
          Length = 431

 Score =  527 bits (1357), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 260/428 (60%), Positives = 321/428 (75%), Gaps = 5/428 (1%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKR-YFGK 60
            I D+ AR+++DSRG+PTIEVDV  E+G  GRA VPSGASTG+HEA ELRD +K  Y GK
Sbjct: 3   LIIDVQARQILDSRGNPTIEVDVITENGVLGRAAVPSGASTGMHEAVELRDNDKSVYMGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+A VND+I   L G D  +Q  ID++MI LDGT NK  LGANAILGVSLAV+KAA
Sbjct: 63  GVLKAVANVNDKIADELKGVDVFEQNAIDQLMIKLDGTENKGNLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           AQ S  PLY+Y+GG +A+ILP+P+MNI+NGG H+D  + FQEFMIMPVGA +  EA+R G
Sbjct: 123 AQESRQPLYRYIGGVNANILPIPMMNIVNGGSHSDAPIAFQEFMIMPVGASSFSEALRWG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            EVFH LK  L  +G ST VGDEGGF+P     + A++ I  +IEKAGY  G+ + +A D
Sbjct: 183 TEVFHNLKAILHDRGLSTAVGDEGGFAPTFDGTEDAVETILKAIEKAGYKPGEQICLAFD 242

Query: 241 CAASAFFKKEKY---ILKGENLELQPN-EMASYLANLVDQYPIYSIEDGMSEDDWHGWKI 296
           CA+S F+K  KY     +GE   ++ + E A YLA L ++YPI SIEDGM E+DW GWK+
Sbjct: 243 CASSEFYKDGKYDYTKFEGEKGAIRTSAEQAEYLAQLTEKYPIISIEDGMDENDWEGWKL 302

Query: 297 LTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAG 356
           LT+++G   QLVGDDLFVTN  RL KGINE  AN+IL+K NQIGS++ET+N +  AQ  G
Sbjct: 303 LTDRVGDKVQLVGDDLFVTNVTRLQKGINEATANSILVKVNQIGSLTETINAVSLAQTNG 362

Query: 357 YPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFA 416
           Y S++SHRSGETED TIADLAVA NCGQIKTGS +RSDRIAKYNQL+RIEE LG  A+F 
Sbjct: 363 YTSVMSHRSGETEDTTIADLAVALNCGQIKTGSASRSDRIAKYNQLLRIEEELGSAARFI 422

Query: 417 GRSILIHQ 424
           G+    ++
Sbjct: 423 GKDFKFYK 430


>gi|73540793|ref|YP_295313.1| phosphopyruvate hydratase [Ralstonia eutropha JMP134]
 gi|119369376|sp|Q473G4|ENO_RALEJ RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|72118206|gb|AAZ60469.1| enolase [Ralstonia eutropha JMP134]
          Length = 429

 Score =  527 bits (1357), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 261/420 (62%), Positives = 326/420 (77%), Gaps = 3/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +D+ +IDLDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDRTLIDLDGTENKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  +PVP+MNI+NGG HA+N+LD QEFM+MPV A + REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQMPVPMMNIVNGGAHANNSLDIQEFMVMPVSATSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  KG ST VGDEGGF+PN  + +  L+ I  ++EKAGY  G+D+L+ALDC
Sbjct: 184 EVFHALKKILADKGMSTAVGDEGGFAPNFSSNEECLNTIVQAVEKAGYRMGEDVLLALDC 243

Query: 242 AASAFFKKEK--YILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           AAS F+ + +  Y+L+GE L+L   + A YLANL D++PI SIEDGM+E DW GWK LT+
Sbjct: 244 AASEFYHEAEDVYVLEGEGLKLSSTQFADYLANLCDKFPIVSIEDGMAEGDWDGWKTLTD 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           K+G   QLVGDDLFVTN + L +GI++ + N+ILIK NQIG+++ET   IE A+ AGY +
Sbjct: 304 KLGKRVQLVGDDLFVTNTKILKEGIDKGIGNSILIKINQIGTLTETFAAIEMAKRAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           +ISHRSGETED TIAD+AV TN GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 VISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 423


>gi|91776261|ref|YP_546017.1| phosphopyruvate hydratase [Methylobacillus flagellatus KT]
 gi|119369347|sp|Q1H011|ENO_METFK RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|91710248|gb|ABE50176.1| enolase [Methylobacillus flagellatus KT]
          Length = 427

 Score =  527 bits (1357), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 256/417 (61%), Positives = 318/417 (76%), Gaps = 1/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DIIARE+IDSRG+PT+EVDV LE G  GRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IVDIIAREIIDSRGNPTVEVDVLLESGVIGRAAVPSGASTGTKEAVELRDGDAARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VN EI  A++G D  +Q  ID+ +IDLDGT NKSRLGANAIL VS+A ++AAA
Sbjct: 64  VLQAVENVNTEITEAIIGLDVEEQSFIDQTLIDLDGTENKSRLGANAILAVSMACARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LP P+MNI+NGG HA+N++D QEFMI+P G    REA+R GA
Sbjct: 124 EESGLPLYRYLGGSGFMQLPTPMMNIINGGAHAENSVDMQEFMIIPAGLPTFREALRAGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L S+G +T VGDEGGF+P+L + ++A+  I  +I  AGY  G+D+L+ LDC
Sbjct: 184 EVFHALKKILHSEGLATTVGDEGGFAPDLPSNEAAIQYILQAITAAGYEPGRDILLGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K   Y L+ E L+L   + A YLA  VD+YPI SIEDGMSE DW GWK+LT++I
Sbjct: 244 ASSEFYKDGLYHLESEGLQLTSAQFADYLATWVDKYPIVSIEDGMSEHDWDGWKLLTDRI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN + L +GI + V N++LIK NQIG+++ET  TIE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNAKILREGIQKGVGNSVLIKVNQIGTLTETFTTIETAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           SHRSGETED TIAD++VATN  QIKTGSL+RS+RIAKYNQL+RIEE LG    +AG+
Sbjct: 364 SHRSGETEDTTIADISVATNALQIKTGSLSRSERIAKYNQLLRIEEELGDATSYAGK 420


>gi|317052278|ref|YP_004113394.1| enolase [Desulfurispirillum indicum S5]
 gi|316947362|gb|ADU66838.1| enolase [Desulfurispirillum indicum S5]
          Length = 426

 Score =  527 bits (1357), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 258/417 (61%), Positives = 317/417 (76%), Gaps = 1/417 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGK 60
           FI DI ARE++DSRG+PT+EV+V LE G  GRA VPSGASTG  EA ELRD + +RY GK
Sbjct: 3   FIEDIYAREILDSRGNPTVEVEVILESGHIGRAAVPSGASTGSREAVELRDNDTERYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV  A+  VN  +  AL G D R+Q  ID +M +LD T NKS+LGANAILGVSLA +KAA
Sbjct: 63  GVEGAVENVNTILAEALAGTDVREQAFIDNVMRELDQTENKSKLGANAILGVSLACAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A+   +PLY+Y+GG +A  LPVP+MNILNGG HADN +D QEFMIMPVGA + REA+RMG
Sbjct: 123 AEYCGMPLYRYIGGVNARTLPVPMMNILNGGSHADNNVDIQEFMIMPVGAPSFREALRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE+FH LKK L  +G ST VGDEGGF+PNL + + AL +I  +IEKAGY AG+D+ +ALD
Sbjct: 183 AEIFHALKKVLLDRGLSTAVGDEGGFAPNLASNEEALQVIMEAIEKAGYKAGEDICLALD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            AAS FFK  KY+L GE       E+  Y ++L D+YPI S+EDG+ E DW+GW ILT K
Sbjct: 243 AAASEFFKDGKYVLSGEGKTFTSEELVDYYSSLADKYPIISLEDGLDESDWNGWAILTEK 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G + Q+VGDDLFVTN   L +GI   +AN+ILIK NQIG+++ETL  IE A+ AGY  +
Sbjct: 303 LGDSIQIVGDDLFVTNTSILAEGIERGIANSILIKVNQIGTLTETLEAIEMAKRAGYTCV 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ISHRSGETED TIAD+AVATN GQIKTGS +RSDR+AKYNQL+RIEE L ++A + G
Sbjct: 363 ISHRSGETEDTTIADIAVATNAGQIKTGSASRSDRVAKYNQLLRIEEELDEEALYPG 419


>gi|82702357|ref|YP_411923.1| phosphopyruvate hydratase [Nitrosospira multiformis ATCC 25196]
 gi|119369359|sp|Q2Y9P0|ENO_NITMU RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|82410422|gb|ABB74531.1| enolase [Nitrosospira multiformis ATCC 25196]
          Length = 427

 Score =  527 bits (1357), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 253/417 (60%), Positives = 323/417 (77%), Gaps = 1/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I D+IARE++DSRG+PT+E DV LE G  GRA VPSGAS G  EA ELRD++ +RYFGKG
Sbjct: 4   IVDVIAREILDSRGNPTVEADVLLESGVLGRAAVPSGASVGTREAVELRDEDAQRYFGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EI  A++G DA DQ  ID+ +IDLDG+ NKSRLGANAIL VSLAV+KAAA
Sbjct: 64  VLKAVENVNTEISEAIMGLDAMDQAFIDRTLIDLDGSGNKSRLGANAILSVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+Y+GG  +  +PVP+MN++NGG HA+N +D QEF+I+P+GA++ REA+R GA
Sbjct: 124 EECGLPLYRYVGGAGSMSMPVPMMNVINGGAHANNNIDMQEFVIIPLGAQSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLK  L  +G  T VGDEGGF+P+L   ++AL LI  +IE AGY  G D+ I LDC
Sbjct: 184 EVFHTLKGLLDKRGMHTAVGDEGGFAPDLPNNEAALQLIVEAIENAGYLPGPDVAIGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F++  KY L+ + L L   + A YLA  +D+YPI SIEDGMSE DW GWK+LT+++
Sbjct: 244 AASEFYRDGKYHLESDGLALDSTQFADYLATWIDKYPIISIEDGMSEHDWDGWKLLTSRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G + QLVGDD+FVTN   L +G+++ +AN+ILIK NQIG+++E L  IE A+ AGY +++
Sbjct: 304 GKSVQLVGDDIFVTNASILKEGVSQGIANSILIKLNQIGTLTEALYAIESAKRAGYTAVV 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           SHRSGETED TIAD+AVA+N  QIKTGSL+RSDR+AKYNQL+RIEE LG  A + GR
Sbjct: 364 SHRSGETEDTTIADIAVASNALQIKTGSLSRSDRLAKYNQLLRIEEDLGDTASYPGR 420


>gi|297157970|gb|ADI07682.1| phosphopyruvate hydratase [Streptomyces bingchenggensis BCW-1]
          Length = 431

 Score =  527 bits (1357), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 326/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEALELRDGDKSRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD TP+KS LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATPDKSSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R G 
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGT 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLK  LK +G ST +GDEGGF+PNL +   ALDLI  +I+KAGY  G+D+ +ALD 
Sbjct: 184 EVYHTLKSVLKERGLSTGLGDEGGFAPNLNSNRDALDLIVEAIKKAGYQPGQDIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G+       EM +Y A LVD YP+ SIED ++E+DW GWK +T+++
Sbjct: 244 AASEFYKDGAYTFEGQT--RSAAEMTAYYAELVDAYPLVSIEDPLNEEDWDGWKTITDQL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI    ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GDKVQLVGDDLFVTNPERLARGIESGTANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|299067180|emb|CBJ38376.1| enolase, phosphopyruvate hydratase [Ralstonia solanacearum CMR15]
          Length = 427

 Score =  526 bits (1356), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 261/418 (62%), Positives = 324/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKGRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +D+ +IDLDGT NK+RLGANA L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDRTLIDLDGTDNKARLGANATLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  +PVP+MNI+NGG HA+N+LD QEFM+MPVG  + REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQMPVPMMNIVNGGAHANNSLDIQEFMVMPVGQPSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK +  KG ST VGDEGGF+PN  + +  L+ I ++IEKAGY  G+D+L+ALDC
Sbjct: 184 EIFHALKKIIADKGMSTAVGDEGGFAPNFASNEECLNTILSAIEKAGYRPGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F++  KY L GE L+L   + A+YLANL D++PI SIEDGM E DW GWK+LT K+
Sbjct: 244 AASEFYRDGKYHLDGEGLQLSSEDFANYLANLADKFPIVSIEDGMHESDWDGWKVLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GNKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV TN GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|302534864|ref|ZP_07287206.1| phosphopyruvate hydratase [Streptomyces sp. C]
 gi|302443759|gb|EFL15575.1| phosphopyruvate hydratase [Streptomyces sp. C]
          Length = 426

 Score =  526 bits (1356), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 328/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATDNKGSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK L +KG ST +GDEGGF+PNL++  +ALDLI  +I++AGY  GKD+ +ALD 
Sbjct: 184 EVYHTLKKVLHNKGLSTGLGDEGGFAPNLESNRAALDLIIEAIKQAGYTPGKDIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY  +G++      EM  Y A LV+ YP+ SIED + EDDW GWK +T+++
Sbjct: 244 AASEFYKDGKYEFEGQSRSAA--EMTDYYAELVEAYPLVSIEDPLFEDDWAGWKTITDRL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  Q+VGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GSKVQIVGDDLFVTNPERLARGIEEGSANALLVKVNQIGSLTETLDAVEMAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVA NCGQIKTG+ ARSDR+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVAVNCGQIKTGAPARSDRVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|284048294|ref|YP_003398633.1| enolase [Acidaminococcus fermentans DSM 20731]
 gi|283952515|gb|ADB47318.1| enolase [Acidaminococcus fermentans DSM 20731]
          Length = 427

 Score =  526 bits (1356), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 259/421 (61%), Positives = 324/421 (76%), Gaps = 1/421 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I ++ ARE++DSRG+PT+EVDV L+DG+ GRA VPSGASTG+HEA ELRD +K R+ GK
Sbjct: 3   IIENVCAREIMDSRGNPTVEVDVLLDDGTVGRAAVPSGASTGVHEAVELRDGDKTRFGGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV KA+  VND I  A++G D   Q+ ID+ MI LDGTPNK RLGANAILGVSLAV+KAA
Sbjct: 63  GVSKAVDNVNDTIADAIIGLDPTRQVEIDEAMIRLDGTPNKGRLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A +  LPLY+YLGG +A  LPVP+MNILNGG HADN +D QEFMIMPVGA++  EA+R+ 
Sbjct: 123 ALSMGLPLYQYLGGVNAKELPVPMMNILNGGAHADNNVDIQEFMIMPVGADSFAEALRIN 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE++  LKK LK KG +T VGDEGGF+PNL++ + AL +I  +IEKAGY  G+ + +A+D
Sbjct: 183 AEIYQALKKVLKDKGLATAVGDEGGFAPNLESNEEALQVIVEAIEKAGYKPGEQVRLAID 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            AAS  F+  KY LKGE +     EM  + A+L ++YPI SIEDG++EDDW GWK LT+ 
Sbjct: 243 TAASELFEDGKYNLKGEGVVKTSAEMVEWYASLCEKYPIVSIEDGLAEDDWDGWKQLTDV 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN ERL KGI   VANAILIK NQIG+++ETL+ IE A+ AGY +I
Sbjct: 303 LGKKVQLVGDDLFVTNVERLKKGIEMGVANAILIKLNQIGTLTETLDAIEMAKRAGYTAI 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           +SHRSGETED TIAD+ V TN GQIK+G+  R+DR+AKYNQL+RIEE LG  A++ G  +
Sbjct: 363 VSHRSGETEDTTIADVVVGTNAGQIKSGAPCRTDRVAKYNQLLRIEEDLGAAAQYNGMDV 422

Query: 421 L 421
            
Sbjct: 423 F 423


>gi|300772700|ref|ZP_07082570.1| enolase [Sphingobacterium spiritivorum ATCC 33861]
 gi|300761003|gb|EFK57829.1| enolase [Sphingobacterium spiritivorum ATCC 33861]
          Length = 433

 Score =  526 bits (1356), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 258/422 (61%), Positives = 320/422 (75%), Gaps = 5/422 (1%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGK 60
            I D+ AR+++DSRG+PTIEVDV  ++G TGRA VPSGASTG HEA ELRD  +K+Y GK
Sbjct: 3   LIIDVRARQILDSRGNPTIEVDVTTQNGFTGRAAVPSGASTGAHEAVELRDGDKKKYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN +I  AL G D  +Q  IDK+MIDLDGT NK +LGANAILGVSLAV+KAA
Sbjct: 63  GVLKAVENVNTKIAKALEGVDVFEQNAIDKLMIDLDGTENKGKLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           AQ S  PLY+Y+GG +A+ LP+P+MNI+NGG H+D  + FQEFMIMPVGA +  EA+R G
Sbjct: 123 AQESGQPLYRYVGGVNANTLPIPMMNIINGGSHSDAPIAFQEFMIMPVGAPSFSEALRWG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            EVFH LKK L  +G ST VGDEGGF+P  +  + A++ +  +I  AGY  GKD+ +ALD
Sbjct: 183 TEVFHNLKKILHDRGLSTAVGDEGGFAPTFEGTEDAIETVLKAISAAGYKPGKDICLALD 242

Query: 241 CAASAFFKKEKY---ILKGENLELQP-NEMASYLANLVDQYPIYSIEDGMSEDDWHGWKI 296
           CA+S FFK  KY     +G    ++   +   YLA L ++YPI SIEDGM+EDDW GWK+
Sbjct: 243 CASSEFFKSNKYDYTKFEGAKGAVRTIEQQVDYLAELTEKYPIISIEDGMAEDDWKGWKL 302

Query: 297 LTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAG 356
           LT+KIG   QLVGDDLFVTN +RL +GI++   N+IL+K NQIGS++ET+N +  AQ  G
Sbjct: 303 LTDKIGDRVQLVGDDLFVTNTKRLQQGIDQHTGNSILVKVNQIGSLTETINAVSLAQTNG 362

Query: 357 YPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFA 416
           Y S++SHRSGETED TIADLAVA NCGQIKTGS +RSDRIAKYNQL+RIEE LG  A+F 
Sbjct: 363 YTSVMSHRSGETEDTTIADLAVALNCGQIKTGSASRSDRIAKYNQLLRIEEELGANARFI 422

Query: 417 GR 418
           G+
Sbjct: 423 GK 424


>gi|302551949|ref|ZP_07304291.1| phosphopyruvate hydratase [Streptomyces viridochromogenes DSM
           40736]
 gi|302469567|gb|EFL32660.1| phosphopyruvate hydratase [Streptomyces viridochromogenes DSM
           40736]
          Length = 429

 Score =  526 bits (1356), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 324/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDSNRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATDNKGSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LKSKG +T +GDEGGF+PNL +   ALDLI  +I++AGY  G+ + +ALD 
Sbjct: 184 EVYHTLKKVLKSKGLATGLGDEGGFAPNLGSNREALDLILEAIKEAGYTPGEQIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G+       EM  Y A LVD YP+ SIED + EDDW GWK +T+K+
Sbjct: 244 AASEFYKDGSYTFEGKT--RSAAEMTEYYAELVDAYPLVSIEDPLFEDDWEGWKTITDKL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GDKVQLVGDDLFVTNPERLARGIEENAANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|320106726|ref|YP_004182316.1| enolase [Terriglobus saanensis SP1PR4]
 gi|319925247|gb|ADV82322.1| enolase [Terriglobus saanensis SP1PR4]
          Length = 429

 Score =  526 bits (1356), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 262/419 (62%), Positives = 318/419 (75%), Gaps = 4/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKR-YFGKG 61
           I  I ARE++DSRG+PT+E DV L  G+ GRA VPSGASTG HEA ELRD +K  Y GKG
Sbjct: 4   IVSIHAREILDSRGNPTVEADVLLAGGALGRAAVPSGASTGEHEAVELRDGDKEHYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V++A+  V   I   L G DA +Q LID  M+ LDGTPNKSRLGANAIL VS+A ++A+A
Sbjct: 64  VMQAVENVESNISPELAGMDATNQRLIDATMLALDGTPNKSRLGANAILAVSMACARASA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+YLGG +A +LP P+MNI+NGG HADN +DFQEFMIMPVGAE   +A+R G 
Sbjct: 124 NALKLPLYRYLGGVNACVLPTPMMNIINGGAHADNNVDFQEFMIMPVGAETFSDALRWGT 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLK  LK KG  T+VGDEGGF+P+L++ + ALD+I  +IE AG+  G D+ +ALD 
Sbjct: 184 EVFHTLKGVLKKKGLQTSVGDEGGFAPSLRSNEEALDVILEAIELAGFAVGDDIALALDP 243

Query: 242 AASAFFKKEK--YIL-KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILT 298
           A+S F+ KE   Y+  K +  E    +M  Y AN V+QYPI SIEDG++EDDW GWK++T
Sbjct: 244 ASSEFYDKETGMYVFKKSDKSEKTSEQMVEYWANWVEQYPIVSIEDGLAEDDWAGWKLMT 303

Query: 299 NKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYP 358
           +K+GS CQLVGDDLFVTN +RL KGI E V N+ILIK NQIG++SETL  IE  +  GY 
Sbjct: 304 DKMGSRCQLVGDDLFVTNTKRLRKGIEEGVGNSILIKVNQIGTISETLEAIELGRRYGYT 363

Query: 359 SIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SIISHRSGETED  IADLAVATN GQIKTGSL+R+DRIAKYNQL+RIEE LG+ A+F G
Sbjct: 364 SIISHRSGETEDTFIADLAVATNAGQIKTGSLSRTDRIAKYNQLLRIEEELGQSAEFMG 422


>gi|30249043|ref|NP_841113.1| phosphopyruvate hydratase [Nitrosomonas europaea ATCC 19718]
 gi|6015097|sp|O85348|ENO_NITEU RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|3493583|gb|AAC33442.1| enolase [Nitrosomonas europaea]
 gi|30138660|emb|CAD84955.1| Enolase [Nitrosomonas europaea ATCC 19718]
          Length = 428

 Score =  526 bits (1356), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 256/418 (61%), Positives = 321/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I D+IARE+IDSRG+PTIE DV LE G  GRA VPSGAS G  EA ELRD + +RY+GKG
Sbjct: 4   IVDVIAREIIDSRGNPTIEADVLLESGVLGRASVPSGASVGTREAVELRDGDAQRYYGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EI   ++G DA +Q  IDK +I+LDG+ NKSRLGANAIL VSLAV+KAAA
Sbjct: 64  VLKAVESVNGEISETIMGLDAMEQCFIDKTLIELDGSENKSRLGANAILAVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG +A  LPVP+MN++NGG+HA+N LD QEFMI+P+G  N+REA+R GA
Sbjct: 124 EESGLPLYRYLGGINAKWLPVPMMNLVNGGVHANNRLDMQEFMIIPLGLPNLREAVRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVF TL+  L  +   T VGDEGGF+P+    + AL LI  +I++AGY  G ++ I +DC
Sbjct: 184 EVFSTLRTLLNKRNLPTTVGDEGGFAPSFARNEEALALIVQAIDEAGYQPGSEVAIGVDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S FF++ KY L  + L L   +   YLA  V++YPI SIEDGMSE DW GW +LT ++
Sbjct: 244 ASSEFFREGKYHLDVDGLGLTSAQFVDYLATWVEKYPIISIEDGMSEQDWEGWGLLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDD+FVTN   L +GI+  +AN+ILIK NQIG+++ETLN IE A+ AGY +I+
Sbjct: 304 GKTVQLVGDDVFVTNTRILKEGISRNIANSILIKINQIGTLTETLNAIEMAKCAGYTAIV 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AVATN  QIKTGSL+RSDR+AKYNQL+RIEE LG+ A++AGRS
Sbjct: 364 SHRSGETEDTTIADIAVATNALQIKTGSLSRSDRLAKYNQLLRIEEDLGEMAQYAGRS 421


>gi|118444579|ref|YP_877496.1| phosphopyruvate hydratase [Clostridium novyi NT]
 gi|134034111|sp|A0PYP4|ENO_CLONN RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|118135035|gb|ABK62079.1| enolase [Clostridium novyi NT]
          Length = 433

 Score =  526 bits (1356), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 255/418 (61%), Positives = 325/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AR+++DSRG+PT+EV+V LEDG+ GRA VPSGASTGI EA ELRD +K RY GK 
Sbjct: 7   IVDVYARQILDSRGNPTVEVEVELEDGTVGRAAVPSGASTGIFEAVELRDNDKSRYMGKS 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ I   L+G +  DQ+ +DKIMI+LDGT NK +LGANA+LGVSLA ++AAA
Sbjct: 67  VEKAVENVNEIIAEELVGLNVFDQVALDKIMIELDGTDNKGKLGANAMLGVSLACARAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   + LY+Y+GG +A +LPVP+MNI+NGG HADN +D QEFMIMP GA++   A+RM A
Sbjct: 127 EYLGISLYQYIGGVNAKVLPVPMMNIMNGGSHADNNVDLQEFMIMPAGAKSFSHALRMCA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E++HTLK  LK KG ST VGDEGGF+PNL++ + A+ +I  ++EKAGY  G+++ IALD 
Sbjct: 187 EIYHTLKNILKDKGLSTGVGDEGGFAPNLESNEEAIQVIIEAVEKAGYKPGEEVFIALDP 246

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           A+S FF  E  KY LKGE  EL P EM  Y A LV++YPI SIEDGM+E+DW GWK++T 
Sbjct: 247 ASSEFFNTETNKYELKGEGRELTPAEMVEYYAKLVEKYPIISIEDGMAEEDWDGWKLMTE 306

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           K+G   QLVGDDLFVTN +RL  GI  +VAN+ILIK NQIG+++ETLNTIE A+ AGY +
Sbjct: 307 KLGGKIQLVGDDLFVTNTKRLSMGIERKVANSILIKLNQIGTLTETLNTIEMAERAGYTA 366

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIADL VA N GQIKTG+ AR++R+AKYNQL+RIEE L    ++ G
Sbjct: 367 VVSHRSGETEDTTIADLVVAVNAGQIKTGAPARTERVAKYNQLLRIEEELNAMGEYRG 424


>gi|300312081|ref|YP_003776173.1| enolase [Herbaspirillum seropedicae SmR1]
 gi|124483346|emb|CAM32546.1| Enolase (2-Phosphoglycer(2-Phosphoglycerate dehydratase) protein
           [Herbaspirillum seropedicae]
 gi|300074866|gb|ADJ64265.1| enolase (2-Phosphoglycerate dehydratase) protein [Herbaspirillum
           seropedicae SmR1]
          Length = 427

 Score =  526 bits (1355), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 256/418 (61%), Positives = 320/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII REVIDSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RYFGKG
Sbjct: 4   IVDIIGREVIDSRGNPTVECDVLLESGVLGRAAVPSGASTGSREAIELRDGDKSRYFGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A   +N EI  A++G DA +Q  +D+ +IDLDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLQACENINTEISEAIMGLDANEQAFLDRTLIDLDGTENKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y GG  +  +PVP+MN++NGG HADN LD QEFMI+PVGA + REA+R GA
Sbjct: 124 EESGLPLYRYFGGSGSMQMPVPMMNVINGGAHADNNLDIQEFMIIPVGAPSFREALRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKK L  +G +T+VGDEGGF+PN+ + + A+ LI  +IEKAGY  G  + + LDC
Sbjct: 184 EVFHTLKKILHDRGLATSVGDEGGFAPNVSSHEEAIKLIIEAIEKAGYEPGTQIALGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS ++K   Y L GEN+ L P +    LA+  D+YPI SIEDGM+E+DW GWK+LT  +
Sbjct: 244 AASEYYKDGNYHLAGENMVLTPAQKTGLLASWCDKYPIISIEDGMAENDWAGWKLLTETL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN + L +GI++ +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTKILKEGIDKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N  QIKTGS++RSDR+AKYNQL+RIEE LG  A + GR+
Sbjct: 364 SHRSGETEDSTIADIAVGMNALQIKTGSMSRSDRMAKYNQLLRIEEDLGDIASYPGRA 421


>gi|28210138|ref|NP_781082.1| phosphopyruvate hydratase [Clostridium tetani E88]
 gi|59797631|sp|Q898R0|ENO_CLOTE RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|28202574|gb|AAO35019.1| enolase [Clostridium tetani E88]
          Length = 431

 Score =  526 bits (1355), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 258/416 (62%), Positives = 322/416 (77%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKR-YFGKG 61
           I D+ AR+V+DSR +PT+EVDV LEDG+TGRA VPSGASTGI EA ELRD +K  Y GKG
Sbjct: 7   IIDVSARQVLDSRSNPTVEVDVILEDGTTGRAAVPSGASTGIFEAVELRDGDKSVYNGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKAI  VN  I   L+G +  DQ+ IDK MI+LDGT NK +LGANA+LGVSLA +KAAA
Sbjct: 67  VLKAIENVNTIIAEELVGMNVLDQIAIDKTMIELDGTDNKGKLGANAMLGVSLACAKAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   L LY+Y+GG +A +LPVP+MNI+NGG HADN +D QEFMIMP GA +  EA+RM +
Sbjct: 127 EYLGLSLYQYIGGVNAKVLPVPMMNIINGGEHADNNVDLQEFMIMPAGASSFSEALRMCS 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H+LK  LK+KGY T VGDEGGF+PNL + + A+ +I  +IEKAGY  G ++ IALD 
Sbjct: 187 EVYHSLKSLLKAKGYDTGVGDEGGFAPNLNSNEEAIQVIVEAIEKAGYKPGVEIFIALDP 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S  F+  KY LKGE   L P EM  Y ANLV +YPI SIEDGM+E+DW GW+++T ++
Sbjct: 247 ASSEIFEDGKYNLKGEGKVLTPQEMVDYYANLVAKYPIISIEDGMAEEDWEGWRLITERL 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTN +RL  GI   VAN+ILIK NQIG+++ETLN IE A+ AGY +++
Sbjct: 307 GTKIQLVGDDLFVTNTDRLTMGIERGVANSILIKLNQIGTLTETLNAIEMAERAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQL+RIE+ LG+  ++ G
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLLRIEDELGEMGEYRG 422


>gi|297538276|ref|YP_003674045.1| enolase [Methylotenera sp. 301]
 gi|297257623|gb|ADI29468.1| enolase [Methylotenera sp. 301]
          Length = 428

 Score =  526 bits (1355), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 256/416 (61%), Positives = 316/416 (75%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DIIARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIIAREILDSRGNPTVECDVLLESGVIGRAAVPSGASTGAKEAMELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VN EI  A++G DA +Q  IDK +I+LDGT NK RLGAN+IL VS+A ++AAA
Sbjct: 64  VLQAVENVNTEITEAIIGLDAEEQSFIDKTLIELDGTENKDRLGANSILAVSMACARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG  A  LP P+MNI+NGG HADN++D QEFMI+P G  + REA+R GA
Sbjct: 124 EESGLPLYRYLGGSGAMQLPTPMMNIINGGAHADNSVDMQEFMIIPAGLPSFREAMRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  KG +T VGDEGGF+PNL + ++A+ LI  +I  AGY  GKD+ + LDC
Sbjct: 184 EVFHQLKKTLHKKGLATTVGDEGGFAPNLPSNEAAIQLILEAISVAGYEPGKDVYLGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ F+K  KY L+ E L L   +   YLA  VD+YPI SIEDGM E DW GWKILT+++
Sbjct: 244 ASTEFYKDGKYHLESEGLSLTSAQFTDYLATWVDKYPIISIEDGMGEFDWDGWKILTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN + L +GI   VAN++LIK NQIG+++ET  TIE A+ AGY +++
Sbjct: 304 GKTTQLVGDDLFVTNTKILREGIQRGVANSVLIKVNQIGTLTETFQTIEMAKRAGYTAVV 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIAD++VATN  QIKTGSL RS+RIAKYNQL+RIEE LG  + +AG
Sbjct: 364 SHRSGETEDTTIADISVATNALQIKTGSLCRSERIAKYNQLLRIEEELGDASSYAG 419


>gi|300813364|ref|ZP_07093715.1| phosphopyruvate hydratase [Peptoniphilus sp. oral taxon 836 str.
           F0141]
 gi|300512507|gb|EFK39656.1| phosphopyruvate hydratase [Peptoniphilus sp. oral taxon 836 str.
           F0141]
          Length = 428

 Score =  526 bits (1354), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 263/418 (62%), Positives = 322/418 (77%), Gaps = 2/418 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKG 61
           FI D+ AREV+DSRG+PT+EV+V  + G  GRA+VPSGASTGIHEA ELRD  K Y GKG
Sbjct: 3   FIKDVYAREVLDSRGNPTVEVEVLTDQGGFGRAIVPSGASTGIHEACELRDGGKFYNGKG 62

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ I   LL     DQ+ IDK++IDLDGT NKS+LGANAILGVSLAV++AAA
Sbjct: 63  VEKAVDNVNNIIAEELLDAYVFDQVSIDKLLIDLDGTENKSKLGANAILGVSLAVARAAA 122

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY Y+GG +A  LPVP+MNILNGG HADN +D QEFMI+PVGA++ +EA+RMGA
Sbjct: 123 DELGLPLYSYIGGVNAKTLPVPMMNILNGGAHADNNVDIQEFMILPVGAKSFKEALRMGA 182

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E +  LKKELKS G ST VGDEGGF+PNL +   ALD+I  +IE AGY AGKD+++A+D 
Sbjct: 183 ETYAALKKELKSMGLSTAVGDEGGFAPNLSSNKEALDIIVKAIESAGYKAGKDIVLAIDA 242

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           AAS F+K++  KY LKGE +     E++ Y   LV+ YPI SIEDG+SEDDW GWK LT 
Sbjct: 243 AASEFYKEKDNKYELKGEGISYDSKEISQYYKTLVETYPIVSIEDGLSEDDWQGWKYLTE 302

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
            IG   QLVGDDLFVTN +RL KGI+E+V+N+ILIK NQIG+++ETL+ IE A+     +
Sbjct: 303 LIGDKVQLVGDDLFVTNTKRLKKGIDEKVSNSILIKLNQIGTLTETLDAIELAKRYNMTA 362

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           IISHRSGETED TI+DL VATN G IKTG+ ARS+R+AKYNQL+RIE+ L    K+AG
Sbjct: 363 IISHRSGETEDTTISDLVVATNAGFIKTGAPARSERMAKYNQLLRIEDELEGAGKYAG 420


>gi|220934358|ref|YP_002513257.1| Phosphopyruvate hydratase [Thioalkalivibrio sp. HL-EbGR7]
 gi|254783277|sp|B8GQ75|ENO_THISH RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|219995668|gb|ACL72270.1| Phosphopyruvate hydratase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 426

 Score =  526 bits (1354), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 259/416 (62%), Positives = 317/416 (76%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI ARE+IDSRG+PT+E +V L  G  GRA VPSGASTG  EA ELRD + RY GKGV
Sbjct: 4   IVDIHAREIIDSRGNPTVEAEVTLASGVMGRAAVPSGASTGAREAIELRDDDVRYGGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN EIR ALLG  A D   +D  MI+LDGTPNKSRLGANA+L VS+A + A A 
Sbjct: 64  RKAVGHVNGEIREALLGMKATDLAAVDGRMIELDGTPNKSRLGANALLAVSMATAHANAA 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            + +PLY++LGG  A  LPVP+MNI+NGG HADN++D QEFMI+PVGA +I EA+R GAE
Sbjct: 124 DAGMPLYRHLGGEEAVTLPVPMMNIVNGGAHADNSVDMQEFMILPVGASSIAEAVRYGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFH LKK L  +G ST VGDEGGF+P+L + ++A+++I  +I+KAG+ AG+D+ + LDCA
Sbjct: 184 VFHALKKVLHKRGSSTAVGDEGGFAPDLPSNEAAIEVILEAIDKAGFKAGQDIWLGLDCA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           +S F K  KY+L  E           YLA  V+QYPI +IEDGM+EDDW GWK+LT K+G
Sbjct: 244 SSEFHKDGKYVLASEGKSFDAAGFVDYLAGWVNQYPILTIEDGMAEDDWAGWKLLTEKLG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTN E L +GI++ +AN+ILIK NQIG+VSETL  I  A  AGY ++IS
Sbjct: 304 GKVQLVGDDLFVTNTEILKEGIDKHIANSILIKLNQIGTVSETLAAIHMAHKAGYTAVIS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           HRSGETED TIADL+VAT  GQIKTGSL+RSDR+AKYNQLIRIEE+LG  A++AGR
Sbjct: 364 HRSGETEDVTIADLSVATQAGQIKTGSLSRSDRVAKYNQLIRIEEALGSAARYAGR 419


>gi|225025013|ref|ZP_03714205.1| hypothetical protein EIKCOROL_01902 [Eikenella corrodens ATCC
           23834]
 gi|224942243|gb|EEG23452.1| hypothetical protein EIKCOROL_01902 [Eikenella corrodens ATCC
           23834]
          Length = 428

 Score =  526 bits (1354), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 263/422 (62%), Positives = 326/422 (77%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IIDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDAARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+EI  A++G DA +Q  IDK++++LDGT NK RLGANA L VS+AV++AAA
Sbjct: 64  VLKAVEHVNNEIAQAIIGIDASEQSYIDKVLVELDGTDNKGRLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG     +PVP+MN++NGG HA+N+LD QEFMIMPVGA + REA+R GA
Sbjct: 124 EDAGLPLYRYLGGAGPMAMPVPMMNVINGGEHANNSLDIQEFMIMPVGAVSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK    KG+ T VGDEGGF+PNL +   ALDLI  +++ AGY AGKD+L+ALDC
Sbjct: 184 EVFHHLKKICHDKGFPTTVGDEGGFAPNLGSHAEALDLILEAVKAAGYEAGKDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K+ KY L  E   L   E A YLA+L ++YPI SIEDGM E+D  GWK+LTNK+
Sbjct: 244 ASSEFYKEGKYHLSAEGKALTSAEFADYLADLANRYPIVSIEDGMDENDREGWKLLTNKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI E +ANA+L+K NQIG++SETL  +E A+   Y S++
Sbjct: 304 GGKVQLVGDDLFVTNPKILAEGIKEGIANALLVKVNQIGTLSETLKAVELAKRNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE LG+ A + G++  
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELGEAAYYPGQAAF 423

Query: 422 IH 423
            H
Sbjct: 424 YH 425


>gi|116328443|ref|YP_798163.1| enolase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
 gi|116331171|ref|YP_800889.1| enolase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
 gi|122281080|sp|Q04SI9|ENO_LEPBJ RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|122283769|sp|Q050L5|ENO_LEPBL RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|116121187|gb|ABJ79230.1| Enolase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
 gi|116124860|gb|ABJ76131.1| Enolase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
          Length = 432

 Score =  526 bits (1354), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 263/420 (62%), Positives = 324/420 (77%), Gaps = 4/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I  I ARE+IDSRG+PT+EVDV L DGS GRA VPSGASTG +EA ELRD +K RY GKG
Sbjct: 7   IQKIQAREIIDSRGNPTVEVDVTLMDGSFGRAAVPSGASTGEYEAVELRDGDKQRYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN +I+  L G DA DQ  +D++M+D DGT NK +LGANAILG SLAV+KAAA
Sbjct: 67  VLKAVEHVNVKIQEILKGQDALDQNRVDQLMLDADGTKNKGKLGANAILGTSLAVAKAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             S LPLY+Y+GG  A  LPVP+MNI+NGG HADN +DFQEFMI+PVGA+N RE +RMGA
Sbjct: 127 FHSKLPLYRYIGGNFARELPVPMMNIINGGAHADNNVDFQEFMILPVGAKNFREGLRMGA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH+LK  LK K  +T VGDEGGF+P+L +   A+++I  +IEKAGY   KD+L+ LD 
Sbjct: 187 EVFHSLKSVLKGKKLNTAVGDEGGFAPDLTSNVEAIEVILQAIEKAGYKPEKDVLLGLDA 246

Query: 242 AASAFF--KKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILT 298
           A+S F+   K+KY+L  E N E    E+  Y ANLV +YPI +IEDG+ E+DW GWK+L+
Sbjct: 247 ASSEFYDKSKKKYVLGAENNKEFSSAELVDYYANLVSKYPIITIEDGLDENDWEGWKLLS 306

Query: 299 NKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYP 358
            K+G   QLVGDDLFVTN E+L KGI   V N+ILIK NQIGS+SETL +IE A+ A Y 
Sbjct: 307 EKLGKKIQLVGDDLFVTNIEKLSKGITSGVGNSILIKVNQIGSLSETLASIEMAKKAKYT 366

Query: 359 SIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           +++SHRSGETED TI+ +AVATN GQIKTGSL+R+DRIAKYN+L+RIEE LGK A + G+
Sbjct: 367 NVVSHRSGETEDVTISHIAVATNAGQIKTGSLSRTDRIAKYNELLRIEEELGKSAVYKGK 426


>gi|253996917|ref|YP_003048981.1| phosphopyruvate hydratase [Methylotenera mobilis JLW8]
 gi|253983596|gb|ACT48454.1| enolase [Methylotenera mobilis JLW8]
          Length = 428

 Score =  526 bits (1354), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 256/418 (61%), Positives = 314/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DIIARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIIAREILDSRGNPTVEADVLLESGVIGRAAVPSGASTGAKEAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VN EI  A++G DA +Q  IDK +I+LDGT NK RLGANAIL VS+A ++AAA
Sbjct: 64  VLQAVENVNTEITEAIIGLDAEEQSFIDKTLIELDGTDNKDRLGANAILAVSMACARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG  A  LP P+MNI+NGG HADN++D QEFMI+P G  + REAIR GA
Sbjct: 124 EESGLPLYRYLGGSGAMQLPTPMMNIINGGAHADNSVDMQEFMIIPAGLPSFREAIRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  KG +T VGDEGGF+PNL + +SA+  I  +I  AGY  G+D+ + LDC
Sbjct: 184 EVFHALKKTLHKKGLATTVGDEGGFAPNLPSNESAIQYILEAISDAGYEPGRDVYLGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ F+K  +Y L+ E L L   + + YLA   D+YPI SIEDGM E DW GW ILT ++
Sbjct: 244 ASTEFYKDGRYHLESEGLALTSGQFSDYLATWCDKYPIISIEDGMGEFDWEGWDILTKRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN + L +GI   VAN++LIK NQIG+++ET  TIE A+ AGY +++
Sbjct: 304 GKTTQLVGDDLFVTNTKILREGIQRGVANSVLIKVNQIGTLTETFQTIEMAKRAGYTAVV 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AVATN  QIKTGSL RS+RIAKYNQL+RIEE LG    +AG+S
Sbjct: 364 SHRSGETEDSTIADIAVATNALQIKTGSLCRSERIAKYNQLLRIEEELGDATSYAGKS 421


>gi|226354813|ref|YP_002784553.1| phosphopyruvate hydratase [Deinococcus deserti VCD115]
 gi|259645913|sp|C1CXJ3|ENO_DEIDV RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|226316803|gb|ACO44799.1| putative Enolase (2-phosphoglycerate dehydratase) (2-phospho-D-
           glycerate hydro-lyase) [Deinococcus deserti VCD115]
          Length = 422

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 250/421 (59%), Positives = 319/421 (75%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGK 60
           M I  +IAREV+DSRG+PT+E +V L+ G  GRA+VPSGASTG HEA ELRD   RY GK
Sbjct: 1   MNIEKVIAREVLDSRGNPTVEAEVHLDSGFVGRAIVPSGASTGTHEALELRDGGSRYMGK 60

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV +A+  V + +  A++G DA +Q+ ID  ++ +DGTPNK ++G NAIL VSLA S+AA
Sbjct: 61  GVQQAVRNVEEALGPAIVGLDASEQIAIDAALMAVDGTPNKGKMGGNAILAVSLATSRAA 120

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A+   +PLY+YLGG +A  LPVP+MN++NGG HADN++DFQEFM+MP+GA   REA+R G
Sbjct: 121 AEELGVPLYRYLGGSNAKTLPVPMMNLINGGAHADNSVDFQEFMVMPIGAPTFREALRYG 180

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            E FH+LKK L S+GY+TNVGDEGGF+P+LK+ + AL ++  +IEKAGY  GKD+ IALD
Sbjct: 181 TETFHSLKKVLSSRGYNTNVGDEGGFAPDLKSNEEALQVLLEAIEKAGYEPGKDIAIALD 240

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A +  +K   Y L+ E   L   EM  + A+  D+YPI SIEDG++EDDW GW+ LT K
Sbjct: 241 PAVTELYKDGHYDLESEGRTLSTAEMVDFWADWADRYPIVSIEDGLAEDDWDGWQALTTK 300

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG   QLVGDDLFVTNPERL +GI+  V NAIL+K NQIGS++E+++ IE A+   Y +I
Sbjct: 301 IGDRVQLVGDDLFVTNPERLQRGIDTGVGNAILVKVNQIGSLTESMDAIELAKRHHYGTI 360

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           ISHRSGE+ED  IADLAVATN GQIKTGS +RSDRIAKYNQL+RIE +LG +A + GR  
Sbjct: 361 ISHRSGESEDSFIADLAVATNAGQIKTGSASRSDRIAKYNQLLRIEHALGDRAVYLGRKA 420

Query: 421 L 421
           L
Sbjct: 421 L 421


>gi|257094877|ref|YP_003168518.1| phosphopyruvate hydratase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257047401|gb|ACV36589.1| Phosphopyruvate hydratase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 427

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 255/415 (61%), Positives = 317/415 (76%), Gaps = 1/415 (0%)

Query: 5   DIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKGVL 63
           D++AREV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +  RY GKGVL
Sbjct: 6   DVVAREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDSARYLGKGVL 65

Query: 64  KAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQT 123
           +A+  VN EI  A++G DA++Q  ID+ +I LDGT NK+RLGANAIL VS+AV+KAAA+ 
Sbjct: 66  QAVENVNTEISEAIIGLDAQEQAFIDQTLIHLDGTDNKARLGANAILAVSMAVAKAAAEE 125

Query: 124 SNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEV 183
           S LPLY+Y GG     +PVP+MNI+NGG HA+N+LDFQEFMI+PV   + REA+R GAEV
Sbjct: 126 SGLPLYRYFGGSGPMQMPVPMMNIVNGGEHANNSLDFQEFMILPVSQNSFREALRCGAEV 185

Query: 184 FHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAA 243
           F  LKK L  KG+ST VGDEGGF+PNL +   AL+LI ++IE AGY   +D+LI LDCAA
Sbjct: 186 FQALKKLLHKKGFSTAVGDEGGFAPNLGSHAEALELIMHAIENAGYAPAEDVLIGLDCAA 245

Query: 244 SAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGS 303
           S  ++  +Y L GENL+L  +E+  YLANL D++PI SIEDGM+E DW GWK+LT ++G 
Sbjct: 246 SELYRDGRYHLAGENLQLNSHELVDYLANLADRFPIVSIEDGMAEGDWDGWKVLTARLGK 305

Query: 304 NCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISH 363
             Q+VGDD+FVTN     +GI + + N+ILIK NQIG++SET   IE A+ AGY ++ISH
Sbjct: 306 GIQIVGDDVFVTNTRIFKEGIKQGIGNSILIKINQIGTLSETFAAIEMAKRAGYTAVISH 365

Query: 364 RSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           RSGETED TIAD+AV  N  QIKTGSL+RSDRIAKYNQL+RIEE LG  A + GR
Sbjct: 366 RSGETEDSTIADIAVGMNALQIKTGSLSRSDRIAKYNQLLRIEEDLGDTAGYPGR 420


>gi|220932415|ref|YP_002509323.1| enolase [Halothermothrix orenii H 168]
 gi|219993725|gb|ACL70328.1| enolase [Halothermothrix orenii H 168]
          Length = 428

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 256/416 (61%), Positives = 330/416 (79%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I D+ ARE++DSRG+PT+EV+V L DGS GRA VPSGASTG +EA ELRD E RY GKGV
Sbjct: 6   IVDVFAREILDSRGNPTVEVEVVLGDGSLGRAAVPSGASTGAYEAVELRDGEDRYLGKGV 65

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN+ I   L+G DARDQ+ ID++MI+LDGT NK +LGANAILGVSLAV+KAAA 
Sbjct: 66  QKAVKNVNEVIAPELIGYDARDQVDIDRLMIELDGTENKGKLGANAILGVSLAVAKAAAN 125

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            S+  L+KYLGG +A +LPVP+MNILNGG HADN +D QEFMIMPVGA N  EA+RMG+E
Sbjct: 126 ASDSYLFKYLGGVNAKVLPVPMMNILNGGEHADNNVDIQEFMIMPVGAVNFAEAMRMGSE 185

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           V+H LKK L+ +G +T +GDEGGF+P+L + + A+++I  ++EKAGY  G D+++ALD A
Sbjct: 186 VYHNLKKVLQGRGLNTAIGDEGGFAPDLGSNEEAIEVIIEAVEKAGYKPGDDIMLALDVA 245

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+  +K  KY+L+GE +E    EM  +   LVD+YPI SIEDG+SEDDW GW  LT K+G
Sbjct: 246 ATELYKDGKYVLEGEGVEKTSEEMIEFYEKLVDKYPIISIEDGLSEDDWDGWAKLTEKLG 305

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           +  QLVGDDL+VTN ERL +GI E+ +N+ILIK NQIG+++ET+  IE A+ AG+ +++S
Sbjct: 306 NKIQLVGDDLYVTNTERLSRGIEEKSSNSILIKVNQIGTLTETIEAIEMAKKAGFTAVVS 365

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           HRSGETED TI+DL VA N GQIKTG+ ARS+R+AKYNQL+RIEE LG+ A++AG+
Sbjct: 366 HRSGETEDVTISDLVVAMNTGQIKTGAPARSERVAKYNQLLRIEEVLGEAAEYAGK 421


>gi|318062700|ref|ZP_07981421.1| enolase [Streptomyces sp. SA3_actG]
 gi|318079769|ref|ZP_07987101.1| enolase [Streptomyces sp. SA3_actF]
          Length = 428

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 328/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 6   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDANRYQGKG 65

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD TP+KS LGANAILGVSLAV+ AA+
Sbjct: 66  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMSDLDATPDKSSLGANAILGVSLAVAHAAS 125

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 126 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEAVRWGA 185

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LK +G ST +GDEGGF+PNL +  +ALDLI  +I++AGY  G+D+ +ALDC
Sbjct: 186 EVYHTLKKVLKERGLSTGLGDEGGFAPNLDSNRAALDLIVEAIKEAGYVPGRDVALALDC 245

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY  +G++      EM  Y   LV  YP+ SIED + EDDW GW  +T ++
Sbjct: 246 AASEFYKDGKYRFEGQD--RTAAEMTLYYEELVGAYPLVSIEDPLFEDDWEGWATVTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI+E+ ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 304 GDKVQLVGDDLFVTNPERLQRGIDEKSANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIK+G+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 364 SHRSGETEDVTIADLAVATNCGQIKSGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 421


>gi|313677149|ref|YP_004055145.1| enolase [Marivirga tractuosa DSM 4126]
 gi|312943847|gb|ADR23037.1| enolase [Marivirga tractuosa DSM 4126]
          Length = 424

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 322/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYF-GKG 61
           I +I AR+++DSRG+PT+EV+V   +G  GRA VPSGASTGIHEA ELRD++K  F GKG
Sbjct: 4   IENIHARQILDSRGNPTVEVEVFTANGGFGRAAVPSGASTGIHEAVELRDKDKSIFMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN  I   L+G    +Q LIDKIMI+LDGT NK++LGANAILGVS+A +KAAA
Sbjct: 64  VLKAVDNVNGAIAEELIGFSVFEQNLIDKIMIELDGTDNKAKLGANAILGVSMACAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           Q S   LY+Y+GG +A+ LPVP+MNILNGG HADN +DFQEFM+MPV AE+  EA+RMG 
Sbjct: 124 QLSGQSLYRYIGGVNANTLPVPMMNILNGGSHADNKIDFQEFMVMPVNAESFSEALRMGT 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
            VFH LK+ LKSKG STNVGDEGGF+PN+++ D A++++  +IEKAG+  G+D+ IALD 
Sbjct: 184 TVFHHLKEVLKSKGLSTNVGDEGGFAPNIESNDQAIEVVLTAIEKAGFKPGEDIFIALDA 243

Query: 242 AASAFFK--KEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           AAS F+   K+KY+ +    EL  +EM +Y     D+YPI SIEDGM EDDW GW+ LT 
Sbjct: 244 AASEFYDEGKKKYVFESTGEELTSDEMVAYWKRWTDKYPILSIEDGMQEDDWEGWEKLTR 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           +IG   QLVGDDLFVTN +RL +GI+E++ N+ILIK NQIG+++ET+N I  A  A Y +
Sbjct: 304 EIGRTVQLVGDDLFVTNTKRLQRGIDEKIGNSILIKVNQIGTLTETINAIRMADKASYKN 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           IISHRSGETED  IADLAVA   GQIKTGS +RSDR+AKYNQL+RIEE LG+ A F G
Sbjct: 364 IISHRSGETEDTFIADLAVAMGSGQIKTGSASRSDRMAKYNQLLRIEEELGEMAYFPG 421


>gi|209519975|ref|ZP_03268754.1| Phosphopyruvate hydratase [Burkholderia sp. H160]
 gi|209499572|gb|EDZ99648.1| Phosphopyruvate hydratase [Burkholderia sp. H160]
          Length = 427

 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 264/418 (63%), Positives = 319/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E A YLANL D++PI SIEDGM E DW GWKILT+K+
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSTEFADYLANLADKFPIVSIEDGMHEGDWEGWKILTDKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKIQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|226939476|ref|YP_002794549.1| phosphopyruvate hydratase [Laribacter hongkongensis HLHK9]
 gi|254783255|sp|C1DCC3|ENO_LARHH RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|226714402|gb|ACO73540.1| Eno [Laribacter hongkongensis HLHK9]
          Length = 427

 Score =  525 bits (1352), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 266/422 (63%), Positives = 323/422 (76%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I D+IARE++DSRG+PT+E DV L+ G  GRA VPSGASTG  EA ELRD + +RY GKG
Sbjct: 4   IVDVIAREILDSRGNPTVECDVWLDSGVMGRAAVPSGASTGEKEALELRDGDARRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+EI  AL+G D  DQ  ID+ +++LDGT NK  LGANAIL VS+AV+KAAA
Sbjct: 64  VLKAVEHVNNEICEALIGLDPTDQAYIDQTLLELDGTDNKGSLGANAILAVSVAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+YLGG     LPVP+MN++NGG HA+N LD QEFMIMPVGA + REA+R GA
Sbjct: 124 LEVGLPLYRYLGGSGPMSLPVPMMNVINGGAHANNTLDIQEFMIMPVGARSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKK    KGYST VGDEGGF+PNL   + A+ LI  + +KAGY  G+D+LIALDC
Sbjct: 184 EIFHTLKKICADKGYSTAVGDEGGFAPNLARNEDAIKLILEATDKAGYVPGEDVLIALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L GENL L   E  +YLA L D YPI SIEDGMSE DW GWK+LT+K+
Sbjct: 244 ASSEFYKDGKYHLAGENLALSSEEFTNYLATLCDNYPIISIEDGMSEHDWAGWKLLTDKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDD+FVTNP  L +GI + + N++L+K NQIGS+SETL  ++ A+ +GY S++
Sbjct: 304 GDKVQLVGDDVFVTNPAILAEGIKQGICNSLLVKINQIGSLSETLKAVDLAKRSGYTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE LG  A + GR+  
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELGSAASYPGRAAF 423

Query: 422 IH 423
            H
Sbjct: 424 YH 425


>gi|302544806|ref|ZP_07297148.1| phosphopyruvate hydratase [Streptomyces hygroscopicus ATCC 53653]
 gi|302462424|gb|EFL25517.1| phosphopyruvate hydratase [Streptomyces himastatinicus ATCC 53653]
          Length = 426

 Score =  525 bits (1352), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 329/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEALELRDGDKNRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD TP+KS LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATPDKSSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI PVGAE+  EA+R GA
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPVGAESFSEALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLK  LK +G ST +GDEGGF+PNL +   ALDLI  +I+KAGY  G+D+ +ALD 
Sbjct: 184 EVYHTLKGVLKERGLSTGLGDEGGFAPNLDSNRDALDLIVEAIKKAGYQPGQDIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F K   Y  +G+      +EM +Y A LV+ YP+ SIED ++E+DW GWK +T ++
Sbjct: 244 AASEFHKDGVYQFEGK--ARTASEMTAYYAELVEAYPLVSIEDPLNEEDWDGWKTITEQL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI+ + ANA+L+K NQIGS++ETL+ +E AQ +G+  ++
Sbjct: 302 GDKVQLVGDDLFVTNPERLARGIDNDTANALLVKVNQIGSLTETLDAVELAQRSGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|323141819|ref|ZP_08076685.1| phosphopyruvate hydratase [Phascolarctobacterium sp. YIT 12067]
 gi|322413711|gb|EFY04564.1| phosphopyruvate hydratase [Phascolarctobacterium sp. YIT 12067]
          Length = 427

 Score =  525 bits (1352), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 266/421 (63%), Positives = 328/421 (77%), Gaps = 1/421 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I ++ ARE++DSRG+PT+EV+VCLEDG+ GRA VPSGASTG+HEA ELRD +K RY GK
Sbjct: 3   MITEVYAREILDSRGNPTVEVEVCLEDGAMGRAAVPSGASTGVHEAVELRDGDKERYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV KA+  VND I  A++G DA  Q  ID++++ LDGTPNK RLGANAILGVS+AV+KAA
Sbjct: 63  GVTKAVDNVNDIIAEAIIGLDATRQTEIDELLVRLDGTPNKGRLGANAILGVSMAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A +  LPLY YLGG +A  LPVP+MNILNGG HADN +D QEFMIMPVGA++  EA+RM 
Sbjct: 123 AASVGLPLYLYLGGVAAKELPVPMMNILNGGEHADNNVDIQEFMIMPVGAKSFSEALRMN 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE++H LK  LK KG ST +GDEGGF+PNLK    A+++I  + E+AGY  GKD+++A+D
Sbjct: 183 AEIYHNLKALLKEKGLSTALGDEGGFAPNLKCNADAIEVILEATERAGYKPGKDIVMAMD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A+S F+   KY + GE +E+   EM  YLA L ++YPI SIEDGM+EDDW GWK LT K
Sbjct: 243 VASSEFYVDGKYKMTGEGVEMTSEEMVDYLAGLCEKYPIISIEDGMAEDDWDGWKKLTKK 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN ERL +GI + VANAILIK NQIG+++ET N IE A+ AGY  I
Sbjct: 303 LGKKVQLVGDDLFVTNEERLVQGIEKGVANAILIKVNQIGTLTETFNAIETAKRAGYTCI 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           ISHRSGETED T+AD+AVA N GQIKTG+ AR+DR+AKYNQL+RIEE LGK AK+ G  +
Sbjct: 363 ISHRSGETEDTTLADIAVAVNAGQIKTGAPARTDRVAKYNQLLRIEEDLGKAAKYNGMKV 422

Query: 421 L 421
            
Sbjct: 423 F 423


>gi|291439182|ref|ZP_06578572.1| enolase [Streptomyces ghanaensis ATCC 14672]
 gi|291342077|gb|EFE69033.1| enolase [Streptomyces ghanaensis ATCC 14672]
          Length = 426

 Score =  525 bits (1351), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 322/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDANRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATDNKGSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE   EA+R G 
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAETFSEALRWGT 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LKSKG +T +GDEGGF+PNL +   ALDLI  +I +AGY  G+ + +ALD 
Sbjct: 184 EVYHTLKKVLKSKGLATGLGDEGGFAPNLGSNREALDLILEAIREAGYTPGEQIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y+ +G+  E    EM  Y A LV+ YP+ SIED + EDDW GWK +T K+
Sbjct: 244 AASEFYKDGSYVFEGK--ERSAAEMTEYYAELVEAYPLVSIEDPLFEDDWEGWKTITAKL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GDKVQLVGDDLFVTNPERLARGIEENAANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|309379217|emb|CBX22174.1| enolase [Neisseria lactamica Y92-1009]
          Length = 428

 Score =  525 bits (1351), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 256/418 (61%), Positives = 319/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVEHINNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK    KG+ T VGDEGGF+PNL +   AL L+  + E AGY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDGKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYRAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YL  LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGRSYTSAEFAEYLEGLVNEFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y  ++
Sbjct: 304 GKKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYACVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAAYYPGKA 421


>gi|269123733|ref|YP_003306310.1| enolase [Streptobacillus moniliformis DSM 12112]
 gi|268315059|gb|ACZ01433.1| enolase [Streptobacillus moniliformis DSM 12112]
          Length = 432

 Score =  525 bits (1351), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 260/421 (61%), Positives = 330/421 (78%), Gaps = 5/421 (1%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I ++ ARE++DSRG+PT+EV+V LE G+ GRA VPSGASTGIHEA ELRD +K RY GK
Sbjct: 3   IIENVYAREILDSRGNPTVEVEVYLEGGAMGRASVPSGASTGIHEAVELRDGDKSRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VND I  A++G DA DQ+ IDK+MIDLDGTPNK +LGANAILGVSLAV+KAA
Sbjct: 63  GVLKAVENVNDIIAEAVIGMDALDQVAIDKLMIDLDGTPNKGKLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    LPLY+YLGG +A  LPVP+MNILNGG HAD+A+D QEFM+ PVGA+  REA+RMG
Sbjct: 123 ANQLGLPLYRYLGGVNAKELPVPMMNILNGGSHADSAVDVQEFMVQPVGAKTYREALRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSP-NLKTADSALDLIANSIEKAGYNAGKDLLIAL 239
           AE+FH L K LK+ G STNVG+EGG++P  +   + ALD+I+ +++ AGY  GKD+  AL
Sbjct: 183 AEIFHHLGKLLKANGDSTNVGNEGGYAPAKINGTEGALDIISEAVKAAGYELGKDITFAL 242

Query: 240 DCAASAFFKKE--KYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKI 296
           D A+S FF  E  KY+ K E  +E    EM ++   L  +YPI SIEDG++EDDW G+K+
Sbjct: 243 DAASSEFFNSETGKYVFKREGGVERTSEEMVAWYEMLCAKYPIVSIEDGLAEDDWDGFKL 302

Query: 297 LTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAG 356
           +T K+G+  Q+VGDDLFVTN +RL +GI + +AN+ILIK NQIG+++ETL+ IE A+ AG
Sbjct: 303 MTEKLGNKIQIVGDDLFVTNTKRLEEGIKKGIANSILIKLNQIGTLTETLDAIEMAKKAG 362

Query: 357 YPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFA 416
           Y ++ISHRSGETED TIAD+AVATN GQIKTGS +R+DRIAKYNQL+RIE+ L  +A + 
Sbjct: 363 YTAVISHRSGETEDDTIADVAVATNAGQIKTGSASRTDRIAKYNQLLRIEDDLAGEALYK 422

Query: 417 G 417
           G
Sbjct: 423 G 423


>gi|46199912|ref|YP_005579.1| enolase [Thermus thermophilus HB27]
 gi|55979971|ref|YP_143268.1| phosphopyruvate hydratase [Thermus thermophilus HB8]
 gi|59797582|sp|Q72H85|ENO_THET2 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|68053536|sp|Q5SME1|ENO_THET8 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|46197539|gb|AAS81952.1| enolase [Thermus thermophilus HB27]
 gi|55771384|dbj|BAD69825.1| enolase (2-phosphoglycerate dehydratase) [Thermus thermophilus HB8]
          Length = 422

 Score =  525 bits (1351), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 256/415 (61%), Positives = 321/415 (77%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I  + AREV+DSRG PT+E +V LE G+ GRAMVPSGASTG HEA ELRD  KRY GKGV
Sbjct: 4   IVGVRAREVLDSRGFPTVEAEVELEGGARGRAMVPSGASTGTHEALELRDGGKRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            +A+  VN+ I   L+G DA DQ  +D+ M++LDGTPNK+ LGANA+L VSLAV++AAA+
Sbjct: 64  RRAVENVNERIAPELVGMDALDQEGVDRAMLELDGTPNKANLGANAVLAVSLAVARAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
              LPLY+YLGG     LPVPLMN++NGG HADN +DFQEFM++P GA +  EA+R+GAE
Sbjct: 124 ALGLPLYRYLGGVQGVTLPVPLMNVINGGKHADNRVDFQEFMLVPAGAGSFAEALRIGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFHTLK  LK KGYSTNVGDEGGF+P+L++ + A++L+  +IE+AGY  G+++ +ALD A
Sbjct: 184 VFHTLKAVLKEKGYSTNVGDEGGFAPDLRSNEEAVELLLLAIERAGYTPGQEVSLALDPA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
            S  ++  KY L+GE   L   EM ++    V++YPI SIEDG++EDDW GW++LT ++G
Sbjct: 244 TSELYRDGKYHLEGEGKVLSSEEMVAFWEAWVEKYPIRSIEDGLAEDDWEGWRLLTERLG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTNPERL  GI   VANAIL+K NQIG++SETL  I  AQ +GY ++IS
Sbjct: 304 GKVQLVGDDLFVTNPERLRAGIERGVANAILVKVNQIGTLSETLEAIRLAQRSGYRAVIS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           HRSGETED  IADLAVA N GQIKTGSL+RSDR+AKYNQL+RIEE LG+ A+F G
Sbjct: 364 HRSGETEDSFIADLAVAVNAGQIKTGSLSRSDRLAKYNQLLRIEEELGRAARFLG 418


>gi|310657956|ref|YP_003935677.1| enolase [Clostridium sticklandii DSM 519]
 gi|308824734|emb|CBH20772.1| enolase [Clostridium sticklandii]
          Length = 430

 Score =  525 bits (1351), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 252/420 (60%), Positives = 331/420 (78%), Gaps = 3/420 (0%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFG 59
           MFI+D+ ARE++DSRG+PT+EV+V LE G  GRA VPSGASTGI+EA ELRD +K RY G
Sbjct: 1   MFISDVFAREILDSRGNPTVEVEVVLESGEMGRAAVPSGASTGIYEAVELRDGDKSRYLG 60

Query: 60  KGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKA 119
           KGVL A+  VN+ I   L+G +  DQ+ ID+++I+LDGT NK +LGANAILGVS+AV KA
Sbjct: 61  KGVLNAVDNVNEIIAPELIGMNVFDQVGIDQMLIELDGTDNKGKLGANAILGVSMAVVKA 120

Query: 120 AAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRM 179
           AA+   +PL++YLGG +A +LP P+MNI+NGG HADN +D QEFM+MPVGA++  EA+RM
Sbjct: 121 AAEELGMPLFQYLGGVNAKVLPTPMMNIINGGEHADNNVDIQEFMVMPVGADSWAEALRM 180

Query: 180 GAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIAL 239
           GAE+FH+LK  LK KG +T VGDEGGF+PNL + + AL  I  +IEKAGY  G ++ IA+
Sbjct: 181 GAEIFHSLKSVLKGKGLNTAVGDEGGFAPNLGSNEEALMAIVEAIEKAGYKPGDEVKIAM 240

Query: 240 DCAASAFFK--KEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           D AAS+F+   K+KY+L GE  EL   EM ++  +LV +YPI SIEDG+ E+DW G+K++
Sbjct: 241 DAAASSFYSADKKKYVLAGEGKELTSEEMVAFYEDLVSKYPIISIEDGLDENDWDGFKLM 300

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T ++G   Q+VGDDLFVTN  +L +GI + +AN+ILIK NQIG+++ETL+ IE A+ AGY
Sbjct: 301 TERLGDKIQIVGDDLFVTNTAKLEEGIQKGIANSILIKLNQIGTITETLDAIEMAKRAGY 360

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +IISHRSGETED TIADL VA N GQIKTG+ +R+DR+AKYNQLIRIEE +G+ +++AG
Sbjct: 361 TAIISHRSGETEDTTIADLVVAVNAGQIKTGAPSRTDRVAKYNQLIRIEEMIGEVSQYAG 420


>gi|325267820|ref|ZP_08134470.1| enolase [Kingella denitrificans ATCC 33394]
 gi|324980701|gb|EGC16363.1| enolase [Kingella denitrificans ATCC 33394]
          Length = 428

 Score =  524 bits (1350), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 263/418 (62%), Positives = 324/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IIDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDTSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+ I  AL+G DA +Q  ID+IM+DLDGT NK+ LGANA L VSLAV++AAA
Sbjct: 64  VLKAVEHVNNNIAQALIGIDANEQAYIDQIMLDLDGTDNKANLGANATLAVSLAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDAGLPLYRYLGGAGPMALPVPMMNVINGGEHANNSLNIQEFMIMPVGADSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   SKG+ T VGDEGGF+PNL + + AL L+  + EKAGY AG+D+L ALDC
Sbjct: 184 EIFHNLKKLCDSKGFPTTVGDEGGFAPNLNSHEEALQLMVEATEKAGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YLA+LV +YPI SIEDGM E+DW GWK+LT+K+
Sbjct: 244 ASSEFYKDGKYHLEAEGKAYTSEEFADYLADLVAKYPIVSIEDGMDENDWAGWKLLTDKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GGKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELGDVAYYPGKS 421


>gi|169830517|ref|YP_001716499.1| phosphopyruvate hydratase [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169637361|gb|ACA58867.1| Phosphopyruvate hydratase [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 427

 Score =  524 bits (1350), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 259/423 (61%), Positives = 316/423 (74%), Gaps = 1/423 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGK 60
           FI DI ARE++DSRG+PT+EVDV L+DG+ GRA VPSGASTG  EA ELRD +  R+ G+
Sbjct: 4   FIADIFAREILDSRGNPTVEVDVILDDGTLGRAAVPSGASTGTFEAVELRDGDMHRFLGR 63

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV +A+A VN  I   + G DA DQ+ ID  +I+LDGT NKS+LGANAILGVSLAV KAA
Sbjct: 64  GVSRAVANVNAIIAPEITGADATDQVAIDTALIELDGTENKSKLGANAILGVSLAVCKAA 123

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    LPLY+YLGG  A  LPVP +NILNGG HADN LD QEFMI+PVGA     A+R G
Sbjct: 124 ANGVGLPLYRYLGGTHARELPVPQLNILNGGRHADNNLDIQEFMIVPVGASTFAGALRCG 183

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            EV+H LKK LKS+G  T VGDEGGF+P L++   ALDLI  +I  AGY  G+D+L+ALD
Sbjct: 184 VEVYHALKKVLKSRGLGTTVGDEGGFAPFLESHAQALDLILEAIRTAGYRPGEDVLLALD 243

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            AAS FF++ +Y L GEN  L   E+  Y   L+  YPI SIEDG++E+DW GW+ LT +
Sbjct: 244 AAASEFFREGRYHLAGENRTLTAGELIGYYEELIQNYPIISIEDGLAEEDWEGWRELTAR 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTNP+RL +GI  ++AN+ILIK NQIG+V+ETL TI +A+ AGY ++
Sbjct: 304 LGGRVQLVGDDLFVTNPQRLERGIASKIANSILIKVNQIGTVTETLETISRARRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           ISHRSGETED TIADLAVAT  GQIKTG+  R++R+AKYN L+RIEE LG+ A F GR  
Sbjct: 364 ISHRSGETEDVTIADLAVATGAGQIKTGAPCRTERVAKYNHLLRIEEELGETAVFRGRRN 423

Query: 421 LIH 423
             H
Sbjct: 424 FYH 426


>gi|295401521|ref|ZP_06811490.1| enolase [Geobacillus thermoglucosidasius C56-YS93]
 gi|294976433|gb|EFG52042.1| enolase [Geobacillus thermoglucosidasius C56-YS93]
          Length = 430

 Score =  524 bits (1350), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 255/418 (61%), Positives = 329/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AREV+DSRG+PT+EV+V  EDG  GRA+VPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   ILDVYAREVLDSRGNPTVEVEVYTEDGGFGRALVPSGASTGEYEAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+ I  A++G +  DQ+ IDK +I+LDGT NKS+LGANAILGVSLAV++AAA
Sbjct: 64  VLKAVENVNEVIAPAIIGLEVTDQVGIDKTLIELDGTENKSKLGANAILGVSLAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY+YLGG +A  LPVP+MNILNGG HADN +D QEFMIMPVGA++ REA+RMGA
Sbjct: 124 DELGMPLYQYLGGFNAKTLPVPMMNILNGGAHADNNVDIQEFMIMPVGAKSFREALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH+LK  LK+KGY+T VGDEGGF+PNLK+ + AL  I  +IEKAGY  G+++++A+D 
Sbjct: 184 EIFHSLKAVLKAKGYNTAVGDEGGFAPNLKSNEEALQTIIEAIEKAGYKPGEEVMLAMDV 243

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           A+S  + KE  KY L+GE +     EM ++   LV +YPI SIEDG+ E+DW G K+LT 
Sbjct: 244 ASSELYNKEDGKYHLEGEGVVRTSEEMVAWYEELVSKYPIISIEDGLDENDWEGHKLLTE 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++G   QLVGDDLFVTN ++L +GI + V N+ILIK NQIG+++ET + IE A+ AGY +
Sbjct: 304 RLGKKVQLVGDDLFVTNTKKLAEGIEKGVGNSILIKVNQIGTLTETFDAIEMAKRAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIAD+AVATN GQIKTG+ +R+DR+AKYNQL+RIE+ LG  A + G
Sbjct: 364 VVSHRSGETEDSTIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDQLGDTAIYNG 421


>gi|239930815|ref|ZP_04687768.1| phosphopyruvate hydratase [Streptomyces ghanaensis ATCC 14672]
          Length = 428

 Score =  524 bits (1350), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 322/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 6   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDANRYLGKG 65

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 66  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATDNKGSLGANAILGVSLAVAHAAS 125

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE   EA+R G 
Sbjct: 126 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAETFSEALRWGT 185

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LKSKG +T +GDEGGF+PNL +   ALDLI  +I +AGY  G+ + +ALD 
Sbjct: 186 EVYHTLKKVLKSKGLATGLGDEGGFAPNLGSNREALDLILEAIREAGYTPGEQIALALDV 245

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y+ +G+  E    EM  Y A LV+ YP+ SIED + EDDW GWK +T K+
Sbjct: 246 AASEFYKDGSYVFEGK--ERSAAEMTEYYAELVEAYPLVSIEDPLFEDDWEGWKTITAKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 304 GDKVQLVGDDLFVTNPERLARGIEENAANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 364 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 421


>gi|15894001|ref|NP_347350.1| phosphopyruvate hydratase [Clostridium acetobutylicum ATCC 824]
 gi|21263598|sp|Q97L52|ENO_CLOAB RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|15023593|gb|AAK78690.1|AE007586_7 Enolase [Clostridium acetobutylicum ATCC 824]
 gi|325508127|gb|ADZ19763.1| phosphopyruvate hydratase [Clostridium acetobutylicum EA 2018]
          Length = 431

 Score =  524 bits (1350), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 252/416 (60%), Positives = 324/416 (77%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D++AR+++DSR +PT+EV+V LEDG+ GRA VPSGASTG  EA ELRD +K +Y GK 
Sbjct: 7   IVDVMARQILDSRANPTVEVEVVLEDGTVGRASVPSGASTGQFEAVELRDNDKAQYLGKS 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  VN+ I T L+G +  DQ LID+ M+++DGT NKS+LGANA+LGVSLAV++AAA
Sbjct: 67  VLNAVDNVNETIATELIGMNVFDQTLIDQTMLEIDGTENKSKLGANAMLGVSLAVARAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   + LY+YLGG +A +LPVP+MNI+NGG HADN +DFQEFMIMP GA +  EA+R  A
Sbjct: 127 EYLGISLYQYLGGVNAKVLPVPMMNIVNGGKHADNNVDFQEFMIMPAGAPSFSEALRSCA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLK  L+SKG  T VGDEGGF+PNL + + A+ +I  ++ KAGY  GKD+ IA+D 
Sbjct: 187 EVYHTLKSLLQSKGLETAVGDEGGFAPNLNSNEEAIQIILEAVTKAGYEPGKDMFIAMDP 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ F++  KY LKGE       EM    ANLV++YPI S+EDGM+E+DW GWK+LT++I
Sbjct: 247 ASTEFYENGKYNLKGEGKVYTSEEMVEVYANLVEKYPIISLEDGMAEEDWDGWKLLTDRI 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN +RL KGI   VAN+ILIK NQIG+++ETLN IE AQ AGY +++
Sbjct: 307 GDKVQLVGDDLFVTNTKRLSKGIQLGVANSILIKLNQIGTLTETLNAIEMAQRAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TI+DL VA N GQIKTG+ AR++R+AKYNQL+RIEE LG+ A+F G
Sbjct: 367 SHRSGETEDTTISDLVVAVNAGQIKTGAPARTERVAKYNQLLRIEEELGEVAEFRG 422


>gi|83748260|ref|ZP_00945286.1| Enolase [Ralstonia solanacearum UW551]
 gi|207722864|ref|YP_002253298.1| enolase (2-phosphoglycerate dehydratase) (2-phospho-d-glycerate
           hydro-lyase) protein [Ralstonia solanacearum MolK2]
 gi|207743531|ref|YP_002259923.1| enolase (2-phosphoglycerate dehydratase) (2-phospho-d-glycerate
           hydro-lyase) protein [Ralstonia solanacearum IPO1609]
 gi|300704501|ref|YP_003746104.1| enolase, phosphopyruvate hydratase [Ralstonia solanacearum
           CFBP2957]
 gi|83725101|gb|EAP72253.1| Enolase [Ralstonia solanacearum UW551]
 gi|206588048|emb|CAQ18628.1| enolase (2-phosphoglycerate dehydratase) (2-phospho-d-glycerate
           hydro-lyase) protein [Ralstonia solanacearum MolK2]
 gi|206594929|emb|CAQ61856.1| enolase (2-phosphoglycerate dehydratase) (2-phospho-d-glycerate
           hydro-lyase) protein [Ralstonia solanacearum IPO1609]
 gi|299072165|emb|CBJ43497.1| enolase, phosphopyruvate hydratase [Ralstonia solanacearum
           CFBP2957]
          Length = 427

 Score =  524 bits (1350), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 257/418 (61%), Positives = 324/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +D+ +IDLDGT NK RLGANA L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDRTLIDLDGTENKGRLGANATLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  +PVP+MNI+NGG HA+N+LD QEFM+MPVG ++ REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQMPVPMMNIVNGGAHANNSLDIQEFMVMPVGQQSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK +  KG ST VGDEGGF+PN  + +  L+ + ++IE+AGY  G+D+L+ALDC
Sbjct: 184 EIFHALKKIISDKGMSTAVGDEGGFAPNFASNEECLNTVLSAIERAGYRPGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F++  KY L+GE L+L   + A+YLANL D++PI SIEDGM E DW GWK+LT ++
Sbjct: 244 ASSEFYRDGKYHLEGEGLQLSSVDFANYLANLADKFPIVSIEDGMHEGDWDGWKVLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKRVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV TN GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|261400672|ref|ZP_05986797.1| phosphopyruvate hydratase [Neisseria lactamica ATCC 23970]
 gi|269209582|gb|EEZ76037.1| phosphopyruvate hydratase [Neisseria lactamica ATCC 23970]
          Length = 428

 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 257/418 (61%), Positives = 319/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK    KG+ T VGDEGGF+PNL +   AL L+  + E AGY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDGKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YL  LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGRFYTSAEFAEYLEGLVNEFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y  ++
Sbjct: 304 GGKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYACVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAAYYPGKA 421


>gi|229543256|ref|ZP_04432316.1| enolase [Bacillus coagulans 36D1]
 gi|229327676|gb|EEN93351.1| enolase [Bacillus coagulans 36D1]
          Length = 431

 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 256/424 (60%), Positives = 326/424 (76%), Gaps = 4/424 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I+D+ AREV+DSRG+PT+EV+V  EDG  GRA+VPSGASTG +EA ELRD +K R+ GK
Sbjct: 3   LISDVYAREVLDSRGNPTVEVEVYTEDGGFGRALVPSGASTGEYEAVELRDNDKSRFLGK 62

Query: 61  GVLKAIAFVNDEIRTALLG-CDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKA 119
           GV  A+  VND I  A++G  D  DQ+ +DK MI+LDGTPNK +LGANAILGVSLAV++A
Sbjct: 63  GVETAVKNVNDTIAEAIIGRYDVFDQVGVDKAMIELDGTPNKGKLGANAILGVSLAVARA 122

Query: 120 AAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRM 179
           AA   +LPLYKYLGG +A  LPVP+MNILNGG HADN +D QEFMIMP GA   +EA+RM
Sbjct: 123 AANELDLPLYKYLGGFNAKQLPVPMMNILNGGAHADNNVDIQEFMIMPAGAPTFKEALRM 182

Query: 180 GAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIAL 239
           GAE+FH L+  LK+KGY+T VGDEGGF+PNLK+ + AL  I  +IEKAGY  G+ +L+A+
Sbjct: 183 GAEIFHNLRSVLKAKGYNTAVGDEGGFAPNLKSNEEALSTIIEAIEKAGYKPGEQVLLAM 242

Query: 240 DCAASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           D A+S  +  E  KY L GE   L   EM ++   L+ +YPI SIEDG+ E+DW G+K+L
Sbjct: 243 DVASSELYSDEDHKYHLAGEGKVLSAEEMVNWYEELISKYPIISIEDGLDENDWEGFKML 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T ++G   QLVGDDLFVTN E+L +GI E ++N+ILIK NQIG+++ET N IE A+ AGY
Sbjct: 303 TERLGKKVQLVGDDLFVTNTEKLARGIEEGISNSILIKVNQIGTLTETFNAIEMAKRAGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +I+SHRSGETED TIAD+AVATN GQIKTG+ +R+DR+AKYNQL+RIE+ L + A+F G
Sbjct: 363 TAIVSHRSGETEDSTIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDELAETAEFLG 422

Query: 418 RSIL 421
           +   
Sbjct: 423 KKTF 426


>gi|328882946|emb|CCA56185.1| Enolase [Streptomyces venezuelae ATCC 10712]
          Length = 428

 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 325/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 6   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYLGKG 65

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 66  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATENKGSLGANAILGVSLAVAHAAS 125

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 126 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGA 185

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E++HTLK  LK KG ST +GDEGGF+PNL++  +ALDLI  +I++AGY  G D+ +ALD 
Sbjct: 186 EIYHTLKAVLKRKGLSTGLGDEGGFAPNLESNRAALDLIVEAIKEAGYTPGSDVALALDV 245

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY  +G++      EM  Y   LV  YP+ SIED + EDDW GWK+LT+K+
Sbjct: 246 AASEFYKDGKYEFEGKS--RSAAEMTEYYEELVSAYPMVSIEDPLYEDDWAGWKVLTDKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  Q+VGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 304 GTKVQIVGDDLFVTNPERLARGIEEGTANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVA NCGQIKTG+ ARSDR+AKYNQL+RIEE L   A +AGRS
Sbjct: 364 SHRSGETEDVTIADLAVAVNCGQIKTGAPARSDRVAKYNQLLRIEEILDDAAVYAGRS 421


>gi|187924537|ref|YP_001896179.1| phosphopyruvate hydratase [Burkholderia phytofirmans PsJN]
 gi|238689580|sp|B2SXU9|ENO_BURPP RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|187715731|gb|ACD16955.1| Phosphopyruvate hydratase [Burkholderia phytofirmans PsJN]
          Length = 427

 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 263/418 (62%), Positives = 318/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGETGRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E A YLANL D++PI SIEDGM E DW GWK LT+K+
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSTEFADYLANLADKFPIVSIEDGMHESDWAGWKTLTDKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|295676922|ref|YP_003605446.1| enolase [Burkholderia sp. CCGE1002]
 gi|295436765|gb|ADG15935.1| enolase [Burkholderia sp. CCGE1002]
          Length = 427

 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 263/418 (62%), Positives = 320/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV   + REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + +  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNEECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E A YLANL D++PI SIEDGM E DW GWKILT+K+
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSTEFADYLANLADKFPIVSIEDGMHEGDWEGWKILTDKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GDKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|239828273|ref|YP_002950897.1| phosphopyruvate hydratase [Geobacillus sp. WCH70]
 gi|259645923|sp|C5D7M1|ENO_GEOSW RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|239808566|gb|ACS25631.1| enolase [Geobacillus sp. WCH70]
          Length = 430

 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 255/418 (61%), Positives = 329/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AREV+DSRG+PT+EV+V  EDG  GRA+VPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   IVDVYAREVLDSRGNPTVEVEVYTEDGGFGRALVPSGASTGEYEAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+ I  A++G +  DQ+ IDK +I+LDGT NKS+LGANAILGVSLAV++AAA
Sbjct: 64  VLKAVENVNEIIAPAIIGFEVTDQVGIDKTLIELDGTENKSKLGANAILGVSLAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
              ++PLY+YLGG +A  LPVP+MNILNGG HADN +D QEFMIMPVGA++ REA+RMGA
Sbjct: 124 DELDMPLYQYLGGFNAKTLPVPMMNILNGGAHADNNVDIQEFMIMPVGAKSFREALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH+LK  LK KGY+T VGDEGGF+PNLK+ + AL  I  +IEKAGY  G+++++A+D 
Sbjct: 184 EIFHSLKAVLKEKGYNTAVGDEGGFAPNLKSNEEALQTIIEAIEKAGYKPGEEVMLAMDV 243

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           A+S  + KE  KY L+GE +     EM ++   LV +YPI SIEDG+ E+DW G K+LT 
Sbjct: 244 ASSELYNKEDGKYHLEGEGVVKTSEEMVAWYEELVSKYPIISIEDGLDENDWEGHKLLTE 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++G   QLVGDDLFVTN ++L +GI + V N+ILIK NQIG+++ET + IE A+ AGY +
Sbjct: 304 RLGKKVQLVGDDLFVTNTKKLAEGIEKGVGNSILIKVNQIGTLTETFDAIEMAKRAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIAD+AVATN GQIKTG+ +R+DR+AKYNQL+RIE+ LG  A + G
Sbjct: 364 VVSHRSGETEDSTIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDQLGDTAIYNG 421


>gi|312109554|ref|YP_003987870.1| enolase [Geobacillus sp. Y4.1MC1]
 gi|311214655|gb|ADP73259.1| enolase [Geobacillus sp. Y4.1MC1]
          Length = 430

 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 254/418 (60%), Positives = 329/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AREV+DSRG+PT+EV++  EDG  GRA+VPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   ILDVYAREVLDSRGNPTVEVEIYTEDGGFGRALVPSGASTGEYEAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+ I  A++G +  DQ+ IDK +I+LDGT NKS+LGANAILGVSLAV++AAA
Sbjct: 64  VLKAVENVNEVIAPAIIGLEVTDQVGIDKTLIELDGTENKSKLGANAILGVSLAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY+YLGG +A  LPVP+MNILNGG HADN +D QEFMIMPVGA++ REA+RMGA
Sbjct: 124 DELGMPLYQYLGGFNAKTLPVPMMNILNGGAHADNNVDIQEFMIMPVGAKSFREALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH+LK  LK+KGY+T VGDEGGF+PNLK+ + AL  I  +IEKAGY  G+++++A+D 
Sbjct: 184 EIFHSLKAVLKAKGYNTAVGDEGGFAPNLKSNEEALQTIIEAIEKAGYKPGEEVMLAMDV 243

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           A+S  + KE  KY L+GE +     EM ++   LV +YPI SIEDG+ E+DW G K+LT 
Sbjct: 244 ASSELYNKEDGKYHLEGEGVVRTSEEMVAWYEELVSKYPIISIEDGLDENDWEGHKLLTE 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++G   QLVGDDLFVTN ++L +GI + V N+ILIK NQIG+++ET + IE A+ AGY +
Sbjct: 304 RLGKKVQLVGDDLFVTNTKKLAEGIEKGVGNSILIKVNQIGTLTETFDAIEMAKRAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIAD+AVATN GQIKTG+ +R+DR+AKYNQL+RIE+ LG  A + G
Sbjct: 364 VVSHRSGETEDSTIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDQLGDTAIYNG 421


>gi|255530613|ref|YP_003090985.1| phosphopyruvate hydratase [Pedobacter heparinus DSM 2366]
 gi|255343597|gb|ACU02923.1| enolase [Pedobacter heparinus DSM 2366]
          Length = 431

 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 262/422 (62%), Positives = 318/422 (75%), Gaps = 5/422 (1%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKR-YFGK 60
            I D+ AR+++DSRG+PTIEVDV  E+G  GRA VPSGASTGIHEA ELRD +K  Y GK
Sbjct: 3   LIIDVHARQILDSRGNPTIEVDVITENGILGRAAVPSGASTGIHEAVELRDNDKAVYMGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+A VND+I   L G D  +Q  ID ++I LDGT NK +LGANAILGVSLAV+KAA
Sbjct: 63  GVLKAVANVNDKIAAELKGVDVFEQNAIDNLLIKLDGTENKGKLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           AQ S  PLY+Y+GG +A+ LP+P+MNI+NGG H+D  + FQEFMIMPVGA +  EA+R G
Sbjct: 123 AQESRQPLYRYIGGVNANTLPIPMMNIVNGGSHSDAPIAFQEFMIMPVGASSFSEALRWG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            EVFH LKK L  +G ST VGDEGGF+P     + A++ I  +IEKAGY  GK++ +A D
Sbjct: 183 TEVFHNLKKILHDRGLSTAVGDEGGFAPTFDGTEDAVETILKAIEKAGYKPGKEICLAFD 242

Query: 241 CAASAFFKKEKY---ILKGENLELQPN-EMASYLANLVDQYPIYSIEDGMSEDDWHGWKI 296
           CAAS F+K  KY     +G    ++ + E A YLA+L ++YPI SIEDGM EDDW GWK+
Sbjct: 243 CAASEFYKDGKYDYTKFEGNKGAIRSSAEQADYLASLTEKYPIISIEDGMGEDDWDGWKL 302

Query: 297 LTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAG 356
           LT KIG   QLVGDDLFVTN +RL  GI+   AN+IL+K NQIGS++ET+N +  AQ  G
Sbjct: 303 LTEKIGDRVQLVGDDLFVTNVKRLQTGIDNHTANSILVKVNQIGSLTETINAVTLAQTNG 362

Query: 357 YPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFA 416
           Y S++SHRSGETED TIADLAVA NCGQIKTGS +RSDRIAKYNQL+RIEE LG  AKF 
Sbjct: 363 YTSVMSHRSGETEDVTIADLAVALNCGQIKTGSASRSDRIAKYNQLLRIEEELGAAAKFI 422

Query: 417 GR 418
           G+
Sbjct: 423 GK 424


>gi|332982049|ref|YP_004463490.1| enolase [Mahella australiensis 50-1 BON]
 gi|332699727|gb|AEE96668.1| enolase [Mahella australiensis 50-1 BON]
          Length = 429

 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 327/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ARE++DSRG+PT+EV+V  E G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IIDILAREILDSRGNPTVEVEVLTEGGFVGRAAVPSGASTGAFEAIELRDGDKNRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VN+ I   L+G DA DQ+ IDK+MI+LDGTPNKS+LGANAILGVSLAV+KAAA
Sbjct: 64  VLQAVDNVNNVIAPELIGMDAIDQVAIDKLMIELDGTPNKSKLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +  LPLY+Y+GG +A +LPVP+MNILNGG HADN +D QEFM+MPVGA + +EA+RM A
Sbjct: 124 ASVGLPLYQYIGGVNAKVLPVPMMNILNGGKHADNTVDIQEFMVMPVGAPSFKEALRMCA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKK L  KGYST VGDEGGF+PNLKT + A+++I  ++EKAGY AG D+ IA+D 
Sbjct: 184 EVFHTLKKVLSDKGYSTAVGDEGGFAPNLKTNEEAIEVILEAVEKAGYKAGDDIRIAIDT 243

Query: 242 AASAFF--KKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           AA+  +  K  KY   GE +     EM  +  +LVD+YPI S+EDG++E+DW GWK+LT 
Sbjct: 244 AATELYDEKDGKYHFPGEGVVRTSEEMVDFYEHLVDKYPIISLEDGVAEEDWEGWKLLTQ 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++G   QLVGDDLFVTN ERL KGI+  VAN+ILIK NQIGS++ETL+ I+ A  AGY +
Sbjct: 304 RLGKKIQLVGDDLFVTNTERLSKGIDLGVANSILIKVNQIGSLTETLDAIQMANRAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIAD+ V  N GQIKTG+ +R DR+AKYNQL+RIEE LG  A++ G
Sbjct: 364 VVSHRSGETEDTTIADIVVGVNAGQIKTGAPSRVDRVAKYNQLLRIEEMLGDTAQYLG 421


>gi|256376858|ref|YP_003100518.1| enolase [Actinosynnema mirum DSM 43827]
 gi|255921161|gb|ACU36672.1| enolase [Actinosynnema mirum DSM 43827]
          Length = 426

 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 261/417 (62%), Positives = 321/417 (76%), Gaps = 1/417 (0%)

Query: 6   IIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKGVLK 64
           +  REV+DSRG+PT+EVDV LE G+ GRA VPSGASTG  EA ELRD +K RY GKGV  
Sbjct: 7   VAGREVLDSRGNPTVEVDVELEGGALGRAAVPSGASTGTREAVELRDGDKGRYHGKGVRA 66

Query: 65  AIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTS 124
           A+  VN EI  A++G  A  Q  +D+++I+LDGT NK+RLGANA LGVSLA +KAAA   
Sbjct: 67  AVDAVNGEIAKAVVGLPAEAQSDLDRVLIELDGTDNKARLGANATLGVSLAAAKAAAAQH 126

Query: 125 NLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVF 184
            LPLY+Y+GG  AH+LP+P+MNI+NGG HADNALDFQEFMI PVGA    EA+R+G+EVF
Sbjct: 127 QLPLYRYVGGVFAHLLPMPMMNIINGGEHADNALDFQEFMIAPVGATTFAEAVRVGSEVF 186

Query: 185 HTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAAS 244
           HTL+KEL + G++TNVGDEGGF+PNL +AD AL  + N+IEK+GY  G D+ I LD AAS
Sbjct: 187 HTLRKELSAAGHNTNVGDEGGFAPNLTSADEALQFVVNAIEKSGYTPGDDVAIMLDLAAS 246

Query: 245 AFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGSN 304
            FFK   Y  KG  ++   +E  +YLA LV ++PI SIEDGM +DD  GWK LT  IG  
Sbjct: 247 EFFKGGVYDYKGAGVKRTVDEHVAYLAELVAKFPILSIEDGMDQDDTKGWKQLTEAIGDR 306

Query: 305 CQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISHR 364
            QLVGDDLF TN + L +GI + +AN+IL+K NQIG+++ETL T+E+A  + Y +++SHR
Sbjct: 307 VQLVGDDLFCTNEKLLAEGIEQGLANSILVKVNQIGTLTETLATVERAHKSAYSAVMSHR 366

Query: 365 SGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SGETED TIADLAVA NCGQIKTGSL+RSDR AKYNQLIRIEE LG QA++AGRS L
Sbjct: 367 SGETEDTTIADLAVAVNCGQIKTGSLSRSDRTAKYNQLIRIEEELGSQARYAGRSSL 423


>gi|239941813|ref|ZP_04693750.1| phosphopyruvate hydratase [Streptomyces roseosporus NRRL 15998]
 gi|239988273|ref|ZP_04708937.1| phosphopyruvate hydratase [Streptomyces roseosporus NRRL 11379]
 gi|291445260|ref|ZP_06584650.1| phosphopyruvate hydratase [Streptomyces roseosporus NRRL 15998]
 gi|291348207|gb|EFE75111.1| phosphopyruvate hydratase [Streptomyces roseosporus NRRL 15998]
          Length = 426

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 328/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYQGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK+ LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATENKASLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E++HTLKK LK+KG ST +GDEGGF+PNL++  +ALDLI  +I++AGY  G+D+ +ALD 
Sbjct: 184 EIYHTLKKVLKTKGLSTGLGDEGGFAPNLESNRAALDLIVEAIKEAGYVPGRDIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G++      EM  Y   LV  YP+ SIED + EDDW GWK++T++I
Sbjct: 244 AASEFYKDGVYEFEGKS--RSAAEMTEYYEELVSAYPLVSIEDPLYEDDWAGWKVITDRI 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  Q+VGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GSKVQIVGDDLFVTNPERLARGIEEGSANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVA NCGQIKTG+ ARSDR+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVAVNCGQIKTGAPARSDRVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|212704052|ref|ZP_03312180.1| hypothetical protein DESPIG_02105 [Desulfovibrio piger ATCC 29098]
 gi|212672557|gb|EEB33040.1| hypothetical protein DESPIG_02105 [Desulfovibrio piger ATCC 29098]
          Length = 433

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 254/415 (61%), Positives = 315/415 (75%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I  + ARE++DSRG+PT+EV+V LE G +GRA VPSGASTG  EA ELRD  KRY GKGV
Sbjct: 5   IASVYAREILDSRGNPTVEVEVSLESGHSGRAAVPSGASTGSREALELRDGGKRYGGKGV 64

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN EI  ALLG DA  Q+ +D  +IDLDGT NKSRLGANA+LGVS+A ++AA++
Sbjct: 65  TKAVENVNSEIADALLGLDALQQVQLDNTLIDLDGTDNKSRLGANAMLGVSMACARAASE 124

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
              LPLYKYLGG +A +LP P+MNI+NGG HA N LD QEFMIMP+ A++ R+A+RMG+E
Sbjct: 125 YLGLPLYKYLGGVNAKVLPAPMMNIINGGAHAPNNLDIQEFMIMPLRAQSFRDALRMGSE 184

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           +FH LKK L+  G+ T+VGDEGGF+PNLK  D A   I  +IE+AGY  G ++ +A+D A
Sbjct: 185 IFHVLKKLLEKDGHVTSVGDEGGFAPNLKNHDEAFSYIVKAIEEAGYIPGSEVALAIDAA 244

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           AS F++  KY+LKGEN      EMA +LA    +YP+ SIEDGM+E DW GW +LT  +G
Sbjct: 245 ASEFYQDGKYVLKGENKTFNNAEMAQWLAEFTSKYPLISIEDGMAESDWDGWGMLTASLG 304

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDD+FVTNP  L +GI E VAN+ILIK NQIG+V+ETL+TIE A+ A Y +++S
Sbjct: 305 ERTQLVGDDVFVTNPSILAEGIAEGVANSILIKLNQIGTVTETLDTIEMAKEAAYTTVVS 364

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           HRSGETED  IADLAV  N GQIKTGSL RS+R+AKYNQL+RIEE LG  A+F G
Sbjct: 365 HRSGETEDSFIADLAVGVNAGQIKTGSLCRSERMAKYNQLLRIEEELGDGAEFFG 419


>gi|282882237|ref|ZP_06290876.1| phosphopyruvate hydratase [Peptoniphilus lacrimalis 315-B]
 gi|281298002|gb|EFA90459.1| phosphopyruvate hydratase [Peptoniphilus lacrimalis 315-B]
          Length = 428

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 321/418 (76%), Gaps = 2/418 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKG 61
           FI D+ AREV+DSRG+PT+EV+V  + G  GRA+VPSGASTGIHEA ELRD  K Y GKG
Sbjct: 3   FIKDVYAREVLDSRGNPTVEVEVLTDQGGFGRAIVPSGASTGIHEACELRDGGKFYNGKG 62

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ I   LL     DQ+ IDK++IDLDGT NKS+LGANAILGVSLAV++AAA
Sbjct: 63  VEKAVDNVNNIIAEELLDAYVFDQVSIDKLLIDLDGTENKSKLGANAILGVSLAVARAAA 122

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY Y+GG +A  LPVP+MNILNGG HADN +D QEFMI+PVGA++ +EA+RMGA
Sbjct: 123 DELGLPLYSYIGGVNAKTLPVPMMNILNGGAHADNNVDIQEFMILPVGAKSFKEALRMGA 182

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E +  LKKELKS G ST VGDEGGF+PNL +   ALD+I  +IE AGY AGKD+++A+D 
Sbjct: 183 ETYAALKKELKSMGLSTAVGDEGGFAPNLSSNKEALDIIVKAIESAGYKAGKDIVLAIDA 242

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           AAS F+K++  KY LKGE +      ++ Y   LV+ YPI SIEDG+SEDDW GWK LT 
Sbjct: 243 AASEFYKEKDNKYELKGEGISYDSKGISQYYKTLVETYPIVSIEDGLSEDDWQGWKYLTE 302

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
            IG   QLVGDDLFVTN +RL KGI+E+V+N+ILIK NQIG+++ETL+ IE A+     +
Sbjct: 303 LIGDKVQLVGDDLFVTNTKRLKKGIDEKVSNSILIKLNQIGTLTETLDAIELAKRYNMTA 362

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           IISHRSGETED TI+DL VATN G IKTG+ ARS+R+AKYNQL+RIE+ L    K+AG
Sbjct: 363 IISHRSGETEDTTISDLVVATNAGFIKTGAPARSERMAKYNQLLRIEDELEGAGKYAG 420


>gi|326797768|ref|YP_004315587.1| Enolase [Sphingobacterium sp. 21]
 gi|326548532|gb|ADZ76917.1| Enolase [Sphingobacterium sp. 21]
          Length = 430

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 258/423 (60%), Positives = 324/423 (76%), Gaps = 5/423 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AR+++DSRG+PT+EVDV  E+G  GRA VPSGASTG+HEA ELRD +K RY GKG
Sbjct: 4   IIDVHARQILDSRGNPTVEVDVTTENGFVGRAAVPSGASTGMHEAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN +I  AL G D  +Q  IDKIMI+LDG+ NK  LGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVENVNTKIAEALRGIDVFEQNAIDKIMIELDGSENKGNLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           Q S  PLY+Y+GG +A+ LP+P+MNI+NGG H+D  + FQEFMIMPVGA +  EA+R GA
Sbjct: 124 QESRQPLYRYIGGVNANTLPIPMMNIINGGSHSDAPIAFQEFMIMPVGAPSFSEALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LK  L  +G ST VGDEGGF+P     + A++ I  +IEKAGY  G  + +ALDC
Sbjct: 184 EVFHNLKSILHDRGLSTAVGDEGGFAPTFDGTEDAIETILKAIEKAGYKPGDQICLALDC 243

Query: 242 AASAFFKKEKY---ILKGENLELQPN-EMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           A+S F+K  +Y     +G+   ++ + E A YLA L ++YPI SIEDGM+EDDW+GWK+L
Sbjct: 244 ASSEFYKDGQYDYTKFEGDKGAVRSSAEQADYLAQLTEKYPIISIEDGMAEDDWNGWKLL 303

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T KIG+  QLVGDDLFVTN +RL +GI+ + AN+IL+K NQIGS++ET++ +  AQ   Y
Sbjct: 304 TEKIGARVQLVGDDLFVTNVKRLQQGIDNDTANSILVKVNQIGSLTETIDAVSLAQTNSY 363

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            S++SHRSGETED+TIADLAVA NCGQIKTGS +RSDR+AKYNQL+RIEE LG  AKF G
Sbjct: 364 TSVMSHRSGETEDNTIADLAVALNCGQIKTGSASRSDRMAKYNQLLRIEEELGSNAKFLG 423

Query: 418 RSI 420
           +S 
Sbjct: 424 KSF 426


>gi|296136722|ref|YP_003643964.1| enolase [Thiomonas intermedia K12]
 gi|295796844|gb|ADG31634.1| enolase [Thiomonas intermedia K12]
          Length = 427

 Score =  523 bits (1346), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 252/420 (60%), Positives = 321/420 (76%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K R+ GKG
Sbjct: 4   IVDLTAREILDSRGNPTVECDVVLETGFIGRAAVPSGASTGTREAMELRDGDKSRFGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  +N EI  A++G DA +Q  +D+ +IDLDGT NKSRLGANAIL VS+AV+KA A
Sbjct: 64  VLRAVEHINTEITEAVMGLDATEQTFLDQTLIDLDGTHNKSRLGANAILAVSMAVAKAGA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + +P+Y+YLGG SA  LPVP+MN++NGG HA+N+LD QEFMIMPVGA N  EA+R GA
Sbjct: 124 EEAGMPIYQYLGGFSARELPVPMMNVINGGAHANNSLDMQEFMIMPVGAPNFHEALRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LK  L  +G  T VGDEGGF+PN+   ++AL LI  +IEKAGY  G+ + IALD 
Sbjct: 184 EVFHALKGILNDRGLPTTVGDEGGFAPNVANHEAALQLIVEAIEKAGYRPGEQIAIALDP 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+GE L L   EM  +  N + +YPI SIEDG++E DW GWK+L +++
Sbjct: 244 ASSEFYKDGKYHLEGEGLVLSTEEMVDFYDNWLGKYPIVSIEDGLAEQDWDGWKLLNSRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDD+FVTN   L  GI +++AN+ILIK NQIG+++ET   IE A+ AG+ +++
Sbjct: 304 GKKVQLVGDDIFVTNTSILKNGIADKLANSILIKVNQIGTLTETFAAIEMAKRAGWTAVV 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED  IAD+AVATN GQIKTGSL+RSDRIAKYNQL+RIEE+LG+ A+F GR + 
Sbjct: 364 SHRSGETEDSIIADIAVATNAGQIKTGSLSRSDRIAKYNQLLRIEENLGETARFLGRDVF 423


>gi|150391308|ref|YP_001321357.1| phosphopyruvate hydratase [Alkaliphilus metalliredigens QYMF]
 gi|166920116|sp|A6TU30|ENO_ALKMQ RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|149951170|gb|ABR49698.1| Phosphopyruvate hydratase [Alkaliphilus metalliredigens QYMF]
          Length = 430

 Score =  523 bits (1346), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 257/423 (60%), Positives = 328/423 (77%), Gaps = 3/423 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I+D+ AREV+DSRG+PTIEV+V LE G  GRA+VPSGASTG  EA ELRD +K RY GK
Sbjct: 3   IISDVYAREVLDSRGNPTIEVEVYLESGVLGRAIVPSGASTGAFEAVELRDGDKGRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VND I   + G DA DQ+ IDKIM+DLDGTPNK++LGANAILGVS+AV+KAA
Sbjct: 63  GVLKAVENVNDIIAPEITGLDALDQVAIDKIMLDLDGTPNKAKLGANAILGVSMAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A+  ++PL++YLGG +A  LPVP+MNILNGG HADN +D QEFM+MPVGA+  +EA+RMG
Sbjct: 123 AEALDIPLFQYLGGVNAKQLPVPMMNILNGGSHADNNVDIQEFMVMPVGAKTFKEALRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            E++H LK  LKSKG +T VGDEGGF+PNL + + AL +I  +IE AGY  G D+ +ALD
Sbjct: 183 TEIYHNLKDVLKSKGLATGVGDEGGFAPNLSSNEEALQIIMEAIEAAGYKPGVDIKLALD 242

Query: 241 CAASAFFKKEK--YILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILT 298
            AA+ F+ +++  Y L GE +     EM  +   LV +YPI SIEDG+SEDDW GW+++T
Sbjct: 243 VAATEFYDEDEKLYKLTGEGVTKTAEEMVDFYEALVKKYPIVSIEDGLSEDDWEGWRVMT 302

Query: 299 NKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYP 358
            ++G N Q+VGDDLFVTN ERL KGI  + AN+IL+K NQIG+++ETL+ IE A+ AGY 
Sbjct: 303 ERLGDNIQIVGDDLFVTNTERLKKGIQTKTANSILVKLNQIGTITETLDAIEMAKRAGYT 362

Query: 359 SIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           ++ISHRSGETED TIAD+AVA N GQIKTG+ AR+DR+AKYNQL+RIE+ LG   ++ G 
Sbjct: 363 TVISHRSGETEDATIADIAVAVNAGQIKTGAPARTDRVAKYNQLLRIEDMLGFTGQYIGN 422

Query: 419 SIL 421
            + 
Sbjct: 423 EVF 425


>gi|68536569|ref|YP_251274.1| phosphopyruvate hydratase [Corynebacterium jeikeium K411]
 gi|119369315|sp|Q4JU51|ENO_CORJK RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|68264168|emb|CAI37656.1| eno [Corynebacterium jeikeium K411]
          Length = 425

 Score =  522 bits (1345), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 330/418 (78%), Gaps = 2/418 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKG 61
            I +I ARE+IDSRG+PT+EVDV L+DGS GRA VPSGASTG+HEA ELRD  +RY GKG
Sbjct: 3   LILNIDAREIIDSRGNPTVEVDVLLDDGSFGRAAVPSGASTGVHEAHELRDGGERYQGKG 62

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  V ++I   L+G +A DQ LID++M DLDGT NKS+LGANAILGVS+AV++AAA
Sbjct: 63  VLNAVKNVIEDIDEELMGVEADDQRLIDQLMRDLDGTENKSKLGANAILGVSMAVARAAA 122

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           ++++LPL++Y+GG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE   EA+R+GA
Sbjct: 123 ESADLPLFRYVGGPNAHVLPVPMMNILNGGAHADSGVDVQEFMIAPIGAETFSEALRVGA 182

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK +K KG ST +GDEGGF+P++ +  +ALDLI  +IEKAG+  G+D+ +ALD 
Sbjct: 183 EVYHTLKKVIKDKGLSTGLGDEGGFAPSVDSTKAALDLIVEAIEKAGFKVGEDVALALDV 242

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S FFK  KY  +G   E    EMA    +L+++YPI SIED + EDDW G+  LT KI
Sbjct: 243 ASSEFFKDGKYHFEGG--EHTAEEMAKVYEDLIEEYPIVSIEDPLQEDDWEGYTALTAKI 300

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDD FVTNP+RL KGI E+ ANA+L+K NQIG+++ET + +E A   GY S++
Sbjct: 301 GDKVQLVGDDFFVTNPQRLAKGIEEKAANALLVKVNQIGTLTETFDAVELAHRNGYRSMM 360

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVA NCGQIKTG+ ARS+R+AKYNQL+RIEE LG  A +AGRS
Sbjct: 361 SHRSGETEDTTIADLAVALNCGQIKTGAPARSERVAKYNQLLRIEEILGDAAVYAGRS 418


>gi|325280936|ref|YP_004253478.1| Enolase [Odoribacter splanchnicus DSM 20712]
 gi|324312745|gb|ADY33298.1| Enolase [Odoribacter splanchnicus DSM 20712]
          Length = 430

 Score =  522 bits (1345), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 265/421 (62%), Positives = 325/421 (77%), Gaps = 5/421 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI  RE++DSRG+PT+EVDV LE+G  GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IVDITGREILDSRGNPTVEVDVTLENGVMGRAAVPSGASTGEHEALELRDGDKSRYQGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  VN  I  ALLG D  DQ  ID+++IDLDGT  KS LGANA+LGVSLA +KAAA
Sbjct: 64  VLNAVNNVNTVIADALLGFDVTDQAAIDRLLIDLDGTKTKSNLGANAMLGVSLACAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY+Y+GGC+A +LPVP+MNI+NGG H+D+ + FQEFMI PVGA+  REA+RMGA
Sbjct: 124 GALEIPLYRYIGGCNAKVLPVPMMNIINGGSHSDSPIAFQEFMIRPVGAKTFREAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLKK L  +G ST VGDEGGF+P LK  + AL+ I  +I+KAGY  G++++I LDC
Sbjct: 184 EIFHTLKKVLHDRGLSTAVGDEGGFAPTLKGTEDALESIIEAIKKAGYKPGEEVMIGLDC 243

Query: 242 AASAFFKKEKY---ILKGEN-LELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           A+S F+K + Y   I +G N  +    E   YL  L+D+YPI SIEDGM+E+DW GW++L
Sbjct: 244 ASSEFYKNDIYDYSIFEGPNGAKRTSTEQVLYLEELIDKYPIDSIEDGMAENDWDGWEML 303

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T KIG  CQLVGDDLFVTN E L KGI    AN+ILIK NQIG+++ETL+ IE AQ AGY
Sbjct: 304 TAKIGDRCQLVGDDLFVTNVEYLKKGIELGCANSILIKVNQIGTLTETLDAIEMAQRAGY 363

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            ++ SHRSGETED TIAD+AVATN GQIKTGS++RSDR+AKYNQL+RIEE LG+ A FAG
Sbjct: 364 TTVTSHRSGETEDATIADIAVATNSGQIKTGSMSRSDRMAKYNQLLRIEEELGEDAVFAG 423

Query: 418 R 418
           +
Sbjct: 424 K 424


>gi|56421589|ref|YP_148907.1| phosphopyruvate hydratase [Geobacillus kaustophilus HTA426]
 gi|261420490|ref|YP_003254172.1| phosphopyruvate hydratase [Geobacillus sp. Y412MC61]
 gi|297531307|ref|YP_003672582.1| enolase [Geobacillus sp. C56-T3]
 gi|319768161|ref|YP_004133662.1| enolase [Geobacillus sp. Y412MC52]
 gi|68053527|sp|Q5KVE7|ENO_GEOKA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|56381431|dbj|BAD77339.1| enolase (2-phosphoglycerate dehydratase) [Geobacillus kaustophilus
           HTA426]
 gi|261376947|gb|ACX79690.1| enolase [Geobacillus sp. Y412MC61]
 gi|297254559|gb|ADI28005.1| enolase [Geobacillus sp. C56-T3]
 gi|317113027|gb|ADU95519.1| enolase [Geobacillus sp. Y412MC52]
          Length = 430

 Score =  522 bits (1345), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 255/418 (61%), Positives = 327/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AREV+DSRG+PT+EV+V  EDG  GRA+VPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   IIDVYAREVLDSRGNPTVEVEVYTEDGGFGRALVPSGASTGEYEAVELRDGDKNRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+ I   ++G +  DQ+ ID+ +I+LDGT NKS+LGANAILGVSLAV++AAA
Sbjct: 64  VLKAVENVNEIIAPEIIGLEVADQVAIDRKLIELDGTENKSKLGANAILGVSLAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+YLGG +A  LPVP+MNILNGG HADN +D QEFMIMPVGAE+ REA+RMGA
Sbjct: 124 DELGLPLYQYLGGFNAKTLPVPMMNILNGGAHADNNVDIQEFMIMPVGAESFREALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH+LK  LK+KGY+T VGDEGGF+PNLK+ + AL  I  +IEKAGY  G+ +++A+D 
Sbjct: 184 EIFHSLKAVLKAKGYNTAVGDEGGFAPNLKSNEEALQTIIEAIEKAGYKPGEQVMLAMDV 243

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           A+S  + KE  KY L+GE +     EM ++   LV +YPI SIEDG+ E+DW G K+LT 
Sbjct: 244 ASSELYNKEDGKYHLEGEGVVKTSEEMVAWYEELVSKYPIISIEDGLDENDWEGHKLLTE 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++G   QLVGDDLFVTN ++L +GI + V N+ILIK NQIG+++ET + IE A+ AGY +
Sbjct: 304 RLGKKVQLVGDDLFVTNTKKLAEGIEKGVGNSILIKVNQIGTLTETFDAIEMAKRAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIAD+AVATN GQIKTG+ +R+DR+AKYNQL+RIE+ LG  A + G
Sbjct: 364 VVSHRSGETEDSTIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDELGHTAIYQG 421


>gi|282866305|ref|ZP_06275351.1| enolase [Streptomyces sp. ACTE]
 gi|282558891|gb|EFB64447.1| enolase [Streptomyces sp. ACTE]
          Length = 428

 Score =  522 bits (1345), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 327/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYQGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATENKGSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LK+KG ST +GDEGGF+PNL++  +ALDLI  ++++AGY  G+D+ +ALD 
Sbjct: 184 EVYHTLKKVLKTKGLSTGLGDEGGFAPNLESNRAALDLILEAVKEAGYVPGRDIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G++      EM  Y   LV  YP+ SIED + EDDW GWK++T+K+
Sbjct: 244 AASEFYKDGVYEFEGKS--RSAAEMTEYYEELVSAYPLVSIEDPLYEDDWAGWKVITDKL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  Q+VGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GSKVQIVGDDLFVTNPERLSRGIEEGSANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVA NCGQIKTG+ ARSDR+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVAVNCGQIKTGAPARSDRVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|302560255|ref|ZP_07312597.1| phosphopyruvate hydratase [Streptomyces griseoflavus Tu4000]
 gi|302477873|gb|EFL40966.1| phosphopyruvate hydratase [Streptomyces griseoflavus Tu4000]
          Length = 426

 Score =  522 bits (1345), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 324/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDANRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATDNKGSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R G 
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGT 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LKSKG +T +GDEGGF+PNL +   ALDLI  ++++AGY  G+ + +ALD 
Sbjct: 184 EVYHTLKKVLKSKGLATGLGDEGGFAPNLGSNREALDLILEAVKEAGYTPGEQIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G+  E    EM  Y A LV+ YP+ SIED + EDDW GWK +T K+
Sbjct: 244 AASEFYKDGVYTFEGK--ERSAAEMTEYYAELVEAYPLVSIEDPLFEDDWEGWKTITAKL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI+E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GDKVQLVGDDLFVTNPERLARGIDEGAANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|152979934|ref|YP_001352960.1| phosphopyruvate hydratase [Janthinobacterium sp. Marseille]
 gi|166232198|sp|A6SXG3|ENO_JANMA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|151280011|gb|ABR88421.1| enolase [Janthinobacterium sp. Marseille]
          Length = 427

 Score =  522 bits (1345), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 255/417 (61%), Positives = 315/417 (75%), Gaps = 1/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII REVIDSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RYFGKG
Sbjct: 4   IVDIIGREVIDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYFGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA   +N EI  A++G DA +Q  +D+ +IDLDGT NK+RLGANA L VS+AV+KAAA
Sbjct: 64  VLKACEHINTEISEAIMGLDANEQAFLDRTLIDLDGTENKARLGANATLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y GG  A  +PVP+MN++NGG HA+N LD QEFMI+PVGA + REAIR GA
Sbjct: 124 EESGLPLYRYFGGSGAMQMPVPMMNVINGGAHANNNLDLQEFMIIPVGAPSFREAIRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKK +  KG  T+VGDEGGF+P+++  ++A+ LI  +IE+AGY  G  + + LDC
Sbjct: 184 EVFHTLKKIINDKGLPTSVGDEGGFAPSVENHEAAIKLILQAIEQAGYEPGTQIALGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY L GE + L   +  + L    D+YPI SIEDGM+E+DW GW  LTN +
Sbjct: 244 AASEFYKDGKYHLAGEGMTLSSADFTNLLGTWCDKYPIISIEDGMAENDWDGWATLTNAL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN + L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTKILREGIQKNIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           SHRSGETED TIAD+AV TN  QIKTGS++RSDR+AKYNQL+RIEE LG  A + GR
Sbjct: 364 SHRSGETEDSTIADIAVGTNSLQIKTGSMSRSDRMAKYNQLLRIEEDLGDIASYPGR 420


>gi|91784228|ref|YP_559434.1| phosphopyruvate hydratase [Burkholderia xenovorans LB400]
 gi|296159011|ref|ZP_06841839.1| enolase [Burkholderia sp. Ch1-1]
 gi|119369305|sp|Q13X07|ENO_BURXL RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|91688182|gb|ABE31382.1| enolase [Burkholderia xenovorans LB400]
 gi|295890886|gb|EFG70676.1| enolase [Burkholderia sp. Ch1-1]
          Length = 427

 Score =  522 bits (1345), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 317/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E   YLANL D++PI SIEDGM E DW GWK LT+K+
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSTEFTDYLANLADKFPIVSIEDGMHESDWAGWKTLTDKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|167629687|ref|YP_001680186.1| enolase [Heliobacterium modesticaldum Ice1]
 gi|167592427|gb|ABZ84175.1| enolase [Heliobacterium modesticaldum Ice1]
          Length = 438

 Score =  522 bits (1344), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 254/417 (60%), Positives = 322/417 (77%), Gaps = 1/417 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGK 60
            I+DI ARE++DSRG+PT+EVDV L DGS GRA VPSGASTG +EA ELRD  + RY GK
Sbjct: 3   IISDIAAREILDSRGNPTLEVDVWLIDGSKGRAAVPSGASTGAYEAVELRDGDQNRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV +A+A VND I+ AL+  DA DQ  +D+ +I+LDGT NKS+LGANAILGVSLA +KA+
Sbjct: 63  GVRQAVANVNDIIKPALIQTDAADQAALDQKLIELDGTANKSKLGANAILGVSLAAAKAS 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    LPLY+Y+GG +   LPVP+MNILNGG HADN +D QEFM++PVGA +  E +RMG
Sbjct: 123 AHYFGLPLYQYVGGINGRELPVPMMNILNGGKHADNNVDIQEFMVLPVGATSFAEGLRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            E+FH+LK  LK+KG +T VGDEGGF+PNLK+ + AL +I  +IEKAGY  G+D+ + LD
Sbjct: 183 TEIFHSLKSVLKAKGLNTAVGDEGGFAPNLKSNEEALAVIVTAIEKAGYRPGEDVFLGLD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            AA+  +K  KY+L GE      +EM ++  +L  +YPI +IEDG++EDDW GW  LT  
Sbjct: 243 VAATELYKDGKYVLAGEGATCTADEMIAFYQHLASKYPIITIEDGLAEDDWEGWAKLTQA 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN ERL +GI   VANAILIK NQIG+++ETL+ IE A+ AGY ++
Sbjct: 303 LGKKLQLVGDDLFVTNTERLARGIAGNVANAILIKVNQIGTLTETLDAIELARRAGYTAV 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ISHRSGET+D TIADLAVATN GQIKTG+ +R+DR+AKYNQL+RIEE LG++A + G
Sbjct: 363 ISHRSGETDDTTIADLAVATNAGQIKTGAPSRTDRVAKYNQLLRIEEELGERACYRG 419


>gi|262066810|ref|ZP_06026422.1| phosphopyruvate hydratase [Fusobacterium periodonticum ATCC 33693]
 gi|291379476|gb|EFE86994.1| phosphopyruvate hydratase [Fusobacterium periodonticum ATCC 33693]
          Length = 434

 Score =  522 bits (1344), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 264/426 (61%), Positives = 328/426 (76%), Gaps = 7/426 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I ++I RE++DSRG+PT+EVDV LE G+ GRA VPSGASTG HEA ELRD++K RY GKG
Sbjct: 4   IVEVIGREILDSRGNPTVEVDVVLECGARGRAAVPSGASTGSHEAVELRDEDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EIR ALLG DA +Q+ IDK MI+LDGTPNK RLGANAILGVSLAVSKAAA
Sbjct: 64  VLKAVNNVNTEIREALLGMDALNQVAIDKTMIELDGTPNKGRLGANAILGVSLAVSKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +    PLYKYLGG +A  LP+P+MNILNGG HAD+A+D QEFMI PVGA++ +EA+RMGA
Sbjct: 124 EALGQPLYKYLGGVNAKELPLPMMNILNGGAHADSAVDLQEFMIQPVGAKSFQEAMRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPN-LKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           E+FH L K LK+ G STNVG+EGG++P+ ++  + AL LI+ +++ AGY  GKD+  ALD
Sbjct: 184 EIFHHLGKILKANGDSTNVGNEGGYAPSKIQGTEGALALISEAVKAAGYELGKDITFALD 243

Query: 241 CAASAFFK----KEKYILKGENLELQ-PNEMASYLANLVDQYPIYSIEDGMSEDDWHGWK 295
            A+S F K    K +Y  K E   ++  +EM  +   L+++YPI SIEDG+ EDDW GW 
Sbjct: 244 AASSEFCKEVNGKYEYHFKREGGVVRTTDEMIKWYEELINKYPIVSIEDGLGEDDWDGWV 303

Query: 296 ILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMA 355
            LT  IG   Q+VGDDLFVTN ERL KGI     N+ILIK NQIGS++ETL+ IE A+ A
Sbjct: 304 KLTKAIGDRVQIVGDDLFVTNTERLKKGIELGAGNSILIKLNQIGSLTETLDAIEMAKRA 363

Query: 356 GYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           GY +++SHRSGETED TIAD+AVATN GQIKTGS +R+DR+AKYNQL+RIEE LG  A++
Sbjct: 364 GYTAVVSHRSGETEDATIADVAVATNAGQIKTGSTSRTDRMAKYNQLLRIEEELGSVAQY 423

Query: 416 AGRSIL 421
            GR + 
Sbjct: 424 NGRDVF 429


>gi|182438232|ref|YP_001825951.1| phosphopyruvate hydratase [Streptomyces griseus subsp. griseus NBRC
           13350]
 gi|326778883|ref|ZP_08238148.1| Enolase [Streptomyces cf. griseus XylebKG-1]
 gi|178466748|dbj|BAG21268.1| putative enolase [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|326659216|gb|EGE44062.1| Enolase [Streptomyces cf. griseus XylebKG-1]
          Length = 426

 Score =  522 bits (1344), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 257/418 (61%), Positives = 328/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYQGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK+ LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATENKASLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E++HTLKK LK+KG ST +GDEGGF+PNL++  +ALDLI  +I++AGY  G+D+ +ALD 
Sbjct: 184 EIYHTLKKVLKTKGLSTGLGDEGGFAPNLESNRAALDLIVEAIKEAGYVPGRDIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G++      EM  Y   LV  YP+ SIED + EDDW GWK++T++I
Sbjct: 244 AASEFYKDGVYEFEGKS--RSAAEMTEYYEELVSAYPLVSIEDPLYEDDWAGWKVITDRI 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  Q+VGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GAKVQIVGDDLFVTNPERLARGIEEGSANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVA NCGQIKTG+ ARSDR+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVAVNCGQIKTGAPARSDRVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|227824576|ref|ZP_03989408.1| phosphopyruvate hydratase [Acidaminococcus sp. D21]
 gi|226905075|gb|EEH90993.1| phosphopyruvate hydratase [Acidaminococcus sp. D21]
          Length = 427

 Score =  522 bits (1344), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 252/421 (59%), Positives = 325/421 (77%), Gaps = 1/421 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I +I ARE++DSRG+PT+EV+V L++G  GRA VPSGASTG+HEA ELRD +K RY GK
Sbjct: 3   LIENICAREILDSRGNPTVEVEVLLDNGIIGRAAVPSGASTGVHEAVELRDGDKNRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VND I  AL+G +   Q+ ID+ ++ LDGT NK +LGANAILGVSLA +KAA
Sbjct: 63  GVLKAVDNVNDVICDALIGLEPSRQIEIDQALLSLDGTENKGKLGANAILGVSLACAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A+ + LPLY+YLGG +A  LPVP+MNILNGG HADN +D QEFM+MP+GA N  EA+RM 
Sbjct: 123 AEDTGLPLYQYLGGVNAKELPVPMMNILNGGAHADNNVDIQEFMVMPIGAVNFAEALRMN 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE++H LK  LK KG +T VGDEGGF+PNL + + AL +I ++I+KAGY  GK++++A+D
Sbjct: 183 AEIYHALKAVLKEKGLATAVGDEGGFAPNLDSNEEALAVIVDAIKKAGYKPGKEVVLAID 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            AAS   +  KY+LKGE +     EM  +   L ++YPI SIEDG+ EDDW GWK+LT++
Sbjct: 243 TAASGLLEDGKYVLKGEGVAKTSAEMVDWYEALCEKYPIISIEDGLGEDDWDGWKLLTDR 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   Q+VGDDLFVTN ERL KGI   VANAILIK NQIG+++ETL+ IE A+ AGY +I
Sbjct: 303 LGKKVQIVGDDLFVTNVERLAKGIEMGVANAILIKLNQIGTLTETLSAIEMAKRAGYTAI 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           +SHRSGETED TIAD+ V TN GQIK+G+  R+DR+AKYNQL+RIEE LG  A++ G+++
Sbjct: 363 VSHRSGETEDTTIADVVVGTNAGQIKSGAPCRTDRVAKYNQLLRIEEDLGAAAQYNGKAV 422

Query: 421 L 421
            
Sbjct: 423 F 423


>gi|227889639|ref|ZP_04007444.1| phosphopyruvate hydratase [Lactobacillus johnsonii ATCC 33200]
 gi|227849782|gb|EEJ59868.1| phosphopyruvate hydratase [Lactobacillus johnsonii ATCC 33200]
          Length = 432

 Score =  522 bits (1344), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 250/418 (59%), Positives = 318/418 (76%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI AREV+DSRG+PT+E +V  E G  GRA+VPSGASTG HEA ELRD +K R+ G+G
Sbjct: 4   ITDIHAREVLDSRGNPTVEAEVYTELGGFGRAIVPSGASTGEHEAVELRDGDKSRFLGQG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  VN EI  A++G D  DQ LID+ MIDLDGTPNK RLGANA+L VSLA ++AAA
Sbjct: 64  VLTAVENVNGEIAKAIIGLDVTDQRLIDQTMIDLDGTPNKGRLGANAMLAVSLASARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+YLGG +AH+LP P+MN++NGG HADN +D QEFMIMPVGA+++ EA+RMGA
Sbjct: 124 DELGLPLYEYLGGPNAHVLPTPMMNVINGGKHADNNVDIQEFMIMPVGAKSLHEAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E FHTLK  L+ +G ST VGDEGGF+PNLK  +   +++  +I++AGY  G+D+ IA DC
Sbjct: 184 ETFHTLKSLLQERGESTAVGDEGGFAPNLKNNEEPFEILVEAIQRAGYKPGQDISIAFDC 243

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           AAS F+ K+  KY+   +  E    E  S + ++VD+YP+ SIED + E+DW GWK+ T 
Sbjct: 244 AASEFYNKDTKKYVTVADGREYTAEEWTSLMEDIVDKYPVISIEDPLDENDWEGWKVFTE 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++G   Q+VGDDLFVTN   L KGI   VAN+ILIK NQIG+++ET   IE A+ AGY +
Sbjct: 304 RLGDKVQIVGDDLFVTNTNYLEKGIKMGVANSILIKLNQIGTLTETFEAIEMAKEAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIADL VATN GQIKTGS++R+DRIAKYNQL+RIEE+LG  A++ G
Sbjct: 364 VVSHRSGETEDTTIADLVVATNAGQIKTGSMSRTDRIAKYNQLMRIEEALGSTAQYKG 421


>gi|237743639|ref|ZP_04574120.1| enolase [Fusobacterium sp. 7_1]
 gi|256028053|ref|ZP_05441887.1| enolase [Fusobacterium sp. D11]
 gi|260495758|ref|ZP_05815880.1| phosphopyruvate hydratase [Fusobacterium sp. 3_1_33]
 gi|289765996|ref|ZP_06525374.1| enolase [Fusobacterium sp. D11]
 gi|229432670|gb|EEO42882.1| enolase [Fusobacterium sp. 7_1]
 gi|260196716|gb|EEW94241.1| phosphopyruvate hydratase [Fusobacterium sp. 3_1_33]
 gi|289717551|gb|EFD81563.1| enolase [Fusobacterium sp. D11]
          Length = 434

 Score =  522 bits (1344), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 265/432 (61%), Positives = 327/432 (75%), Gaps = 19/432 (4%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+I RE++DSRG+PT+EVDV LE G+ GRA VPSGASTG HEA ELRD++K RY GKG
Sbjct: 4   IVDVIGREILDSRGNPTVEVDVILECGAIGRAAVPSGASTGSHEAVELRDEDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EIR ALLG DA +Q+ IDKIMI+LDGT NK RLGANAILGVSLAVSKAAA
Sbjct: 64  VLKAVNNVNTEIREALLGMDALNQVAIDKIMIELDGTANKGRLGANAILGVSLAVSKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +    PLYKYLGG +A  LP+P+MNILNGG HAD+A+D QEFMI PVGA++ REA++MGA
Sbjct: 124 EALGQPLYKYLGGVNAKELPLPMMNILNGGAHADSAVDVQEFMIQPVGAKSFREAMQMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPN-LKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           EVFH L K LK+ G STNVG+EGG++P+ ++  + AL LI+ +++ AGY  GKD+  ALD
Sbjct: 184 EVFHHLGKILKANGDSTNVGNEGGYAPSKIQGTEGALSLISEAVKAAGYELGKDITFALD 243

Query: 241 CAASAF-----------FKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSED 289
            A+S F           FK+E  I++        + M  +   L+++YPI SIEDG+ ED
Sbjct: 244 AASSEFCEKVNGEYQYHFKREGGIVR------NTDAMIKWYEELINKYPIVSIEDGLGED 297

Query: 290 DWHGWKILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTI 349
           DW GW  LT  IG   Q+VGDDLFVTN ERL KGI     N+ILIK NQIGS++ETL+ I
Sbjct: 298 DWDGWVKLTQAIGDRVQIVGDDLFVTNTERLKKGIELGAGNSILIKLNQIGSLTETLDAI 357

Query: 350 EKAQMAGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESL 409
           E A+ AGY +++SHRSGETED TIAD+AVATN GQIKTGS +R+DR+AKYNQL+RIEE L
Sbjct: 358 EMAKRAGYTAVVSHRSGETEDATIADVAVATNAGQIKTGSTSRTDRMAKYNQLLRIEEEL 417

Query: 410 GKQAKFAGRSIL 421
           G  A++ GRS+ 
Sbjct: 418 GSVAQYNGRSVF 429


>gi|186476197|ref|YP_001857667.1| phosphopyruvate hydratase [Burkholderia phymatum STM815]
 gi|238691311|sp|B2JIX0|ENO_BURP8 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|184192656|gb|ACC70621.1| Phosphopyruvate hydratase [Burkholderia phymatum STM815]
          Length = 427

 Score =  521 bits (1343), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 318/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E A YLA L D++PI SIEDGM E DW GWK+LT+K+
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFADYLATLADKFPIVSIEDGMHEGDWEGWKLLTDKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKIQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|42518800|ref|NP_964730.1| enolase [Lactobacillus johnsonii NCC 533]
 gi|268319804|ref|YP_003293460.1| hypothetical protein FI9785_1333 [Lactobacillus johnsonii FI9785]
 gi|59797825|sp|Q74K78|ENO1_LACJO RecName: Full=Enolase 1; AltName: Full=2-phospho-D-glycerate
           hydro-lyase 1; AltName: Full=2-phosphoglycerate
           dehydratase 1
 gi|41583086|gb|AAS08696.1| enolase [Lactobacillus johnsonii NCC 533]
 gi|125742943|gb|ABN54674.1| enolase-3 [Lactobacillus johnsonii]
 gi|262398179|emb|CAX67193.1| eno [Lactobacillus johnsonii FI9785]
 gi|329667651|gb|AEB93599.1| enolase [Lactobacillus johnsonii DPC 6026]
          Length = 432

 Score =  521 bits (1343), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 250/418 (59%), Positives = 318/418 (76%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI AREV+DSRG+PT+E +V  E G  GRA+VPSGASTG HEA ELRD +K R+ G+G
Sbjct: 4   ITDIHAREVLDSRGNPTVEAEVYTELGGFGRAIVPSGASTGEHEAVELRDGDKSRFLGQG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  VN EI  A++G D  DQ LID+ MIDLDGTPNK RLGANA+L VSLA ++AAA
Sbjct: 64  VLTAVENVNGEIAKAVIGLDVTDQRLIDQTMIDLDGTPNKGRLGANAMLAVSLASARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+YLGG +AH+LP P+MN++NGG HADN +D QEFMIMPVGA+++ EA+RMGA
Sbjct: 124 DELGLPLYEYLGGPNAHVLPTPMMNVINGGKHADNNVDIQEFMIMPVGAKSLHEAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E FHTLK  L+ +G ST VGDEGGF+PNLK  +   +++  +I++AGY  G+D+ IA DC
Sbjct: 184 ETFHTLKSLLQERGESTAVGDEGGFAPNLKNNEEPFEILVEAIQRAGYKPGQDISIAFDC 243

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           AAS F+ K+  KY+   +  E    E  S + ++VD+YP+ SIED + E+DW GWK+ T 
Sbjct: 244 AASEFYNKDTKKYVTVADGREYTAEEWTSLMEDIVDKYPVISIEDPLDENDWEGWKVFTE 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++G   Q+VGDDLFVTN   L KGI   VAN+ILIK NQIG+++ET   IE A+ AGY +
Sbjct: 304 RLGDKVQIVGDDLFVTNTNYLEKGIKMGVANSILIKLNQIGTLTETFEAIEMAKEAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIADL VATN GQIKTGS++R+DRIAKYNQL+RIEE+LG  A++ G
Sbjct: 364 VVSHRSGETEDTTIADLVVATNAGQIKTGSMSRTDRIAKYNQLMRIEEALGSTAQYKG 421


>gi|94310000|ref|YP_583210.1| phosphopyruvate hydratase [Cupriavidus metallidurans CH34]
 gi|119369285|sp|Q1LPI5|ENO1_RALME RecName: Full=Enolase 1; AltName: Full=2-phospho-D-glycerate
           hydro-lyase 1; AltName: Full=2-phosphoglycerate
           dehydratase 1
 gi|93353852|gb|ABF07941.1| enolase [Cupriavidus metallidurans CH34]
          Length = 429

 Score =  521 bits (1343), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 260/422 (61%), Positives = 323/422 (76%), Gaps = 3/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +D+ +I+LDGT NK RLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDRTLIELDGTENKGRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  +PVP+MNI+NGG HA+N+LD QEFMIMPV   + REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQMPVPMMNIVNGGAHANNSLDIQEFMIMPVSQTSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  KG ST VGDEGGF+PN  + +  L+ +  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDKGMSTAVGDEGGFAPNFSSNEECLNTVVQAIEKAGYKAGEDVLLALDC 243

Query: 242 AASAFFKKEK--YILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           AAS F+ + +  Y L+GE L+L   + A YLANL D++PI SIEDGM+E DW GWK LT+
Sbjct: 244 AASEFYHEAEGVYSLEGEGLKLTSTQFADYLANLCDKFPIVSIEDGMAEGDWEGWKTLTD 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           K+G   QLVGDDLFVTN + L +GI + + N+ILIK NQIG+++ET   IE A+ AGY +
Sbjct: 304 KLGKRVQLVGDDLFVTNTKILKEGIEKGIGNSILIKINQIGTLTETFAAIEMAKRAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           +ISHRSGETED TIAD+AV TN GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 VISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIATYPGKS 423

Query: 420 IL 421
             
Sbjct: 424 TF 425


>gi|299138562|ref|ZP_07031741.1| enolase [Acidobacterium sp. MP5ACTX8]
 gi|298599808|gb|EFI55967.1| enolase [Acidobacterium sp. MP5ACTX8]
          Length = 484

 Score =  521 bits (1343), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 264/421 (62%), Positives = 316/421 (75%), Gaps = 4/421 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKR-YFGKG 61
           I  I ARE++DSRG+PT+E DV L DG  GRA VPSGASTG HEA ELRD +K  Y GKG
Sbjct: 58  IVSIHAREILDSRGNPTVEADVVLADGVRGRAAVPSGASTGEHEAVELRDGDKEHYLGKG 117

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  V   +   L G DA +Q LID  M+ +DGT NKSRLGANAIL VS+A ++A+A
Sbjct: 118 VLQAVENVESILAPELAGMDASNQRLIDATMLAIDGTENKSRLGANAILAVSMACARASA 177

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY+Y GG +A ILP P+MNILNGG HADN +DFQEFM+MPVGAE   +A+R G 
Sbjct: 178 DALGIPLYRYFGGVNACILPTPMMNILNGGAHADNNVDFQEFMVMPVGAETFSDALRWGT 237

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLK  LK KGY+T VGDEGGF+P+LK+   AL+LI  +IE AGY AG+ + IALD 
Sbjct: 238 EVFHTLKGVLKKKGYNTAVGDEGGFAPSLKSNVEALELILEAIELAGYKAGEQIAIALDP 297

Query: 242 AASAFFKKE--KYIL-KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILT 298
           A+S F+ K   KYI  K +  E    +MA+Y  + V QYPI SIEDG++EDDW GWKILT
Sbjct: 298 ASSEFYDKSTGKYIFKKSDKSEKNSEQMAAYWESWVRQYPIISIEDGLAEDDWTGWKILT 357

Query: 299 NKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYP 358
            KIG N QLVGDDLFVTN +RL +GI E V N+IL+K NQIG++SETL  IE A+ +GY 
Sbjct: 358 EKIGRNVQLVGDDLFVTNSKRLQRGIEEGVGNSILVKVNQIGTISETLEAIELARRSGYT 417

Query: 359 SIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           SIISHRSGETED  IADLAV T  GQIKTGS +R+DRIAKYNQL+RIEE LG+ A+F GR
Sbjct: 418 SIISHRSGETEDTFIADLAVGTGAGQIKTGSASRTDRIAKYNQLLRIEEELGQTAEFLGR 477

Query: 419 S 419
           S
Sbjct: 478 S 478


>gi|171463596|ref|YP_001797709.1| Phosphopyruvate hydratase [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|238689060|sp|B1XUR8|ENO_POLNS RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|171193134|gb|ACB44095.1| Phosphopyruvate hydratase [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 428

 Score =  521 bits (1343), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 261/418 (62%), Positives = 318/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  ++LG DA +Q  +D+ +IDLDGT NK+RLGANA L VS+AV++AAA
Sbjct: 64  VLKAVQNINIEIAESILGLDASEQAFLDRTLIDLDGTHNKARLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG     LPVP+MNI+NGG HA+N+LD QEFM+MPVGAEN R+A+R GA
Sbjct: 124 EEAGLPLYRYFGGSGGMQLPVPMMNIVNGGAHANNSLDIQEFMVMPVGAENFRDALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK L ++G  T VGDEGGF+PN K+    L  I  +IE AGY AG+D+L+ALDC
Sbjct: 184 EIFHELKKILGAQGMPTTVGDEGGFAPNFKSNHGCLQTIMKAIEGAGYQAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY L GE L+L  +E + YL NL DQ+PI SIEDGM E DW GW  +T K+
Sbjct: 244 AASEFYKDGKYHLAGEGLQLSSSEFSDYLGNLADQFPIVSIEDGMHESDWDGWADITKKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ A Y ++I
Sbjct: 304 GKKIQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRANYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV TN GQIKTGSL+RSDRIAKYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDVATYPGKS 421


>gi|225871989|ref|YP_002753443.1| phosphopyruvate hydratase [Acidobacterium capsulatum ATCC 51196]
 gi|254783223|sp|C1F9E6|ENO_ACIC5 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|225794165|gb|ACO34255.1| phosphopyruvate hydratase [Acidobacterium capsulatum ATCC 51196]
          Length = 430

 Score =  521 bits (1343), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 262/419 (62%), Positives = 311/419 (74%), Gaps = 4/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I  I ARE++DSRG+PT+E DV L DG+ GRA VPSGASTG HEA ELRD +K  Y GKG
Sbjct: 4   IAAIHAREILDSRGNPTVEADVLLADGTLGRAAVPSGASTGEHEAVELRDGDKSHYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +   I   L G DA +Q L+D  MI LDGTPNK RLGANAIL VS+A ++A+A
Sbjct: 64  VLKAVDNIESVIAPELEGMDAANQRLLDATMIALDGTPNKGRLGANAILAVSMAAARASA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +  +PLY+YLGG +A ILP P+MNILNGG HADN +DFQEFM+MPVGAE   EA+R GA
Sbjct: 124 NSLKIPLYRYLGGANASILPTPMMNILNGGAHADNNVDFQEFMVMPVGAERFSEALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FHTLK  LK KGY+T VGDEGGF+P+L +   A+++I  +IE AGY AG+D+ IALD 
Sbjct: 184 EIFHTLKGVLKKKGYNTAVGDEGGFAPSLSSNTEAIEVILEAIELAGYKAGEDVAIALDP 243

Query: 242 AASAFFKKE--KYIL-KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILT 298
           AAS F+ KE  KYI  K +  E    EMA Y  +   QYPI SIEDG +EDDW GW+  T
Sbjct: 244 AASEFYDKEKGKYIFKKSDKSEKTSEEMAQYWESWTRQYPIISIEDGFAEDDWQGWRYFT 303

Query: 299 NKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYP 358
             +GS  QLVGDDLFVTN ERL +GI E +AN+ILIK NQIG+VSET   IE  +  GY 
Sbjct: 304 ELVGSRIQLVGDDLFVTNTERLQRGIEEGIANSILIKVNQIGTVSETFEAIELGRRYGYT 363

Query: 359 SIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SIISHRSGETED  IADLAVAT  GQIKTGS +R+DRIAKYNQL+RIEE LG+  +F G
Sbjct: 364 SIISHRSGETEDTFIADLAVATGAGQIKTGSASRTDRIAKYNQLLRIEEQLGQTGEFLG 422


>gi|294629772|ref|ZP_06708332.1| phosphopyruvate hydratase [Streptomyces sp. e14]
 gi|292833105|gb|EFF91454.1| phosphopyruvate hydratase [Streptomyces sp. e14]
          Length = 433

 Score =  521 bits (1343), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 326/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYQGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATDNKGSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LK+KG +T +GDEGGF+PNL +   ALDLI  +I++AGY  G+ + +ALD 
Sbjct: 184 EVYHTLKKVLKAKGLATGLGDEGGFAPNLGSNREALDLILEAIKEAGYVPGEQIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY+ +G+  E    EM  Y   LV  YP+ SIED + EDDW GWKILT+++
Sbjct: 244 AASEFYKDGKYLFEGK--ERSAAEMTEYYEELVAAYPLVSIEDPLFEDDWAGWKILTDRL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   Q+VGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GDKVQIVGDDLFVTNPERLARGIEEGTANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|145589130|ref|YP_001155727.1| phosphopyruvate hydratase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|189037226|sp|A4SXE9|ENO_POLSQ RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|145047536|gb|ABP34163.1| enolase [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 428

 Score =  521 bits (1342), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 260/420 (61%), Positives = 319/420 (75%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI   +LG DA +Q  +D  +I+LDGT NK+RLGANA L VS+AV++AAA
Sbjct: 64  VLKAVQNINVEIAETILGLDASEQAFLDHTLIELDGTHNKARLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG     LPVP+MNI+NGG HA+N+LD QEFM+MPVGAEN R+A+R GA
Sbjct: 124 EEAGLPLYRYFGGSGGMQLPVPMMNIVNGGAHANNSLDIQEFMVMPVGAENFRDALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK L ++G  T VGDEGGF+PN K+    L +I  +IE AGY AG+D+L+ALDC
Sbjct: 184 EIFHELKKILAAQGMPTTVGDEGGFAPNFKSNHECLQIIMKAIEGAGYQAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY L GE L+L  +E + YL NL DQ+PI SIEDGM E DW GW  +T K+
Sbjct: 244 AASEFYKDGKYHLSGEGLQLTSSEFSDYLGNLADQFPIVSIEDGMHESDWDGWADITQKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI++ +AN+ILIK NQIG+++ET   IE A+ A Y ++I
Sbjct: 304 GKKIQLVGDDLFVTNTRILKEGIDKGIANSILIKINQIGTLTETFAAIEMAKRANYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIAD+AV TN GQIKTGSL+RSDRIAKYNQL+RIEE LG  A + G+S+ 
Sbjct: 364 SHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDVATYPGKSVF 423


>gi|29830076|ref|NP_824710.1| phosphopyruvate hydratase [Streptomyces avermitilis MA-4680]
 gi|59797627|sp|Q82HH5|ENO_STRAW RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|29607186|dbj|BAC71245.1| putative enolase [Streptomyces avermitilis MA-4680]
          Length = 428

 Score =  521 bits (1342), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 327/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYQGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATDNKGSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LK+KG ST +GDEGGF+PNL++  +ALDLI  +I++AGY  G+ + +ALD 
Sbjct: 184 EVYHTLKKVLKTKGLSTGLGDEGGFAPNLESNRAALDLIIEAIKQAGYIPGEQIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY  +G++      EM  Y   LV  YP+ SIED + EDDW GWK++T+K+
Sbjct: 244 AASEFYKDGKYEFEGKS--RSAAEMTEYYEELVSAYPLVSIEDPLYEDDWAGWKVITDKL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   Q+VGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GDKVQIVGDDLFVTNPERLARGIEEGSANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVA NCGQIKTG+ ARSDR+AKYNQL+RIEE L   A++AGRS
Sbjct: 362 SHRSGETEDVTIADLAVAVNCGQIKTGAPARSDRVAKYNQLLRIEEILDDAAEYAGRS 419


>gi|290959835|ref|YP_003491017.1| enolase [Streptomyces scabiei 87.22]
 gi|260649361|emb|CBG72476.1| enolase [Streptomyces scabiei 87.22]
          Length = 426

 Score =  521 bits (1342), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 324/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATDNKGSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LK+KG ST +GDEGGF+PNL++  +ALDLI  +I++AGY  G+ + +ALD 
Sbjct: 184 EVYHTLKKVLKTKGLSTGLGDEGGFAPNLESNRAALDLILEAIKEAGYTPGEQIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G+  E    EM  Y A+LV  YP+ SIED + EDDW GW  +T K+
Sbjct: 244 AASEFYKDGVYTFEGK--ERSAAEMTEYYADLVASYPLVSIEDPLFEDDWAGWNTITEKL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   Q+VGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GDKVQIVGDDLFVTNPERLARGIEEGSANALLVKVNQIGSLTETLDAVEMAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVA NCGQIKTG+ ARSDR+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVAVNCGQIKTGAPARSDRVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|238028002|ref|YP_002912233.1| phosphopyruvate hydratase [Burkholderia glumae BGR1]
 gi|237877196|gb|ACR29529.1| Enolase [Burkholderia glumae BGR1]
          Length = 427

 Score =  521 bits (1342), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 261/418 (62%), Positives = 318/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV   + REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E A YLA L D++PI SIEDGM E DW GWK+LT ++
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFADYLATLADKFPIVSIEDGMHESDWDGWKLLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|320010369|gb|ADW05219.1| enolase [Streptomyces flavogriseus ATCC 33331]
          Length = 428

 Score =  521 bits (1341), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 257/418 (61%), Positives = 327/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYQGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATENKGSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E++HTLKK LK+KG ST +GDEGGF+PNL++  +ALDLI  ++++AGY  G+D+ +ALD 
Sbjct: 184 EIYHTLKKVLKTKGLSTGLGDEGGFAPNLESNRAALDLILEAVKEAGYVPGRDIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G++      EM  Y   LV  YP+ SIED + EDDW GWK++T+K+
Sbjct: 244 AASEFYKDGVYEFEGKS--RSAAEMTEYYEELVSAYPLVSIEDPLYEDDWAGWKVITDKL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  Q+VGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GSKVQIVGDDLFVTNPERLARGIEEGSANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVA NCGQIKTG+ ARSDR+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVAVNCGQIKTGAPARSDRVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|113867208|ref|YP_725697.1| phosphopyruvate hydratase [Ralstonia eutropha H16]
 gi|123033130|sp|Q0KCE2|ENO_RALEH RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|113525984|emb|CAJ92329.1| phosphopyruvate hydratase [Ralstonia eutropha H16]
          Length = 429

 Score =  521 bits (1341), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 260/419 (62%), Positives = 322/419 (76%), Gaps = 3/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +D+ +IDLDGT NK RLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDRTLIDLDGTENKGRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMIMPV   + REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIMPVSQTSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK L  KG ST VGDEGGF+PN  + +  L+ +  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EIFHALKKILADKGMSTAVGDEGGFAPNFSSNEECLNTVVQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEK--YILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           AAS F+ + +  Y L+GE L+L   + A YLANL D++PI SIEDGM+E DW GWK LT 
Sbjct: 244 AASEFYHEGEGVYQLEGEGLKLSSTQFADYLANLCDKFPIVSIEDGMAEGDWDGWKTLTE 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           K+G+  QLVGDDLFVTN + L +GI + + N+ILIK NQIG+++ET   IE A+ AGY +
Sbjct: 304 KLGTRVQLVGDDLFVTNTKILKEGIEKGIGNSILIKINQIGTLTETFAAIEMAKRAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           +ISHRSGETED TIAD+AV TN GQIKTGSL+RSDR+AKYNQL+RIEE LG  A + G+
Sbjct: 364 VISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRMAKYNQLLRIEEDLGDIASYPGK 422


>gi|330837141|ref|YP_004411782.1| enolase [Spirochaeta coccoides DSM 17374]
 gi|329749044|gb|AEC02400.1| enolase [Spirochaeta coccoides DSM 17374]
          Length = 431

 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 263/423 (62%), Positives = 326/423 (77%), Gaps = 6/423 (1%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I  I ARE++DSRG+PT+EV+V LEDGS GRA VPSGASTG+HEA ELRD +K RY GK
Sbjct: 3   IIEFIEAREILDSRGNPTVEVEVGLEDGSQGRAAVPSGASTGVHEAVELRDGDKSRYNGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN+ I   L G DA DQ+ ID IMI LDGTPNK +LGANAILGVS+AV++AA
Sbjct: 63  GVLKAVDNVNNIIAPELEGLDALDQVSIDHIMIALDGTPNKGKLGANAILGVSMAVARAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A +  LPL+KYLG    ++LPVP+ NILNGG H+DN +DFQEFMIMP+GA +IREA+R  
Sbjct: 123 ASSLELPLFKYLGAFHCNVLPVPMANILNGGAHSDNKVDFQEFMIMPIGASSIREAVRWT 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGK--DLLIA 238
           AEVFH LK  LKS+GY+T VGDEGGF+P+LK+ + AL++I  +I KAGY AG+  D +IA
Sbjct: 183 AEVFHCLKSVLKSRGYNTGVGDEGGFAPDLKSNEEALEVIMEAISKAGYKAGRDADFVIA 242

Query: 239 LDCAASAFF--KKEKYILKGENLE-LQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWK 295
           LD AAS  +  K   Y LK    E L   +M     + V++YPI SIEDGM+EDDW GWK
Sbjct: 243 LDPAASELYDEKTRTYTLKWTTGEKLTSAQMVDLWESWVNKYPIISIEDGMAEDDWEGWK 302

Query: 296 ILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMA 355
           +LT++IG   QLVGDDLFVTN ERL  G+ ++VAN+ILIK NQIG+++ET   I+ A+  
Sbjct: 303 LLTDRIGDRVQLVGDDLFVTNVERLKVGLEKKVANSILIKVNQIGTLTETFEAIDMAKRN 362

Query: 356 GYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           GY S++SHRSGETED  IADLAVA   GQIKTGS++RSDR+AKYN+L+RIE+ LG+ AK+
Sbjct: 363 GYTSVMSHRSGETEDSFIADLAVALETGQIKTGSMSRSDRLAKYNELLRIEDYLGEDAKY 422

Query: 416 AGR 418
           AGR
Sbjct: 423 AGR 425


>gi|294668279|ref|ZP_06733384.1| hypothetical protein NEIELOOT_00192 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291309798|gb|EFE51041.1| hypothetical protein NEIELOOT_00192 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 428

 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 320/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IIDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+EI  AL+G DA +Q  IDK+MI+LDGT NK RLGANA L VS+AV++AAA
Sbjct: 64  VLKAVEHVNNEIAQALIGIDASEQSYIDKVMIELDGTDNKGRLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG     +PVP+MN++NGG HA+N+LD QEFMIMPVGA   REA+R GA
Sbjct: 124 EDAGLPLYRYLGGAGQMAMPVPMMNVINGGAHANNSLDIQEFMIMPVGAPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK   +KG+ T VGDEGGF+PNL + + AL L+  ++  AGY  G+D+L ALDC
Sbjct: 184 EVFHALKKLCDAKGFPTTVGDEGGFAPNLNSHEEALKLMQQAVADAGYKTGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L  E   L   E A YLA+L  +YPI SIEDGM E+D  GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLSAEGKALSSAEFADYLADLAARYPIVSIEDGMDENDREGWKLLTQKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + +ANA+L+K NQIG++SETL  +E A+   Y S++
Sbjct: 304 GGTVQLVGDDLFVTNPKILAEGIEDGIANALLVKVNQIGTLSETLKAVELAKRNRYTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE LG+ A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELGEAAYYPGKA 421


>gi|260577712|ref|ZP_05845647.1| phosphopyruvate hydratase [Corynebacterium jeikeium ATCC 43734]
 gi|258604107|gb|EEW17349.1| phosphopyruvate hydratase [Corynebacterium jeikeium ATCC 43734]
          Length = 425

 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 329/418 (78%), Gaps = 2/418 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKG 61
            I +I ARE+IDSRG+PT+EVDV L+DGS GRA VPSGASTG+HEA ELRD  +RY GKG
Sbjct: 3   LILNIDAREIIDSRGNPTVEVDVLLDDGSFGRAAVPSGASTGVHEAHELRDGGERYQGKG 62

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  V ++I   L+G +A DQ LID++M DLDGT NKS+LGANAILGVS+AV++AAA
Sbjct: 63  VLNAVKNVIEDIDEELMGVEADDQRLIDQLMRDLDGTENKSKLGANAILGVSMAVARAAA 122

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           ++++LPL++Y+GG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE   EA+R+GA
Sbjct: 123 ESADLPLFRYVGGPNAHVLPVPMMNILNGGAHADSGVDVQEFMIAPIGAETFSEALRVGA 182

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK +K KG ST +GDEGGF+P++ +  +ALDLI  +IEKAG+  G+D+ +ALD 
Sbjct: 183 EVYHTLKKVIKDKGLSTGLGDEGGFAPSVDSTKAALDLIVEAIEKAGFKVGEDVALALDV 242

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S FFK  KY  +G   E    EMA     L+++YPI SIED + EDDW G+  LT KI
Sbjct: 243 ASSEFFKDGKYHFEGG--EHTAEEMAKVYEGLIEEYPIVSIEDPLQEDDWEGYTALTAKI 300

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   Q+VGDD FVTNP+RL KGI E+ ANA+L+K NQIG+++ET + +E A   GY S++
Sbjct: 301 GDKVQIVGDDFFVTNPQRLAKGIEEKAANALLVKVNQIGTLTETFDAVELAHRNGYRSMM 360

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVA NCGQIKTG+ ARS+R+AKYNQL+RIEE LG  A +AGRS
Sbjct: 361 SHRSGETEDTTIADLAVALNCGQIKTGAPARSERVAKYNQLLRIEEILGDAAVYAGRS 418


>gi|134095372|ref|YP_001100447.1| phosphopyruvate hydratase [Herminiimonas arsenicoxydans]
 gi|166232197|sp|A4G737|ENO_HERAR RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|133739275|emb|CAL62324.1| Enolase (2-phosphoglycerate dehydratase) (2-phospho-D-glycerate
           hydro-lyase) [Herminiimonas arsenicoxydans]
          Length = 427

 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 254/418 (60%), Positives = 316/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE+IDSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RYFGKG
Sbjct: 4   IVDIIGREIIDSRGNPTVECDVLLESGVMGRASVPSGASTGSREAIELRDGDKNRYFGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA   +N EI  A++G DA +Q  +D+ +IDLDGT NK+RLGANA L VS+AV+KAAA
Sbjct: 64  VLKACENINTEISEAIMGLDANEQAFLDRTLIDLDGTDNKARLGANATLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+Y GG  A  +PVP+MN++NGG HA+N LD QEFMI+PVGA + REAIR GA
Sbjct: 124 EESGLPLYRYFGGSGAMQMPVPMMNVINGGAHANNNLDLQEFMIIPVGAPSFREAIRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKK +  KG  T+VGDEGGF+P+++  ++A+ +I  +IE+AGY  G  + + LDC
Sbjct: 184 EVFHTLKKIINDKGLPTSVGDEGGFAPSVENHEAAIKMILQAIEQAGYEPGTQIALGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY L GE + L   +  + L    D+YPI SIEDGM+E+DW GW  LTN +
Sbjct: 244 AASEFYKDGKYHLAGEGMSLSSADFTNLLGTWCDKYPIISIEDGMAENDWDGWATLTNAL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN + L +GI + VAN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTKILREGIQKNVANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV TN  QIKTGS++RSDR+AKYNQL+RIEE LG  A + GR+
Sbjct: 364 SHRSGETEDSTIADIAVGTNSLQIKTGSMSRSDRMAKYNQLLRIEEDLGDIASYPGRN 421


>gi|170694759|ref|ZP_02885910.1| Phosphopyruvate hydratase [Burkholderia graminis C4D1M]
 gi|170140390|gb|EDT08567.1| Phosphopyruvate hydratase [Burkholderia graminis C4D1M]
          Length = 427

 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 317/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGETGRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E A YLA L D++PI SIEDGM E DW GWK+LT K+
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFADYLATLADKFPIVSIEDGMHEGDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKRIQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|329941149|ref|ZP_08290428.1| phosphopyruvate hydratase [Streptomyces griseoaurantiacus M045]
 gi|329299680|gb|EGG43579.1| phosphopyruvate hydratase [Streptomyces griseoaurantiacus M045]
          Length = 429

 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 324/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATDNKGSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LK+KG +T +GDEGGF+PNL +   ALDLI  +I++AGY  G  + +ALD 
Sbjct: 184 EVYHTLKKVLKNKGLATGLGDEGGFAPNLGSNREALDLILEAIKEAGYTPGDQIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G++      EM  Y A LVD YP+ SIED + EDDW GWK +T+++
Sbjct: 244 AASEFYKDGVYSFEGKD--RTAAEMTDYYAELVDAYPLVSIEDPLFEDDWAGWKTITDRL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GDKVQLVGDDLFVTNPERLARGIEEGTANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|322804498|emb|CBZ02048.1| enolase [Clostridium botulinum H04402 065]
          Length = 431

 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 257/416 (61%), Positives = 321/416 (77%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AR+++DSR +PT+EV+V LEDG+ G A VPSGASTG  EA ELRD +K +Y GKG
Sbjct: 7   IVDVYARQILDSRCNPTVEVEVELEDGTVGVAAVPSGASTGAFEAVELRDGDKSKYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN  I   L+G +  DQ+ IDK MI+LDGT NK++LGANA+LGVSLA +KAAA
Sbjct: 67  VLKAVDNVNTIIADELVGMNVLDQVAIDKTMIELDGTDNKAKLGANAMLGVSLACAKAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +  + LY+Y+GG +A +LPVP+MNI+NGG HADN +D QEFMIMPVGA +  EA+RM +
Sbjct: 127 NSLGMSLYQYIGGVNAKVLPVPMMNIINGGKHADNNVDLQEFMIMPVGAPSFSEALRMCS 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LK  LKS+GY T VGDEGGF+PNLK+ + A+ +I  +I++AGY  GKD+ IALD 
Sbjct: 187 EVYHALKSTLKSQGYDTGVGDEGGFAPNLKSNEEAIVVIIEAIKEAGYTPGKDIFIALDP 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S  F+  KY L GE   L P EMA+Y   L ++YPI SIEDGM+E+DW GWKILT KI
Sbjct: 247 ASSEIFEDGKYNLAGEGRVLTPEEMANYYVELAEKYPIISIEDGMAEEDWDGWKILTEKI 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTN ERL KGI   VAN+ILIK NQIG+++ETLN IE A+ AGY +++
Sbjct: 307 GNKVQLVGDDLFVTNTERLAKGIKLGVANSILIKLNQIGTLTETLNAIEMAERAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQL+RIEE L    ++ G
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLLRIEEELNDMGEYRG 422


>gi|114565841|ref|YP_752995.1| phosphopyruvate hydratase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|119369418|sp|Q0B080|ENO_SYNWW RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|114336776|gb|ABI67624.1| enolase [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 425

 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 256/416 (61%), Positives = 321/416 (77%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I D+ AREV+DSRG+PT+EV+V LEDG+ GRA+VPSGASTG HEA ELRD + KRY GKG
Sbjct: 4   IVDVFAREVLDSRGNPTVEVEVFLEDGTMGRAIVPSGASTGAHEAVELRDGDSKRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VN  I   ++G DA  Q+ ID++MIDLD TPNK++LGANAI+GVSLA ++AAA
Sbjct: 64  VLQAVDNVNMIIAPEVIGMDATAQIDIDQLMIDLDNTPNKAKLGANAIMGVSLATARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY+Y+GG +A  +PVP+MNILNGG HADN +D QEFMI+P GA N  E +RMG 
Sbjct: 124 THLAIPLYQYIGGVNAREIPVPMMNILNGGKHADNNVDIQEFMIVPSGAPNFAEGLRMGV 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H+LKK L +KG  + VGDEGGF+PNL + ++ALDLI  +I  AGY AG D+ +ALD 
Sbjct: 184 EVYHSLKKVLNNKGLGSGVGDEGGFAPNLPSNEAALDLILEAIAAAGYQAGSDINLALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+  FK  KY L      L  +EM  + A ++++YP+ S+EDG++EDDW GWK LT ++
Sbjct: 244 AATELFKDGKYHLASSGQVLSSSEMVDFYAQMLEKYPLISLEDGLAEDDWDGWKQLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  QLVGDDLFVTN +RL +GI E V N+ILIK NQIG++SETLNTIE A+ AGY  +I
Sbjct: 304 GSKIQLVGDDLFVTNSQRLARGIEEGVCNSILIKVNQIGTLSETLNTIEMARRAGYTCVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIAD+AVATN GQIKTG+ ARSDR+AKYNQL+RIEE L   A + G
Sbjct: 364 SHRSGETEDSTIADIAVATNAGQIKTGAPARSDRVAKYNQLLRIEEELDVFAVYRG 419


>gi|182419780|ref|ZP_02951020.1| phosphopyruvate hydratase [Clostridium butyricum 5521]
 gi|237666464|ref|ZP_04526449.1| phosphopyruvate hydratase [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|182376328|gb|EDT73910.1| phosphopyruvate hydratase [Clostridium butyricum 5521]
 gi|237657663|gb|EEP55218.1| phosphopyruvate hydratase [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 430

 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 257/422 (60%), Positives = 325/422 (77%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D++AR++IDSR  PT+EV++ LEDG+ GRA VPSGASTG++EA ELRD +K  Y GKG
Sbjct: 7   IVDVVARQIIDSRCFPTVEVEIYLEDGTMGRAAVPSGASTGMYEAVELRDGDKGVYQGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VND I   L+GC+  DQ  IDK++I+LDGT NK +LGANAILGVSLAV+ AAA
Sbjct: 67  VLKAVENVNDTIAEELIGCNVFDQTYIDKMLIELDGTNNKGKLGANAILGVSLAVANAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY+Y+GG +A +LPVP+MNILNGG HADN++D QEFMIMP GA    +A+RM A
Sbjct: 127 NALGIPLYRYIGGVNAKVLPVPMMNILNGGSHADNSVDLQEFMIMPAGAGTFSDALRMCA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK L  KGY+T +GDEGGF+PNLK+   ALD+I  +I KAGY AG+++ IA+D 
Sbjct: 187 EVYHTLKKILNDKGYATGIGDEGGFAPNLKSNAEALDVIIEAIGKAGYKAGEEIFIAIDA 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S ++K  KY+L+ E   L   EM  +    V++YPI SIEDGM+E+DW GWK++T ++
Sbjct: 247 ASSEYYKDGKYVLEHEGRTLSSAEMVDFFEEWVNKYPIISIEDGMAEEDWDGWKLMTERL 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN ERL KGI   VAN+ILIK NQIG+++ETLN IE A  AGY +++
Sbjct: 307 GKKVQLVGDDLFVTNTERLEKGIQLGVANSILIKLNQIGTLTETLNAIEMANRAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADL VATN GQIKTG+ ARS+R+AKYNQLIRIEE L   A++ G+   
Sbjct: 367 SHRSGETEDTTIADLVVATNAGQIKTGAPARSERVAKYNQLIRIEEELDDVAEYRGKKAF 426

Query: 422 IH 423
            +
Sbjct: 427 FN 428


>gi|74316639|ref|YP_314379.1| phosphopyruvate hydratase [Thiobacillus denitrificans ATCC 25259]
 gi|119369421|sp|Q3SL43|ENO_THIDA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|74056134|gb|AAZ96574.1| enolase (phosphopyruvate hydratase) [Thiobacillus denitrificans
           ATCC 25259]
          Length = 427

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 260/417 (62%), Positives = 319/417 (76%), Gaps = 1/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+IARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IIDVIAREILDSRGNPTVEADVLLESGVIGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EI  A++G D  DQ  ID+ MI+LDGT NKSRLGANA+L VS+A ++AAA
Sbjct: 64  VLKAVEHVNTEICEAIIGLDVEDQAFIDQTMIELDGTENKSRLGANALLAVSMACARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG +   LPVP+MNI+NGG HA+N +D QEFM++PVGA + REA+R GA
Sbjct: 124 EQAGLPLYRYLGGAAPMQLPVPMMNIINGGAHANNNIDMQEFMVIPVGAPSFREALRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L   G +T VGDEGGF+PNL++ ++AL LI  +IEKAG   G D+ I +DC
Sbjct: 184 EVFHALKKLLDDAGMTTTVGDEGGFAPNLESHEAALKLIVQAIEKAGLQPGIDVAIGVDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K   Y +  ENL+L       YLA   D+YPI SIEDGM+E DW GWKILT+++
Sbjct: 244 ASSEFYKDGLYHIDSENLKLTSAAFTDYLAAWCDKYPIISIEDGMAEGDWDGWKILTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN + L +GI +++AN+ILIK NQIG++SET   IE A+ AGY S+I
Sbjct: 304 GRRVQLVGDDLFVTNAKILKEGIEKDIANSILIKVNQIGTLSETFQAIEMAKQAGYTSVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           SHRSGETED TIADLAVATN  QIKTGSL+RSDR+AKYNQL+RIEE LG  A + GR
Sbjct: 364 SHRSGETEDTTIADLAVATNARQIKTGSLSRSDRMAKYNQLLRIEEELGDTASYPGR 420


>gi|194289292|ref|YP_002005199.1| phosphopyruvate hydratase [Cupriavidus taiwanensis LMG 19424]
 gi|238692757|sp|B3R499|ENO_CUPTR RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|193223127|emb|CAQ69132.1| enolase, phosphopyruvate hydratase [Cupriavidus taiwanensis LMG
           19424]
          Length = 429

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 260/419 (62%), Positives = 322/419 (76%), Gaps = 3/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKGRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +D+ +IDLDGT NK RLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDRTLIDLDGTENKGRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFM+MPV   + REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMVMPVSQTSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK L  KG ST VGDEGGF+PN  + +  L+ I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EIFHALKKILADKGMSTAVGDEGGFAPNFSSNEECLNTIVQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEK--YILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           AAS F+ + +  Y L+GE L+L   + A YLANL D++PI SIEDGM+E DW GWK LT+
Sbjct: 244 AASEFYHEAEGVYQLEGEGLKLSSTQFADYLANLCDKFPIVSIEDGMAEGDWDGWKTLTD 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           K+G   QLVGDDLFVTN + L +GI + + N+ILIK NQIG+++ET   IE A+ AGY +
Sbjct: 304 KLGKRVQLVGDDLFVTNTKILKEGIEKGIGNSILIKINQIGTLTETFAAIEMAKRAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           +ISHRSGETED TIAD+AV TN GQIKTGSL+RSDR+AKYNQL+RIEE LG  A + G+
Sbjct: 364 VISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRMAKYNQLLRIEEDLGDIASYPGK 422


>gi|330817642|ref|YP_004361347.1| phosphopyruvate hydratase [Burkholderia gladioli BSR3]
 gi|327370035|gb|AEA61391.1| phosphopyruvate hydratase [Burkholderia gladioli BSR3]
          Length = 427

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 261/418 (62%), Positives = 317/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGETGRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E A YLA L D++PI SIEDGM E DW GWK+LT ++
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFADYLATLADKFPIVSIEDGMHESDWDGWKLLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|91789044|ref|YP_549996.1| phosphopyruvate hydratase [Polaromonas sp. JS666]
 gi|119369366|sp|Q128E4|ENO_POLSJ RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|91698269|gb|ABE45098.1| enolase [Polaromonas sp. JS666]
          Length = 427

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 256/418 (61%), Positives = 321/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ RE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIVGREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A+LG DA +Q  +D+ +IDLDGT NKSRLGANA L VS+AV++AAA
Sbjct: 64  VLKAVEHINTEISEAVLGLDASEQAFLDRTLIDLDGTDNKSRLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  +PVP+MN++NGG HA+N LD QE MI+P+GA + REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQMPVPMMNVVNGGAHANNNLDLQELMIIPIGAPSFREAVRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  KG S  VGDEGGF+PN+ + ++A+ +I  +I+KAGY AG+ + + LDC
Sbjct: 184 EVFHALKKILHDKGMSVAVGDEGGFAPNVPSHEAAIQMILEAIDKAGYVAGEQIALGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY+L GE L L   E  + LA  VD+YPI SIEDGM+E DW GWKILT ++
Sbjct: 244 AASEFYKDGKYVLAGEGLSLDATEWTNILATWVDKYPIISIEDGMAEGDWDGWKILTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN + L +GI++ +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKQVQLVGDDLFVTNTKILKEGIDKHIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV TN GQIKTGSL+RSDR+AKYNQL+RIEE LG  A + GR+
Sbjct: 364 SHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRMAKYNQLLRIEEDLGDIATYPGRA 421


>gi|256819122|ref|YP_003140401.1| phosphopyruvate hydratase [Capnocytophaga ochracea DSM 7271]
 gi|256580705|gb|ACU91840.1| enolase [Capnocytophaga ochracea DSM 7271]
          Length = 430

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 323/418 (77%), Gaps = 4/418 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKG 61
            I  + AR+++DSRG+PT+EVDV  E+G  GRA VPSGASTG +EA ELRD  K Y GKG
Sbjct: 3   IIVSVHARQILDSRGNPTVEVDVMTENGFLGRAAVPSGASTGEYEAVELRDGGKNYMGKG 62

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+A VND I   ++G D  +Q LIDK MI+LDGTPNKS+LGANAILGVSLAV++AAA
Sbjct: 63  VLKAVANVNDIIAEEIVGMDVFEQNLIDKTMIELDGTPNKSKLGANAILGVSLAVARAAA 122

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+Y+GG SAH LPVP+MNI+N G H+D  + FQEFMIMPV A+N  +AI+MG+
Sbjct: 123 EELGLPLYRYVGGVSAHTLPVPMMNIINAGAHSDAPIAFQEFMIMPVNAKNFSQAIQMGS 182

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  KG ST VGDEGGF+PN K  + ALD I  ++++AGY  G+D+ IALDC
Sbjct: 183 EVFHNLKKVLHKKGLSTAVGDEGGFAPNFKDIEDALDSIKEAVKEAGYKWGEDIKIALDC 242

Query: 242 AASAFFKKEKY---ILKGENLELQPN-EMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           A+S F+K  KY   I +G   +++ + E A YLA LV +YPI SIEDGM ++DW GWK+L
Sbjct: 243 ASSEFYKNGKYDYTIFEGAKGKVRTSAEQAEYLAELVAKYPIISIEDGMDQNDWDGWKLL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T+K+G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG++SET+  ++ A  AGY
Sbjct: 303 TDKLGKKVQLVGDDLFVTNVSILERGIAKGIANSILIKVNQIGTLSETIAAVDMANRAGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
            +++SHRSGETED+TIADLAVA N GQIKTGS +RSDR+AKYNQL+RIEESLG  A +
Sbjct: 363 TAVMSHRSGETEDNTIADLAVALNTGQIKTGSASRSDRMAKYNQLLRIEESLGSVAYY 420


>gi|238853246|ref|ZP_04643631.1| phosphopyruvate hydratase [Lactobacillus gasseri 202-4]
 gi|238834130|gb|EEQ26382.1| phosphopyruvate hydratase [Lactobacillus gasseri 202-4]
          Length = 432

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 251/418 (60%), Positives = 318/418 (76%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI AREV+DSRG+PT+E +V  E G  GRA+VPSGASTG HEA ELRD +K R+ G+G
Sbjct: 4   ITDIHAREVLDSRGNPTVEAEVYTELGGFGRAIVPSGASTGEHEAVELRDGDKSRFGGQG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  VN EI  A++G D  DQ LID+ MIDLDGTPNK RLGANAIL VSLA ++AAA
Sbjct: 64  VLTAVENVNGEIAKAVIGLDVTDQRLIDQTMIDLDGTPNKGRLGANAILSVSLASARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+YLGG +AH+LP P+MN++NGG HADN +D QEFMIMPVGA+++ EA+RMGA
Sbjct: 124 DELGLPLYEYLGGPNAHVLPTPMMNVINGGKHADNNVDIQEFMIMPVGAKSLHEAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E FHTLK  L+ +G ST VGDEGGF+PNLK  +   +++  +I++AGY  G+D+ IA DC
Sbjct: 184 ETFHTLKGLLQERGESTAVGDEGGFAPNLKNNEEPFEILVEAIQRAGYKPGQDIAIAFDC 243

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           AAS F+ K+  KY+   +  E    E  S + +LVD+YP+ S+ED + E+DW GWK  T 
Sbjct: 244 AASEFYNKDTKKYVTVADGREYTAEEWTSLIEDLVDKYPVISVEDPLDENDWEGWKTFTE 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++G+  Q+VGDDLFVTN   L KGI   VAN+ILIK NQIG+++ET   IE A+ AGY +
Sbjct: 304 RLGNKVQIVGDDLFVTNTSYLEKGIKMGVANSILIKLNQIGTLTETFEAIEMAKEAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIADL VATN GQIKTGS++R+DRIAKYNQL+RIEE+LG  A++ G
Sbjct: 364 VVSHRSGETEDTTIADLVVATNAGQIKTGSMSRTDRIAKYNQLMRIEEALGSTAQYKG 421


>gi|188589978|ref|YP_001922183.1| phosphopyruvate hydratase [Clostridium botulinum E3 str. Alaska
           E43]
 gi|251779314|ref|ZP_04822234.1| phosphopyruvate hydratase [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|238689629|sp|B2UY16|ENO_CLOBA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|188500259|gb|ACD53395.1| phosphopyruvate hydratase [Clostridium botulinum E3 str. Alaska
           E43]
 gi|243083629|gb|EES49519.1| phosphopyruvate hydratase [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 431

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 256/422 (60%), Positives = 325/422 (77%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D++AR+++DSR  PT+EV+V LEDG+ GRA VPSGASTG++EA ELRD +K +Y GKG
Sbjct: 7   IIDVVARQILDSRCFPTVEVEVYLEDGTMGRAAVPSGASTGMYEAVELRDGDKDKYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  VND I  AL+GC+  DQ  IDK++I+LDGT NK +LGANAILGVSLAV+ AAA
Sbjct: 67  VLTAVQNVNDTIAEALIGCNVFDQPYIDKMLIELDGTNNKGKLGANAILGVSLAVANAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               L LYKY+GG +A +LPVP+MNI+NGG HADN++D QEFMIMPVGA +  EA+RM A
Sbjct: 127 NALGLSLYKYVGGVNAKVLPVPMMNIINGGSHADNSVDLQEFMIMPVGATSFTEALRMCA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLK  LK KGY+T +GDEGGF+PNLK+   A+D+I  +I KAGY AG+D+ IA+D 
Sbjct: 187 EVYHTLKNTLKDKGYATGLGDEGGFAPNLKSNAEAIDVIIEAITKAGYKAGEDMFIAIDA 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S ++K  KY+L+ E   L   EM  +  + V++YPI SIEDGM+E+DW GWK+L  ++
Sbjct: 247 ASSEYYKDGKYVLENEGKTLTSAEMVDFFEDWVNKYPIISIEDGMAEEDWDGWKLLNERL 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN ERL KGI    AN+ILIK NQIG+++ETLN IE A  AGY ++I
Sbjct: 307 GKKVQLVGDDLFVTNTERLEKGIEIGAANSILIKLNQIGTLTETLNAIEMANRAGYTAVI 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TI+DL VA N GQIKTG+ ARS+R+AKYNQL+RIEE L   A++ G+   
Sbjct: 367 SHRSGETEDTTISDLVVAVNAGQIKTGAPARSERVAKYNQLLRIEEELEDVAEYRGKKAF 426

Query: 422 IH 423
            +
Sbjct: 427 FN 428


>gi|297200211|ref|ZP_06917608.1| phosphopyruvate hydratase [Streptomyces sviceus ATCC 29083]
 gi|297147603|gb|EDY57370.2| phosphopyruvate hydratase [Streptomyces sviceus ATCC 29083]
          Length = 428

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 327/418 (78%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 6   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYQGKG 65

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 66  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATDNKGSLGANAILGVSLAVAHAAS 125

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R G 
Sbjct: 126 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGT 185

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LKSKG ST +GDEGGF+PNL++  +ALDLI  +I++AGY  G+ + +ALD 
Sbjct: 186 EVYHTLKKVLKSKGLSTGLGDEGGFAPNLESNRAALDLILEAIKEAGYIPGEQVALALDV 245

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY  +G++      EM  Y   LV  YP+ SIED + EDDW GWK+LT+K+
Sbjct: 246 AASEFYKDGKYQFEGKD--RSAAEMTEYYEELVAAYPLVSIEDPLFEDDWAGWKVLTDKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   Q+VGDDLFVTNPERL +GI +  ANA+L+K NQIGS++ETL+ +E AQ +G+  ++
Sbjct: 304 GDKVQIVGDDLFVTNPERLARGIEDGAANALLVKVNQIGSLTETLDAVELAQRSGFKCMM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 364 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 421


>gi|258517027|ref|YP_003193249.1| enolase [Desulfotomaculum acetoxidans DSM 771]
 gi|257780732|gb|ACV64626.1| enolase [Desulfotomaculum acetoxidans DSM 771]
          Length = 426

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 259/420 (61%), Positives = 321/420 (76%), Gaps = 3/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA ELRDQ+  RY GKG
Sbjct: 5   IVDVHAREILDSRGNPTVEVDVILEDGTMGRAAVPSGASTGAYEAVELRDQDSSRYLGKG 64

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VND +   ++G DA DQL ID+ MIDLDGT NK +LGANAILG+SLA +KAAA
Sbjct: 65  VKKAVENVNDILGPEVVGMDATDQLGIDRAMIDLDGTANKGKLGANAILGISLAAAKAAA 124

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+YLGG +A  LPVP+MNILNGG HADN +D QEFMIMP GA +  E +RMGA
Sbjct: 125 EACGLPLYQYLGGVNAKQLPVPMMNILNGGAHADNNVDIQEFMIMPAGATSFAEGLRMGA 184

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LK  LK KG +T VGDEGGF+PNL + + AL +I  +I  AGY  G+D+ +A+D 
Sbjct: 185 EIFHKLKSVLKGKGLNTAVGDEGGFAPNLGSNEEALAVIVEAIGSAGYKPGQDVFLAIDA 244

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AA+ FFK   Y  +G+   L   EM  Y A+LV +YPI SIEDG++EDDW GWK+LT K+
Sbjct: 245 AATEFFKDGNYAFEGK--ALTAAEMVDYYASLVAKYPIISIEDGLAEDDWDGWKLLTEKL 302

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  QLVGDDLFVTN ERL +GI   VAN+ILIK NQIG+++ETL+ IE A+ AGY +++
Sbjct: 303 GSKVQLVGDDLFVTNTERLARGIEAGVANSILIKVNQIGTLTETLDAIEMAKRAGYTAVV 362

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADL VATN GQIKTG+ +R+DR+AKYNQL+R+EE L    +F G+ + 
Sbjct: 363 SHRSGETEDSTIADLVVATNAGQIKTGAPSRTDRVAKYNQLLRLEEDLAVYGQFKGKGVF 422


>gi|323526597|ref|YP_004228750.1| enolase [Burkholderia sp. CCGE1001]
 gi|323383599|gb|ADX55690.1| enolase [Burkholderia sp. CCGE1001]
          Length = 427

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 261/418 (62%), Positives = 316/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGETGRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E   YLA L D++PI SIEDGM E DW GWK+LT K+
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFTDYLATLADKFPIVSIEDGMHEGDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKIQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|134097443|ref|YP_001103104.1| phosphopyruvate hydratase [Saccharopolyspora erythraea NRRL 2338]
 gi|291004566|ref|ZP_06562539.1| phosphopyruvate hydratase [Saccharopolyspora erythraea NRRL 2338]
 gi|166232226|sp|A4F804|ENO_SACEN RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|133910066|emb|CAM00178.1| phosphopyruvate hydratase [Saccharopolyspora erythraea NRRL 2338]
          Length = 428

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 251/417 (60%), Positives = 324/417 (77%), Gaps = 3/417 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGK 60
            I  + ARE++DSRG+PT+EV+V LEDG+  RA VPSGASTG HEA ELRD + +RY GK
Sbjct: 3   IIEQVGAREILDSRGNPTVEVEVALEDGTLTRAAVPSGASTGEHEAVELRDGDAERYGGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV KA+  V DEI   L G DA +Q ++D+ ++DLDGTP+KSRLGANAILGVSLAV+KAA
Sbjct: 63  GVEKAVEAVLDEIGPELAGVDAIEQRVVDQKLVDLDGTPDKSRLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A++  L L++Y+GG +AH+LPVP+MNILNGG HAD  +D QEFMI P+GA++  EA+R G
Sbjct: 123 AESVGLELFRYVGGPNAHVLPVPMMNILNGGAHADTGVDVQEFMIAPIGADSFSEAVRWG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE +H+LK  LK+KG +T +GDEGGF+P+L +   ALDLIA++IEKAGY  G+D+++ALD
Sbjct: 183 AETYHSLKSVLKAKGLATGLGDEGGFAPDLPSNREALDLIASAIEKAGYKLGRDIVLALD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            AA+ F++   Y  +G     +  +MA Y   L+D YP+ SIED +SEDDW GW  LT++
Sbjct: 243 VAATEFYRDGAYHFEGSKRSAE--QMAGYYGELLDAYPLVSIEDPLSEDDWDGWVRLTSE 300

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG   QLVGDDLFVTNPERL +GI+    NA+L+K NQIG++SETL+ +  A   GY S+
Sbjct: 301 IGERVQLVGDDLFVTNPERLEEGISRRAGNALLVKVNQIGTLSETLDAVHLATSCGYKSM 360

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           +SHRSGETED TIADLAVAT CGQIKTG+ ARS+R+AKYNQL+RIEE+LG  A++AG
Sbjct: 361 MSHRSGETEDTTIADLAVATGCGQIKTGAPARSERVAKYNQLLRIEETLGDAARYAG 417


>gi|116629934|ref|YP_815106.1| enolase [Lactobacillus gasseri ATCC 33323]
 gi|282851468|ref|ZP_06260833.1| phosphopyruvate hydratase [Lactobacillus gasseri 224-1]
 gi|300361306|ref|ZP_07057483.1| enolase [Lactobacillus gasseri JV-V03]
 gi|311110433|ref|ZP_07711830.1| phosphopyruvate hydratase [Lactobacillus gasseri MV-22]
 gi|122273128|sp|Q042F4|ENO2_LACGA RecName: Full=Enolase 2; AltName: Full=2-phospho-D-glycerate
           hydro-lyase 2; AltName: Full=2-phosphoglycerate
           dehydratase 2
 gi|116095516|gb|ABJ60668.1| enolase [Lactobacillus gasseri ATCC 33323]
 gi|282557436|gb|EFB63033.1| phosphopyruvate hydratase [Lactobacillus gasseri 224-1]
 gi|300353925|gb|EFJ69796.1| enolase [Lactobacillus gasseri JV-V03]
 gi|311065587|gb|EFQ45927.1| phosphopyruvate hydratase [Lactobacillus gasseri MV-22]
          Length = 432

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 251/418 (60%), Positives = 317/418 (75%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI AREV+DSRG+PT+E +V  E G  GRA+VPSGASTG HEA ELRD +K R+ G+G
Sbjct: 4   ITDIHAREVLDSRGNPTVEAEVYTELGGFGRAIVPSGASTGEHEAVELRDGDKSRFGGQG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  VN EI  A++G D  DQ LID+ MIDLDGTPNK RLGANAIL VSLA ++AAA
Sbjct: 64  VLTAVENVNGEIAKAVIGLDVTDQRLIDQTMIDLDGTPNKGRLGANAILSVSLASARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+YLGG +AH+LP P+MN++NGG HADN +D QEFMIMPVGA+++ EA+RMGA
Sbjct: 124 DELGLPLYEYLGGPNAHVLPTPMMNVINGGKHADNNVDIQEFMIMPVGAKSLHEAVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E FHTLK  L+ +G ST VGDEGGF+PNLK  +   +++  +I++AGY  G+D+ IA DC
Sbjct: 184 ETFHTLKGLLQERGESTAVGDEGGFAPNLKNNEEPFEILVEAIQRAGYKPGQDIAIAFDC 243

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           AAS F+ K+  KY+   +  E    E  S + +LVD+YP+ S+ED + E+DW GWK  T 
Sbjct: 244 AASEFYNKDTKKYVTVADGREYTAEEWTSLIEDLVDKYPVISVEDPLDENDWEGWKTFTE 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++G   Q+VGDDLFVTN   L KGI   VAN+ILIK NQIG+++ET   IE A+ AGY +
Sbjct: 304 RLGDKVQIVGDDLFVTNTSYLEKGIKMGVANSILIKLNQIGTLTETFEAIEMAKEAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIADL VATN GQIKTGS++R+DRIAKYNQL+RIEE+LG  A++ G
Sbjct: 364 VVSHRSGETEDTTIADLVVATNAGQIKTGSMSRTDRIAKYNQLMRIEEALGSTAQYKG 421


>gi|187933291|ref|YP_001887241.1| phosphopyruvate hydratase [Clostridium botulinum B str. Eklund 17B]
 gi|238691657|sp|B2TPW4|ENO_CLOBB RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|187721444|gb|ACD22665.1| phosphopyruvate hydratase [Clostridium botulinum B str. Eklund 17B]
          Length = 431

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 256/422 (60%), Positives = 325/422 (77%), Gaps = 1/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D++AR+++DSR  PT+EV+V LEDG+ GRA VPSGASTG++EA ELRD +K +Y GKG
Sbjct: 7   IIDVVARQILDSRCFPTVEVEVYLEDGTIGRAAVPSGASTGMYEAVELRDGDKDKYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  VND I  AL+GC+  DQ  IDK++I+LDGT NK +LGANAILGVSLAV+ AAA
Sbjct: 67  VLTAVQNVNDTIAEALIGCNVFDQPYIDKMLIELDGTDNKGKLGANAILGVSLAVANAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               L LYKY+GG +A +LPVP+MNI+NGG HADN++D QEFMIMPVGA +  EA+RM A
Sbjct: 127 NALGLSLYKYVGGVNAKVLPVPMMNIINGGSHADNSVDLQEFMIMPVGATSFTEALRMCA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLK  LK KGY+T +GDEGGF+PNLK+   A+D+I  +I KAGY AG+D+ IA+D 
Sbjct: 187 EVYHTLKNTLKDKGYATGLGDEGGFAPNLKSNAEAIDVIIEAITKAGYKAGEDMFIAIDA 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S ++K  KY+L+ E   L   EM  +  + V++YPI SIEDGM+E+DW GWK+L  ++
Sbjct: 247 ASSEYYKDGKYVLENEGKTLTSAEMVDFFEDWVNKYPIISIEDGMAEEDWDGWKLLNERL 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN ERL KGI    AN+ILIK NQIG+++ETLN IE A  AGY ++I
Sbjct: 307 GKKVQLVGDDLFVTNTERLEKGIEIGAANSILIKLNQIGTLTETLNAIEMANRAGYTAVI 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TI+DL VA N GQIKTG+ ARS+R+AKYNQL+RIEE L   A++ G+   
Sbjct: 367 SHRSGETEDTTISDLVVAVNAGQIKTGAPARSERVAKYNQLLRIEEELEDVAEYRGKKAF 426

Query: 422 IH 423
            +
Sbjct: 427 FN 428


>gi|126700790|ref|YP_001089687.1| enolase [Clostridium difficile 630]
 gi|255102313|ref|ZP_05331290.1| enolase [Clostridium difficile QCD-63q42]
 gi|255308205|ref|ZP_05352376.1| enolase [Clostridium difficile ATCC 43255]
 gi|255657118|ref|ZP_05402527.1| enolase [Clostridium difficile QCD-23m63]
 gi|119369311|sp|Q181T5|ENO_CLOD6 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|115252227|emb|CAJ70067.1| Enolase (2-phosphoglycerate dehydratase) (2-phospho-D-glycerate
           hydro-lyase) [Clostridium difficile]
          Length = 430

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 256/415 (61%), Positives = 321/415 (77%), Gaps = 3/415 (0%)

Query: 6   IIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKGVLK 64
           + AREV+DSRG+PT+EV+V LEDG+ GRA+VPSGASTG  EA ELRD +K RY GKGV  
Sbjct: 7   VYAREVLDSRGNPTVEVEVVLEDGAMGRAIVPSGASTGAFEAVELRDGDKGRYLGKGVET 66

Query: 65  AIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTS 124
           A+A VN+ I   + G DA DQ  ID IMI+LDGTPNK +LGANAILGVS+AV++AAA   
Sbjct: 67  AVANVNEIIAPEIEGMDAFDQPAIDAIMIELDGTPNKGKLGANAILGVSMAVARAAADEI 126

Query: 125 NLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVF 184
            LPL++YLGG +A  LPVP+MNILNGG HADN +D QEFMI+PVGA   +E +RMGAEVF
Sbjct: 127 GLPLFQYLGGVNAKQLPVPMMNILNGGEHADNNVDVQEFMILPVGACCFKEGLRMGAEVF 186

Query: 185 HTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAAS 244
           H+LKK L  KG +  VGDEGGF+PNL +   AL+LI  +I KAGY  G+D+++ LD AA+
Sbjct: 187 HSLKKVLGEKGLACGVGDEGGFAPNLGSNREALELIVEAITKAGYKPGEDVMLGLDVAAT 246

Query: 245 AFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
             + KE  KY+L GE  EL   EM +   +  + +PI +IEDG+ E+DW GWK+LT K+G
Sbjct: 247 EMYNKETKKYVLAGEGKELTAAEMVALYEDWSNNFPIITIEDGLDEEDWDGWKLLTEKLG 306

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           +  QLVGDDLFVTN ERL KGI   VAN+IL+K NQIG+++ETL+ IE A+ AGY ++IS
Sbjct: 307 NKLQLVGDDLFVTNTERLEKGIENGVANSILVKVNQIGTITETLDAIEMAKRAGYTAVIS 366

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           HRSGETED TIADLAVA N GQIKTG+ +R+DR+AKYNQL+RIEE +G+QA++ G
Sbjct: 367 HRSGETEDSTIADLAVAVNAGQIKTGAPSRTDRVAKYNQLLRIEEMVGEQARYCG 421


>gi|21221535|ref|NP_627314.1| phosphopyruvate hydratase [Streptomyces coelicolor A3(2)]
 gi|256787275|ref|ZP_05525706.1| phosphopyruvate hydratase [Streptomyces lividans TK24]
 gi|289771170|ref|ZP_06530548.1| phosphopyruvate hydratase [Streptomyces lividans TK24]
 gi|23814098|sp|Q9F2Q3|ENO1_STRCO RecName: Full=Enolase 1; AltName: Full=2-phospho-D-glycerate
           hydro-lyase 1; AltName: Full=2-phosphoglycerate
           dehydratase 1
 gi|10241779|emb|CAC09537.1| enolase [Streptomyces coelicolor A3(2)]
 gi|289701369|gb|EFD68798.1| phosphopyruvate hydratase [Streptomyces lividans TK24]
          Length = 426

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 323/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATDNKGSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R GA
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LK+KG +T +GDEGGF+PNL +   ALDLI  +I++AGY  G+ + +ALD 
Sbjct: 184 EVYHTLKKVLKNKGLATGLGDEGGFAPNLGSNREALDLILEAIKEAGYTPGEQIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G+N      EM  Y A LV+ YP+ SIED + EDDW GW  +T K+
Sbjct: 244 AASEFYKDGSYAFEGKN--RSAAEMTEYYAELVEAYPLVSIEDPLFEDDWDGWNTITAKL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GDKVQLVGDDLFVTNPERLARGIEENSANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|325105179|ref|YP_004274833.1| enolase [Pedobacter saltans DSM 12145]
 gi|324974027|gb|ADY53011.1| enolase [Pedobacter saltans DSM 12145]
          Length = 431

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 257/424 (60%), Positives = 323/424 (76%), Gaps = 5/424 (1%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKR-YFGK 60
            I D+ AR+++DSRG+PTIEVDV  E+G  GRA VPSGASTG +EA ELRD +K  Y GK
Sbjct: 3   LILDVHARQILDSRGNPTIEVDVVTENGIIGRAAVPSGASTGQYEAVELRDNDKSVYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+A VND+I   L G D  +Q  IDKIM+DLDGT NK  LGANAILGVSLAV+KAA
Sbjct: 63  GVLKAVANVNDKIAEKLRGVDVFEQNTIDKIMLDLDGTENKGELGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           AQ S+ PLY+Y+GG +A+ LP+P+MNI+NGG H+D  + FQEFMIMPVGA +  EA+R G
Sbjct: 123 AQESHQPLYRYIGGVNANTLPIPMMNIINGGSHSDAPIAFQEFMIMPVGASSFSEALRWG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            EVFH LKK L  +G ST VGDEGGF+P  +  + A++ + N+I+ AGY  G  + +ALD
Sbjct: 183 TEVFHNLKKILHDRGLSTAVGDEGGFAPTFEGTEDAIETVLNAIKAAGYQPGSQICLALD 242

Query: 241 CAASAFFKKEKY---ILKGENLELQPN-EMASYLANLVDQYPIYSIEDGMSEDDWHGWKI 296
           CA+S F+K  KY     +G+   ++ + E A+YLA L ++YPI SIEDGM E+DW GWK 
Sbjct: 243 CASSEFYKDGKYDYTKFEGDKGAVRSSAEQAAYLAELTEKYPIISIEDGMDENDWDGWKQ 302

Query: 297 LTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAG 356
           LT+K+G+  QLVGDDLFVTN +RL +GI+   AN+IL+K NQIGS++ET++ +  AQ  G
Sbjct: 303 LTDKVGNRVQLVGDDLFVTNVKRLQQGIDTNTANSILVKVNQIGSLTETIDAVSLAQTNG 362

Query: 357 YPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFA 416
           Y S++SHRSGETED TIADLAVA NCGQIKTGS +RSDRIAKYNQL+RIEE LG  AKF 
Sbjct: 363 YTSVMSHRSGETEDTTIADLAVALNCGQIKTGSASRSDRIAKYNQLLRIEEELGDNAKFI 422

Query: 417 GRSI 420
           G++ 
Sbjct: 423 GKNF 426


>gi|138896640|ref|YP_001127093.1| phosphopyruvate hydratase [Geobacillus thermodenitrificans NG80-2]
 gi|196249341|ref|ZP_03148039.1| Phosphopyruvate hydratase [Geobacillus sp. G11MC16]
 gi|166232193|sp|A4ISP4|ENO_GEOTN RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|134268153|gb|ABO68348.1| Enolase [Geobacillus thermodenitrificans NG80-2]
 gi|196211098|gb|EDY05859.1| Phosphopyruvate hydratase [Geobacillus sp. G11MC16]
          Length = 430

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 253/418 (60%), Positives = 326/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AREV+DSRG+PT+EV+V  E+G  GRA+VPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   IIDVYAREVLDSRGNPTVEVEVYTEEGGFGRALVPSGASTGEYEAVELRDGDKNRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+ I   ++G +  DQ+ ID+ +I+LDGT NK +LGANAILGVSLAV++AAA
Sbjct: 64  VLKAVENVNEVIAPEIIGLEVTDQVAIDRALIELDGTENKGKLGANAILGVSLAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+YLGG +A  LPVP+MNILNGG HADN +D QEFMIMPVGAE+ REA+RMGA
Sbjct: 124 DELGLPLYQYLGGFNAKTLPVPMMNILNGGAHADNNVDIQEFMIMPVGAESFREALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH+LK  LK+KGY+T VGDEGGF+PNLK+ + AL  I  +IEKAGY  G+ +++A+D 
Sbjct: 184 EIFHSLKAVLKAKGYNTAVGDEGGFAPNLKSNEEALQTIIEAIEKAGYKPGEQVMLAMDV 243

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           A+S  + KE  KY L+GE +     EM ++   LV +YPI SIEDG+ E+DW G K+LT 
Sbjct: 244 ASSELYNKEDGKYHLEGEGVVKTSEEMVAWYEELVSKYPIISIEDGLDENDWEGHKLLTE 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++G   QLVGDDLFVTN ++L +GI + V N+ILIK NQIG+++ET + IE A+ AGY +
Sbjct: 304 RLGHKVQLVGDDLFVTNTKKLAEGIEKGVGNSILIKVNQIGTLTETFDAIEMAKRAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIAD+AVATN GQIKTG+ +R+DR+AKYNQL+RIE+ LG  A + G
Sbjct: 364 VVSHRSGETEDSTIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDELGHTAIYQG 421


>gi|319761806|ref|YP_004125743.1| enolase [Alicycliphilus denitrificans BC]
 gi|330826334|ref|YP_004389637.1| enolase [Alicycliphilus denitrificans K601]
 gi|317116367|gb|ADU98855.1| enolase [Alicycliphilus denitrificans BC]
 gi|329311706|gb|AEB86121.1| enolase [Alicycliphilus denitrificans K601]
          Length = 428

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 257/419 (61%), Positives = 327/419 (78%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIVGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKGRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A+LG DA +Q  +DK +IDLDGT NKSRLGANA+L VS+AV++AAA
Sbjct: 64  VLKAVEHINTEISEAVLGLDASEQAFLDKTLIDLDGTDNKSRLGANAMLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG +   LPVP+MN++NGG HA+N LD QEFMI+PVGA + REA+R GA
Sbjct: 124 EEAGLPLYRYFGGMNGCQLPVPMMNVINGGAHANNTLDLQEFMIIPVGAPSFREALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK +  +G ST VGDEGGF+P+++  ++A+ LI  +I+KAGY AG+ +++ LDC
Sbjct: 184 EVFHALKKIINDRGMSTAVGDEGGFAPSVENHEAAIQLILEAIDKAGYTAGEQIVLGLDC 243

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AAS F+K  KY+L+GE  ++L   +    LA  VD+YPI SIEDGM+E DW GWK+LT +
Sbjct: 244 AASEFYKDGKYVLEGEGGIQLTAQQWTDMLAAWVDKYPIISIEDGMAEGDWDGWKLLTER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G N QLVGDDLFVTN + L +GI++ +AN+ILIK NQIG+++ET   IE A+ AGY ++
Sbjct: 304 LGKNVQLVGDDLFVTNTKILKEGIDKNIANSILIKINQIGTLTETFAAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ISHRSGETED TIAD+AV  N GQIKTGSL+RSDRIAKYNQL+RIEE LG  A++ GR+
Sbjct: 364 ISHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDVAEYPGRA 422


>gi|212695352|ref|ZP_03303480.1| hypothetical protein BACDOR_04899 [Bacteroides dorei DSM 17855]
 gi|237711627|ref|ZP_04542108.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|237725930|ref|ZP_04556411.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|265753046|ref|ZP_06088615.1| phosphopyruvate hydratase [Bacteroides sp. 3_1_33FAA]
 gi|212662081|gb|EEB22655.1| hypothetical protein BACDOR_04899 [Bacteroides dorei DSM 17855]
 gi|229435738|gb|EEO45815.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
 gi|229454322|gb|EEO60043.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263236232|gb|EEZ21727.1| phosphopyruvate hydratase [Bacteroides sp. 3_1_33FAA]
          Length = 426

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 263/425 (61%), Positives = 323/425 (76%), Gaps = 5/425 (1%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFG 59
           M I  IIARE++DSRG+PT+EVDV LE G TGRA VPSGASTG HEA ELRD +K RY G
Sbjct: 1   MKIEKIIAREILDSRGNPTVEVDVTLESGITGRASVPSGASTGEHEALELRDGDKTRYNG 60

Query: 60  KGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKA 119
           KG LKA+A VN  I  AL+GC A +Q  IDK M+ LDGTP KS+LGANAILGVSLAV+KA
Sbjct: 61  KGTLKAVANVNTIIAPALIGCSALEQRAIDKKMLALDGTPTKSKLGANAILGVSLAVAKA 120

Query: 120 AAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRM 179
           AA   ++PLY+Y+GG + +++PVP+MNI+NGG H+D  + FQEFMI PVGA +  E +RM
Sbjct: 121 AANYLDIPLYRYIGGTNTYVMPVPMMNIINGGSHSDAPIAFQEFMIRPVGAPSFHEGLRM 180

Query: 180 GAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIAL 239
           GAEVFH LKK L  +G ST VGDEGGF+P L   + A++ I  +I+ AGY  GKD++I +
Sbjct: 181 GAEVFHALKKVLHDRGLSTAVGDEGGFAPALNGTEDAIESILAAIKNAGYEPGKDVMIGM 240

Query: 240 DCAASAFFKKEKY---ILKGENLELQ-PNEMASYLANLVDQYPIYSIEDGMSEDDWHGWK 295
           DCA+S F+K   Y   I +GE  + +  +E  +YL  L+++YPI SIEDGMSE+DW GWK
Sbjct: 241 DCASSEFYKNGVYDYTIFEGETGKKRTTDEQINYLEELINKYPIDSIEDGMSENDWEGWK 300

Query: 296 ILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMA 355
            LT +IG+ CQLVGDDLFVTN E L KGI +  AN+ILIK NQIGS+SETL+ IE A   
Sbjct: 301 KLTERIGNRCQLVGDDLFVTNVEFLSKGIAQGCANSILIKVNQIGSLSETLDAIEMAHRH 360

Query: 356 GYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           GY ++ SHRSGETED TIAD+AVATN GQIKTGSL+RSDR+AKYNQL+RIEE LG  A +
Sbjct: 361 GYTTVTSHRSGETEDATIADIAVATNSGQIKTGSLSRSDRMAKYNQLLRIEEELGNLAVY 420

Query: 416 AGRSI 420
             + I
Sbjct: 421 GYKRI 425


>gi|78066882|ref|YP_369651.1| phosphopyruvate hydratase [Burkholderia sp. 383]
 gi|119369303|sp|Q39EV9|ENO_BURS3 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|77967627|gb|ABB09007.1| enolase [Burkholderia sp. 383]
          Length = 427

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 317/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E   YLA L D++PI SIEDGM E DW GWK+LT+++
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFTDYLATLADKFPIVSIEDGMHESDWEGWKLLTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|300934094|ref|ZP_07149350.1| phosphopyruvate hydratase [Corynebacterium resistens DSM 45100]
          Length = 425

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 252/417 (60%), Positives = 322/417 (77%), Gaps = 2/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I  IIARE++DSRG+PT+EV+V L+DGS GRA VPSGASTG+HEA ELRD ++RY GKGV
Sbjct: 4   IMQIIAREILDSRGNPTVEVEVGLDDGSIGRAAVPSGASTGVHEAHELRDGDERYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
           LKA+  V DEI   L+G +A DQ LID+ MI+LDGT NKSRLGANAILGVS+AV+ AAA+
Sbjct: 64  LKAVENVIDEIDDELVGMEADDQRLIDEAMIELDGTDNKSRLGANAILGVSMAVAHAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
           ++ L L++Y+GG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE   +A+RMG E
Sbjct: 124 STGLHLFRYVGGPNAHVLPVPMMNILNGGAHADSGVDVQEFMIAPIGAETFSDALRMGTE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           V+H LKK +K KG ST +GDEGGF+P++ +  +ALDLI  +IE AGY  G+++ +ALD A
Sbjct: 184 VYHQLKKVIKDKGLSTGLGDEGGFAPSVDSTKAALDLIVEAIEGAGYKLGEEIALALDVA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           +S F+K  KY  +G   E    EMA     L+DQYPI SIED + EDDW G+  LT  IG
Sbjct: 244 SSEFYKDGKYHFEGG--EHTAEEMAKVYEELIDQYPIVSIEDPLQEDDWEGYTNLTAAIG 301

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              Q+VGDD FVTNP RL +GI ++ ANA+L+K NQIG+++ET + ++ A   GY +++S
Sbjct: 302 DKVQIVGDDFFVTNPARLQEGIEKKAANALLVKVNQIGTLTETFDAVDLAHRNGYRTMMS 361

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           HRSGETED TIADLAVA NCGQIKTG+ ARS+R+AKYNQL+RIE+ L   A +AGRS
Sbjct: 362 HRSGETEDTTIADLAVALNCGQIKTGAPARSERVAKYNQLLRIEQYLDDAAVYAGRS 418


>gi|291286672|ref|YP_003503488.1| enolase [Denitrovibrio acetiphilus DSM 12809]
 gi|290883832|gb|ADD67532.1| enolase [Denitrovibrio acetiphilus DSM 12809]
          Length = 432

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 259/419 (61%), Positives = 324/419 (77%), Gaps = 4/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AREV+DSRG+PTIEV+V    G  GRA+VPSGASTG +EA ELRD +K R+ GKG
Sbjct: 4   IIDVFAREVLDSRGNPTIEVEVVTSGGVMGRAIVPSGASTGEYEAVELRDGDKERFLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VN+ +   L G D  +Q LID+++I+LDGT NK +LGANAILGVSLA +KAAA
Sbjct: 64  VLQAVQNVNEIVAPELEGIDVTEQKLIDEMLIELDGTKNKGKLGANAILGVSLACAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           ++  LPLYKY+GG  A  LP P+MNILNGG HADN +D QEFMIMP+GAE+ REA+RMG 
Sbjct: 124 ESCGLPLYKYIGGAYACTLPAPMMNILNGGEHADNNVDIQEFMIMPLGAESFREALRMGV 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLK  LK+KG ST+VGDEGGF+PNL + + A+++I  +I+KAGY AG D+ IA+D 
Sbjct: 184 EVFHTLKGVLKAKGMSTSVGDEGGFAPNLGSNEEAIEVILEAIDKAGYKAGSDIYIAIDA 243

Query: 242 AASAFFKKEK--YILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILT 298
           A+S F+ K+K  Y+L+ E   E    +M  Y   LV++YPI SIEDG+ E+DW GWK+LT
Sbjct: 244 ASSEFYNKDKGVYVLEAEAEPEKTSAQMVEYYKYLVEKYPIISIEDGLDENDWDGWKLLT 303

Query: 299 NKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYP 358
           + IG  CQLVGDDLFVTN ERL +GI   VAN+IL+K NQIG+++ETL+ I+ A+ AGY 
Sbjct: 304 DAIGDKCQLVGDDLFVTNTERLTRGIKTGVANSILVKLNQIGTLTETLDAIQTAREAGYT 363

Query: 359 SIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +ISHRSGE+ED TIADLAVA N GQIKTGS  R+DRIAKYNQL+RIEE L  QA + G
Sbjct: 364 CVISHRSGESEDTTIADLAVAVNAGQIKTGSACRTDRIAKYNQLLRIEEELFDQAAYKG 422


>gi|87307879|ref|ZP_01090022.1| enolase (2-phosphoglycerate dehydratase) [Blastopirellula marina
           DSM 3645]
 gi|87289493|gb|EAQ81384.1| enolase (2-phosphoglycerate dehydratase) [Blastopirellula marina
           DSM 3645]
          Length = 428

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 316/419 (75%), Gaps = 5/419 (1%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKR-YFGK 60
           FI DI   +V+DSRG+PT+EV+V L+DG+ GRA VPSGASTG+HEA ELRD +K  Y GK
Sbjct: 3   FIVDIRGLQVLDSRGNPTVEVEVTLDDGAMGRAAVPSGASTGVHEANELRDGDKSVYVGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV KA+  VN  +   LLG DA +Q  ID+ MI+LDGTPNKS+LGANAILGVSLAV+KAA
Sbjct: 63  GVTKAVENVNTVLAEVLLGEDALNQAEIDRKMIELDGTPNKSKLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           AQ+S LPLY+YLGG  A +LP P+MNILNGG HADN +D QEFM+MP+G +N  +A+R G
Sbjct: 123 AQSSGLPLYRYLGGVGARLLPAPMMNILNGGSHADNNVDVQEFMVMPLGFDNFSDALRCG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            EVFH+LK  LK KG +T VGDEGGF+PNL +   ALDLI  SIEKAGY  G+ + IALD
Sbjct: 183 VEVFHSLKGVLKGKGLNTAVGDEGGFAPNLGSNIEALDLIMESIEKAGYKPGEQVFIALD 242

Query: 241 CAASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILT 298
           CA+S ++  E  KY + G+  E     M  +LA+   +YPI SIEDG  EDDW GWK+LT
Sbjct: 243 CASSEYYNGETKKYTIDGK--EFDSAAMVDFLADWASKYPIVSIEDGCDEDDWEGWKLLT 300

Query: 299 NKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYP 358
            K+G   QLVGDDLFVTN ERL +GI E +AN+ILIK NQIG+++ET+N I  A   GY 
Sbjct: 301 EKLGDKVQLVGDDLFVTNTERLARGIQEGIANSILIKVNQIGTLTETINAITMAHNNGYT 360

Query: 359 SIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           S+ SHRSGETED  IADLAVA  CGQIKTGS +RSDR+AKYNQL+RIE  LG+ A + G
Sbjct: 361 SVSSHRSGETEDSFIADLAVALGCGQIKTGSASRSDRMAKYNQLLRIEAELGENAMYGG 419


>gi|296452046|ref|ZP_06893759.1| enolase [Clostridium difficile NAP08]
 gi|296879558|ref|ZP_06903539.1| enolase [Clostridium difficile NAP07]
 gi|296259119|gb|EFH06001.1| enolase [Clostridium difficile NAP08]
 gi|296429440|gb|EFH15306.1| enolase [Clostridium difficile NAP07]
          Length = 448

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 256/415 (61%), Positives = 321/415 (77%), Gaps = 3/415 (0%)

Query: 6   IIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKGVLK 64
           + AREV+DSRG+PT+EV+V LEDG+ GRA+VPSGASTG  EA ELRD +K RY GKGV  
Sbjct: 25  VYAREVLDSRGNPTVEVEVVLEDGAMGRAIVPSGASTGAFEAVELRDGDKGRYLGKGVET 84

Query: 65  AIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTS 124
           A+A VN+ I   + G DA DQ  ID IMI+LDGTPNK +LGANAILGVS+AV++AAA   
Sbjct: 85  AVANVNEIIAPEIEGMDAFDQPAIDAIMIELDGTPNKGKLGANAILGVSMAVARAAADEI 144

Query: 125 NLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVF 184
            LPL++YLGG +A  LPVP+MNILNGG HADN +D QEFMI+PVGA   +E +RMGAEVF
Sbjct: 145 GLPLFQYLGGVNAKQLPVPMMNILNGGEHADNNVDVQEFMILPVGACCFKEGLRMGAEVF 204

Query: 185 HTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAAS 244
           H+LKK L  KG +  VGDEGGF+PNL +   AL+LI  +I KAGY  G+D+++ LD AA+
Sbjct: 205 HSLKKVLGEKGLACGVGDEGGFAPNLGSNREALELIVEAITKAGYKPGEDVMLGLDVAAT 264

Query: 245 AFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
             + KE  KY+L GE  EL   EM +   +  + +PI +IEDG+ E+DW GWK+LT K+G
Sbjct: 265 EMYNKETKKYVLAGEGKELTAAEMVALYEDWSNNFPIITIEDGLDEEDWDGWKLLTEKLG 324

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           +  QLVGDDLFVTN ERL KGI   VAN+IL+K NQIG+++ETL+ IE A+ AGY ++IS
Sbjct: 325 NKLQLVGDDLFVTNTERLEKGIENGVANSILVKVNQIGTITETLDAIEMAKRAGYTAVIS 384

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           HRSGETED TIADLAVA N GQIKTG+ +R+DR+AKYNQL+RIEE +G+QA++ G
Sbjct: 385 HRSGETEDSTIADLAVAVNAGQIKTGAPSRTDRVAKYNQLLRIEEMVGEQARYCG 439


>gi|159896679|ref|YP_001542926.1| phosphopyruvate hydratase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159889718|gb|ABX02798.1| Phosphopyruvate hydratase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 428

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 251/419 (59%), Positives = 319/419 (76%), Gaps = 1/419 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I  +  REV+DSRG+PT+EV++ LEDG+  RA+VPSGASTG HEA ELRD +K RY GK
Sbjct: 3   LITHVRGREVLDSRGNPTVEVEIGLEDGTLARAIVPSGASTGAHEAVELRDGDKSRYGGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN++I  A+ G +A DQ+ +DK +I+LDGT NK +LGANAILGVSLA +KA 
Sbjct: 63  GVLKAVKHVNEDIAEAIEGLEALDQITLDKTLIELDGTKNKGKLGANAILGVSLATAKAG 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A +  LPLY+YLGG   H LPVP+MNILNGG HA ++ DFQEFM+MPVGA + REA+R G
Sbjct: 123 ALSVGLPLYRYLGGVFGHTLPVPMMNILNGGKHAQDSTDFQEFMVMPVGAPSFREALRWG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE++HTLK  L  +G +TN GDEGGF+P+L + ++AL++I  +I+KAGY  GKD+++ALD
Sbjct: 183 AEIYHTLKNVLHDRGLATNTGDEGGFAPSLPSNEAALEVIVEAIQKAGYTPGKDVMLALD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A S  ++   Y L  E  +L   EM  Y  NLV++YPI SIEDG+ EDDW  W  L  +
Sbjct: 243 PACSEIYENGIYNLAREGRKLSSEEMVGYWENLVNKYPIISIEDGLHEDDWGAWSSLRQR 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG   QLVGDDL VTN ERL++ I E  AN+ILIK NQIG+++ETL+ I+ AQ AG+ +I
Sbjct: 303 IGDRVQLVGDDLLVTNVERLNRAIKENSANSILIKLNQIGTLTETLDAIQMAQRAGWTAI 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           +SHRSGE+ED T+ADL VATN GQIKTG+ AR+DR+AKYNQL+RIEE L  QAKFAG S
Sbjct: 363 VSHRSGESEDVTVADLVVATNAGQIKTGAPARTDRVAKYNQLLRIEEELDSQAKFAGWS 421


>gi|116669708|ref|YP_830641.1| phosphopyruvate hydratase [Arthrobacter sp. FB24]
 gi|134034103|sp|A0JU21|ENO_ARTS2 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|116609817|gb|ABK02541.1| enolase [Arthrobacter sp. FB24]
          Length = 426

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 263/419 (62%), Positives = 321/419 (76%), Gaps = 3/419 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I+ I ARE++DSRG+PT+EV+V L DG  GRA VPSGASTG HEA ELRD +K RY GK
Sbjct: 3   LIDAIHAREILDSRGNPTVEVEVLLSDGQIGRAAVPSGASTGEHEAVELRDGDKGRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV KA+  V D+I  AL G DA DQ  ID+ MIDLDGTPNKS+LGANAILGVSLAV+ AA
Sbjct: 63  GVQKAVDAVIDQIAPALTGFDATDQRSIDQAMIDLDGTPNKSKLGANAILGVSLAVANAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A +++LPLYKYLGG +AH+LPVPLMNILNGG HAD+ +D QEFMI P+GAE   E +R G
Sbjct: 123 AASADLPLYKYLGGPNAHVLPVPLMNILNGGSHADSDVDIQEFMIAPIGAETFSEGLRWG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            EV+H LK  L++KG ST +GDEGGF+PNL +  +ALDLI  +I+ AGY  GKD+ +ALD
Sbjct: 183 VEVYHNLKSVLQAKGLSTGLGDEGGFAPNLPSNRAALDLIQEAIKNAGYIPGKDIALALD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A+S FFK   Y  +G+   L   EM++Y A LV  YP+ SIED + E+DW GWK LT+ 
Sbjct: 243 VASSEFFKDGAYQFEGK--ALSATEMSAYYAELVADYPLVSIEDPLDENDWEGWKTLTDA 300

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG   QLVGDDLFVTNP  L +GI+   AN++L+K NQIGS++ETL+ +  AQ AGY +I
Sbjct: 301 IGDKVQLVGDDLFVTNPSILQRGIDTATANSLLVKVNQIGSLTETLDAVSLAQRAGYTTI 360

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
            SHRSGETED TIAD+AVATN GQIKTG+ ARS+R+AKYNQL+RIEE L   A++AGRS
Sbjct: 361 TSHRSGETEDTTIADIAVATNAGQIKTGAPARSERVAKYNQLLRIEEELDDAARYAGRS 419


>gi|254392300|ref|ZP_05007484.1| phosphopyruvate hydratase [Streptomyces clavuligerus ATCC 27064]
 gi|326441412|ref|ZP_08216146.1| enolase [Streptomyces clavuligerus ATCC 27064]
 gi|197705971|gb|EDY51783.1| phosphopyruvate hydratase [Streptomyces clavuligerus ATCC 27064]
          Length = 426

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 325/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYQGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATENKGSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R G 
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGT 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LK KG +T +GDEGGF+PNL +  +ALDLI  +I++AGY  GKD+ +ALD 
Sbjct: 184 EVYHTLKKVLKQKGLATGLGDEGGFAPNLDSNRAALDLILEAIKEAGYVPGKDIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G+   L   E+  Y   LV  YP+ SIED + EDDW GWK+LT+K+
Sbjct: 244 AASEFYKDGVYEFEGK--PLSAAELTEYYEELVAAYPLVSIEDPLFEDDWAGWKVLTDKL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  Q+VGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GTKVQIVGDDLFVTNPERLARGIEEGSANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|34762728|ref|ZP_00143718.1| Enolase [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
 gi|27887627|gb|EAA24706.1| Enolase [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
          Length = 434

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 262/432 (60%), Positives = 326/432 (75%), Gaps = 19/432 (4%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+I RE++DSRG+PT+EVDV LE G  GRA VPSGASTG HEA ELRD++K RY GKG
Sbjct: 4   IVDVIGREILDSRGNPTVEVDVILECGVKGRAAVPSGASTGSHEAVELRDEDKTRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EIR ALLG DA +Q+ ID++M++LDGT NK RLGANAILGVSLAVSKAAA
Sbjct: 64  VLKAVNNVNTEIREALLGMDALNQVEIDRVMLELDGTANKGRLGANAILGVSLAVSKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLYKYLGG +A  LP+P+MNILNGG HAD+A+D QEFMI PVGA++ REA++MGA
Sbjct: 124 EALGLPLYKYLGGVNAKELPLPMMNILNGGAHADSAVDLQEFMIQPVGAKSFREAMQMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPN-LKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           EVFH L K LK+ G STNVG+EGG++P+ ++  + AL LI+ +++ AGY  GKD+  ALD
Sbjct: 184 EVFHHLGKILKANGDSTNVGNEGGYAPSKIQGTEGALSLISEAVKAAGYELGKDITFALD 243

Query: 241 CAASAF-----------FKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSED 289
            A+S F           FK+E  I++        + M  +   L+++YPI SIEDG+ ED
Sbjct: 244 AASSEFCEKVNGEYQYHFKREGGIIR------NTDAMIKWYEELINKYPIVSIEDGLGED 297

Query: 290 DWHGWKILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTI 349
           DW GW  LT  IG   Q+VGDDLFVTN ERL KGI     N+ILIK NQIGS++ETL+ I
Sbjct: 298 DWDGWVKLTKAIGDRVQIVGDDLFVTNTERLKKGIELGAGNSILIKLNQIGSLTETLDAI 357

Query: 350 EKAQMAGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESL 409
           E A+ AGY +++SHRSGETED TIAD+AVATN GQIKTGS +R+DR+AKYNQL+RIEE L
Sbjct: 358 EMAKRAGYTAVVSHRSGETEDATIADVAVATNAGQIKTGSTSRTDRMAKYNQLLRIEEEL 417

Query: 410 GKQAKFAGRSIL 421
           G  A++ GR + 
Sbjct: 418 GSVAQYKGRDVF 429


>gi|153939129|ref|YP_001389593.1| phosphopyruvate hydratase [Clostridium botulinum F str. Langeland]
 gi|170757014|ref|YP_001779861.1| phosphopyruvate hydratase [Clostridium botulinum B1 str. Okra]
 gi|166232187|sp|A7G9Y3|ENO_CLOBL RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|229463768|sp|B1IDB9|ENO_CLOBK RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|152935025|gb|ABS40523.1| phosphopyruvate hydratase [Clostridium botulinum F str. Langeland]
 gi|169122226|gb|ACA46062.1| enolase [Clostridium botulinum B1 str. Okra]
 gi|295317689|gb|ADF98066.1| phosphopyruvate hydratase [Clostridium botulinum F str. 230613]
          Length = 431

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 256/416 (61%), Positives = 320/416 (76%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AR+++DSR +PT+EV+V LEDG+ G A VPSGASTG  EA ELRD +K +Y GKG
Sbjct: 7   IVDVYARQILDSRCNPTVEVEVELEDGTVGVAAVPSGASTGAFEAVELRDGDKSKYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN  I   L+G +  DQ+ IDK MI+LDGT NK++LGANA+LGVSLA +KAAA
Sbjct: 67  VLKAVDNVNTIIADELVGMNVLDQVAIDKTMIELDGTDNKAKLGANAMLGVSLACAKAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +  + LY+Y+GG +A +LPVP+MNI+NGG HADN +D QEFMIMP GA +  EA+RM +
Sbjct: 127 NSLGMSLYQYIGGVNAKVLPVPMMNIINGGKHADNNVDLQEFMIMPAGAPSFSEALRMCS 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LK  LKS+GY T VGDEGGF+PNLK+ + A+ +I  +I++AGY  GKD+ IALD 
Sbjct: 187 EVYHALKSTLKSQGYDTGVGDEGGFAPNLKSNEEAIVVIIEAIKEAGYTPGKDIFIALDP 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S  F+  KY L GE   L P EMA+Y   L ++YPI SIEDGM+E+DW GWKILT KI
Sbjct: 247 ASSEIFEDGKYNLAGEGRVLTPEEMANYYVELAEKYPIISIEDGMAEEDWDGWKILTEKI 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTN ERL KGI   VAN+ILIK NQIG+++ETLN IE A+ AGY +++
Sbjct: 307 GNKVQLVGDDLFVTNTERLSKGIKLGVANSILIKLNQIGTLTETLNAIEMAERAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQL+RIEE L    ++ G
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLLRIEEELNDMGEYRG 422


>gi|115352195|ref|YP_774034.1| phosphopyruvate hydratase [Burkholderia ambifaria AMMD]
 gi|170699286|ref|ZP_02890335.1| Phosphopyruvate hydratase [Burkholderia ambifaria IOP40-10]
 gi|172061062|ref|YP_001808714.1| phosphopyruvate hydratase [Burkholderia ambifaria MC40-6]
 gi|122322766|sp|Q0BDS3|ENO_BURCM RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|238689174|sp|B1YT09|ENO_BURA4 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|115282183|gb|ABI87700.1| enolase [Burkholderia ambifaria AMMD]
 gi|170135778|gb|EDT04057.1| Phosphopyruvate hydratase [Burkholderia ambifaria IOP40-10]
 gi|171993579|gb|ACB64498.1| Phosphopyruvate hydratase [Burkholderia ambifaria MC40-6]
          Length = 427

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 316/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E   YLA L D++PI SIEDGM E DW GWK+LT ++
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFTDYLATLADKFPIVSIEDGMHESDWEGWKLLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|294784217|ref|ZP_06749512.1| phosphopyruvate hydratase [Fusobacterium sp. 3_1_27]
 gi|294488083|gb|EFG35434.1| phosphopyruvate hydratase [Fusobacterium sp. 3_1_27]
          Length = 434

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 263/432 (60%), Positives = 326/432 (75%), Gaps = 19/432 (4%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+I RE++DSRG+PT+EVDV LE G  GRA VPSGASTG HEA ELRD++K RY GKG
Sbjct: 4   IVDVIGREILDSRGNPTVEVDVILECGVKGRAAVPSGASTGSHEAVELRDEDKTRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EIR ALLG DA +Q+ ID++MI+LDGT NK RLGANAILGVSLAVSKAAA
Sbjct: 64  VLKAVNNVNTEIREALLGRDALNQVEIDRVMIELDGTANKGRLGANAILGVSLAVSKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLYKYLGG +A  LP+P+MNILNGG HAD+A+D QEFMI PVGA++ REA++MGA
Sbjct: 124 EALGLPLYKYLGGVNAKELPLPMMNILNGGAHADSAVDLQEFMIQPVGAKSFREAMQMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPN-LKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           EVFH L K LK+ G STNVG+EGG++P+ ++  + AL LI+ +++ AGY  GKD+  ALD
Sbjct: 184 EVFHHLGKILKANGDSTNVGNEGGYAPSKIQGTEGALSLISEAVKAAGYELGKDITFALD 243

Query: 241 CAASAF-----------FKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSED 289
            A+S F           FK+E  I++        + M  +   L+++YPI SIEDG+ ED
Sbjct: 244 AASSEFCEKVNGEYQYHFKREGGIVR------NTDAMIKWYEELINKYPIVSIEDGLGED 297

Query: 290 DWHGWKILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTI 349
           DW GW  LT  IG   Q+VGDDLFVTN ERL KGI     N+ILIK NQIGS++ETL+ I
Sbjct: 298 DWDGWVKLTQAIGDRVQIVGDDLFVTNTERLKKGIELGAGNSILIKLNQIGSLTETLDAI 357

Query: 350 EKAQMAGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESL 409
           E A+ AGY +++SHRSGETED TIAD+AVATN GQIKTGS +R+DR+AKYNQL+RIEE L
Sbjct: 358 EMAKRAGYTAVVSHRSGETEDATIADVAVATNAGQIKTGSTSRTDRMAKYNQLLRIEEEL 417

Query: 410 GKQAKFAGRSIL 421
           G  A++ GR + 
Sbjct: 418 GSVAQYKGRDVF 429


>gi|291614343|ref|YP_003524500.1| enolase [Sideroxydans lithotrophicus ES-1]
 gi|291584455|gb|ADE12113.1| enolase [Sideroxydans lithotrophicus ES-1]
          Length = 427

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 253/417 (60%), Positives = 316/417 (75%), Gaps = 1/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGKG 61
           I D++ARE++DSRG+PT+E DV LE G  GRA VPSGASTG +EA ELRD  +KRY GKG
Sbjct: 4   IVDVVAREILDSRGNPTVEADVLLESGVMGRAAVPSGASTGENEAMELRDGDKKRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  VN EI  A++G DA +Q  ID+ MIDLDGT NKSRLGANAIL VS+AV++AAA
Sbjct: 64  VLNAVENVNTEIAEAIIGLDAAEQAFIDQTMIDLDGTENKSRLGANAILAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG +   +PVP+MNI+NGG HA    D QEFMI+PVGAE+ REA+R GA
Sbjct: 124 EESGLPLYRYLGGAARMEMPVPMMNIINGGAHATGGADIQEFMIIPVGAESFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LK  L  +G +T VGDEGGF+P L + ++AL +I  +IE AGY  G D+ I +D 
Sbjct: 184 EVFHALKAILHKRGLTTTVGDEGGFAPALGSNEAALKVIVEAIEAAGYVPGADVAIGVDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY LK + L L   ++    A+ VD+YP+ ++EDGMSE DW GWK+LT+++
Sbjct: 244 AASEFYKDGKYHLKADGLTLTSAQIIDMYASWVDKYPVITLEDGMSEHDWDGWKLLTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDD+FVTN + L +GI   +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKTIQLVGDDIFVTNTKILREGIKRGIANSILIKVNQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           SHRSGETED TIADLAVATN  QIKTGSL+RSDR+AKYNQL+RIEE LG  A + GR
Sbjct: 364 SHRSGETEDSTIADLAVATNALQIKTGSLSRSDRMAKYNQLLRIEEDLGDSASYPGR 420


>gi|238020776|ref|ZP_04601202.1| hypothetical protein GCWU000324_00666 [Kingella oralis ATCC 51147]
 gi|237867756|gb|EEP68762.1| hypothetical protein GCWU000324_00666 [Kingella oralis ATCC 51147]
          Length = 428

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 260/417 (62%), Positives = 322/417 (77%), Gaps = 1/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+EI  A++G DA +Q  ID+IM++LDGT NK  LGANA L VSLAV++AAA
Sbjct: 64  VLKAVEHVNNEIAQAIIGIDATEQAYIDQIMLELDGTENKGNLGANATLAVSLAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA + REA+R GA
Sbjct: 124 EDAGLPLYRYLGGAGPMALPVPMMNVINGGEHANNSLNIQEFMIMPVGAASFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   +KG+ T VGDEGGF+PNL + + AL L+  + EKAGY AG+D+L A+DC
Sbjct: 184 EIFHHLKKLCDAKGFPTTVGDEGGFAPNLGSHEEALQLMVEATEKAGYKAGEDVLFAMDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YLA+LV +YPI SIEDGM E+DW GWK LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGKAYTSEEFAEYLADLVAKYPIISIEDGMDENDWAGWKHLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL+ ++ A+   Y S++
Sbjct: 304 GDKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLSAVDLAKRNRYTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE LG  A + G+
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELGSAAYYPGK 420


>gi|107028713|ref|YP_625808.1| phosphopyruvate hydratase [Burkholderia cenocepacia AU 1054]
 gi|116690128|ref|YP_835751.1| phosphopyruvate hydratase [Burkholderia cenocepacia HI2424]
 gi|167586764|ref|ZP_02379152.1| phosphopyruvate hydratase [Burkholderia ubonensis Bu]
 gi|170733461|ref|YP_001765408.1| phosphopyruvate hydratase [Burkholderia cenocepacia MC0-3]
 gi|206560541|ref|YP_002231306.1| phosphopyruvate hydratase [Burkholderia cenocepacia J2315]
 gi|254247801|ref|ZP_04941122.1| Enolase [Burkholderia cenocepacia PC184]
 gi|254251983|ref|ZP_04945301.1| Enolase [Burkholderia dolosa AUO158]
 gi|119369301|sp|Q1BHS0|ENO_BURCA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|134034107|sp|A0K8N1|ENO_BURCH RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|238688557|sp|B1JUY6|ENO_BURCC RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|238693115|sp|B4EDA1|ENO_BURCJ RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|105897877|gb|ABF80835.1| enolase [Burkholderia cenocepacia AU 1054]
 gi|116648217|gb|ABK08858.1| enolase [Burkholderia cenocepacia HI2424]
 gi|124872577|gb|EAY64293.1| Enolase [Burkholderia cenocepacia PC184]
 gi|124894592|gb|EAY68472.1| Enolase [Burkholderia dolosa AUO158]
 gi|169816703|gb|ACA91286.1| Phosphopyruvate hydratase [Burkholderia cenocepacia MC0-3]
 gi|198036583|emb|CAR52480.1| enolase [Burkholderia cenocepacia J2315]
          Length = 427

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 317/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E   YLA L D++PI SIEDGM E DW GWK+LT+++
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFTDYLATLADKFPIVSIEDGMHESDWDGWKLLTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|119961453|ref|YP_947047.1| phosphopyruvate hydratase [Arthrobacter aurescens TC1]
 gi|166232168|sp|A1R485|ENO_ARTAT RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|119948312|gb|ABM07223.1| enolase [Arthrobacter aurescens TC1]
          Length = 426

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 320/419 (76%), Gaps = 3/419 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I+ I ARE++DSRG+PT+EV+V L DG  GRA VPSGASTG HEA ELRD +K RY GK
Sbjct: 3   LIDAIHAREILDSRGNPTVEVEVLLSDGQIGRAAVPSGASTGEHEAVELRDGDKGRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV KA+  V DEI  AL+G DA DQ  ID+ MIDLDGTPNK +LGANAILGVSLAV+ AA
Sbjct: 63  GVQKAVDAVIDEISPALIGFDATDQRSIDQAMIDLDGTPNKGKLGANAILGVSLAVANAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A +++LPLYKYLGG +AH+LPVPLMNILNGG HAD+ +D QEFMI P+GAE   E +R G
Sbjct: 123 AASADLPLYKYLGGPNAHVLPVPLMNILNGGSHADSDVDIQEFMIAPIGAETFSEGLRWG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            EV+H LK  L+ KG ST +GDEGGF+PNL +  +ALDLI  +I+ AGY  G D+ +ALD
Sbjct: 183 VEVYHNLKAVLQEKGLSTGLGDEGGFAPNLPSNRAALDLIQEAIKNAGYTPGTDIALALD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A+S F+K+  Y  +G+   L   EM++Y A LV  YP+ SIED + E+DW GWK LT+ 
Sbjct: 243 VASSEFYKEGAYQFEGK--ALSATEMSAYYAELVADYPLVSIEDPLDENDWEGWKTLTDT 300

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG   QLVGDDLFVTNP RL +GI    AN++L+K NQIGS++ETL+ +  AQ +GY +I
Sbjct: 301 IGDKVQLVGDDLFVTNPVRLQQGIETATANSLLVKVNQIGSLTETLDAVSLAQRSGYTTI 360

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
            SHRSGETED TIAD+AVATN GQIKTG+ ARS+R+AKYNQL+RIEE L   A++AGRS
Sbjct: 361 TSHRSGETEDTTIADIAVATNAGQIKTGAPARSERVAKYNQLLRIEEELDDAARYAGRS 419


>gi|117924860|ref|YP_865477.1| enolase [Magnetococcus sp. MC-1]
 gi|134034116|sp|A0L7X8|ENO_MAGSM RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|117608616|gb|ABK44071.1| enolase [Magnetococcus sp. MC-1]
          Length = 429

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 259/422 (61%), Positives = 318/422 (75%), Gaps = 3/422 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I +I  REVIDSRG+PT+EVDV  EDG  GRA VPSGASTG  EA ELRD +K R+ GKG
Sbjct: 4   IVEIHGREVIDSRGNPTVEVDVYTEDGGFGRAAVPSGASTGSREAVELRDGDKSRFLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN  +   +LG +  DQ  ID  MI LDGT NKSRLGANAILG+S+AV+KAAA
Sbjct: 64  VRKAVDAVNTVLAEVVLGMEVADQKGIDAAMIALDGTHNKSRLGANAILGISMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
              +LPLY+YLGG +  +LPVP+MNI+NGG HADN +D QEFMIMPV A +  EAIRMGA
Sbjct: 124 DECDLPLYRYLGGTNTSLLPVPMMNIINGGAHADNNVDIQEFMIMPVAATSCTEAIRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH+LKK LKSKG +T VGDEGGF+PNL + + AL +I  +IE AGY  G+D+ +ALDC
Sbjct: 184 EVFHSLKKVLKSKGLNTAVGDEGGFAPNLGSNEEALKVIVEAIEAAGYKPGEDIKLALDC 243

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           A+S F+ KE   Y L GE   L   E+ ++  +LV +YPI SIEDG  E DW GWK++T 
Sbjct: 244 ASSEFYNKETGNYDLTGEGRVLTKQELVAFYEDLVAKYPIISIEDGFDESDWDGWKLMTE 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
            +G+  QLVGDDLFVTN + L +GI++ +AN+IL+K NQIG+++ET   +E AQ AGY +
Sbjct: 304 ALGNKIQLVGDDLFVTNSKILAEGISKGIANSILVKVNQIGTLTETFEAVEMAQRAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           +ISHRSGETED TIAD+AVA N GQIKTGS++RSDRIAKYNQLIRIEE LG  A+F G  
Sbjct: 364 VISHRSGETEDATIADIAVALNAGQIKTGSMSRSDRIAKYNQLIRIEEELGGMARFEGMK 423

Query: 420 IL 421
           + 
Sbjct: 424 VF 425


>gi|313673085|ref|YP_004051196.1| enolase [Calditerrivibrio nitroreducens DSM 19672]
 gi|312939841|gb|ADR19033.1| enolase [Calditerrivibrio nitroreducens DSM 19672]
          Length = 429

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 261/417 (62%), Positives = 316/417 (75%), Gaps = 2/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGKG 61
           I DI ARE++DSRG+PT+EV+V   +G  G A VPSGASTG  EA ELRD  +KRY GKG
Sbjct: 4   IVDIYAREILDSRGNPTVEVEVITSEGVVGTAAVPSGASTGEREAIELRDGDKKRYMGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN+ I   L G D  +Q LID+IMIDLDGT NK +LGANAIL VSLA ++AAA
Sbjct: 64  VLKAVQNVNEIIAPELEGIDVTEQKLIDEIMIDLDGTKNKEKLGANAILAVSLACARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +  LPLYKY+GG  AH LPVP+MNILNGG HADN +D QEFMIMP G +  RE +RMG 
Sbjct: 124 ISLGLPLYKYIGGAFAHTLPVPMMNILNGGKHADNNVDIQEFMIMPAGVDTFREGLRMGV 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKK L  KGYST+VGDEGGF+PNLK+ + A+++I  SIEKAGY  GKD+ +ALD 
Sbjct: 184 EVFHTLKKVLHDKGYSTSVGDEGGFAPNLKSNEEAIEVILKSIEKAGYKPGKDIYLALDA 243

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           A+S F+ K KY +  E   E   +EM  Y + L+ +YPI SIEDG++E+DW GWK LT +
Sbjct: 244 ASSEFYSKGKYNMAAEAKPEKSSDEMIEYYSYLLAKYPIISIEDGLAENDWDGWKKLTEQ 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDD+FVTN E L +GI + VAN+ILIK NQIG+++ETL  IE A+ AGY  +
Sbjct: 304 LGKKVQLVGDDIFVTNTEILAEGIKKGVANSILIKLNQIGTLTETLAAIEMAKRAGYTCV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ISHRSGETED TIADLAVATN GQIKTGSL R+DR+ KYNQL+RIE+ L  QA + G
Sbjct: 364 ISHRSGETEDTTIADLAVATNAGQIKTGSLCRTDRVCKYNQLLRIEDELLDQAYYPG 420


>gi|254976759|ref|ZP_05273231.1| enolase [Clostridium difficile QCD-66c26]
 gi|255094143|ref|ZP_05323621.1| enolase [Clostridium difficile CIP 107932]
 gi|255315895|ref|ZP_05357478.1| enolase [Clostridium difficile QCD-76w55]
 gi|255518555|ref|ZP_05386231.1| enolase [Clostridium difficile QCD-97b34]
 gi|255651675|ref|ZP_05398577.1| enolase [Clostridium difficile QCD-37x79]
 gi|260684709|ref|YP_003215994.1| enolase [Clostridium difficile CD196]
 gi|260688367|ref|YP_003219501.1| enolase [Clostridium difficile R20291]
 gi|260210872|emb|CBA66013.1| enolase [Clostridium difficile CD196]
 gi|260214384|emb|CBE06783.1| 2-phospho-d-glycerate hydro-lyase [Clostridium difficile R20291]
          Length = 430

 Score =  518 bits (1335), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 255/415 (61%), Positives = 321/415 (77%), Gaps = 3/415 (0%)

Query: 6   IIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKGVLK 64
           + AREV+DSRG+PT+EV+V LEDG+ GRA+VPSGASTG  EA ELRD +K RY GKGV  
Sbjct: 7   VYAREVLDSRGNPTVEVEVVLEDGAMGRAIVPSGASTGAFEAVELRDGDKGRYLGKGVET 66

Query: 65  AIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTS 124
           A+A VN+ I   + G DA DQ  ID IMI+LDGTPNK +LGANAILGVS+AV++AAA   
Sbjct: 67  AVANVNEIIAPEIEGMDAFDQPAIDAIMIELDGTPNKGKLGANAILGVSMAVARAAADEI 126

Query: 125 NLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVF 184
            LPL++YLGG +A  LPVP+MNILNGG HADN +D QEFMI+PVGA   +E +RMGAEVF
Sbjct: 127 GLPLFQYLGGVNAKQLPVPMMNILNGGEHADNNVDVQEFMILPVGACCFKEGLRMGAEVF 186

Query: 185 HTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAAS 244
           H+LKK L  KG +  VGDEGGF+PNL +   AL+LI  +I KAGY  G+D+++ LD AA+
Sbjct: 187 HSLKKVLGEKGLACGVGDEGGFAPNLGSNREALELIVEAITKAGYKPGEDVMLGLDVAAT 246

Query: 245 AFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
             + KE  KY+L GE  EL   EM +   +  + +PI +IEDG+ E+DW GWK+LT ++G
Sbjct: 247 EMYNKETKKYVLAGEGKELTAAEMVALYEDWSNNFPIITIEDGLDEEDWDGWKLLTERLG 306

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
           +  QLVGDDLFVTN ERL KGI   VAN+IL+K NQIG+++ETL+ IE A+ AGY ++IS
Sbjct: 307 NKLQLVGDDLFVTNTERLEKGIENGVANSILVKVNQIGTITETLDAIEMAKRAGYTAVIS 366

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           HRSGETED TIADLAVA N GQIKTG+ +R+DR+AKYNQL+RIEE +G+QA++ G
Sbjct: 367 HRSGETEDSTIADLAVAVNAGQIKTGAPSRTDRVAKYNQLLRIEEMVGEQARYCG 421


>gi|325526447|gb|EGD04029.1| enolase [Burkholderia sp. TJI49]
          Length = 427

 Score =  518 bits (1335), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 316/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E   YLA L D++PI SIEDGM E DW GWK+LT ++
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFTDYLATLADKFPIVSIEDGMHEGDWEGWKLLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|261377770|ref|ZP_05982343.1| phosphopyruvate hydratase [Neisseria cinerea ATCC 14685]
 gi|269146059|gb|EEZ72477.1| phosphopyruvate hydratase [Neisseria cinerea ATCC 14685]
          Length = 428

 Score =  518 bits (1335), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 322/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IIDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVDHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDAGLPLYRYLGGAGPMALPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   SKG+ T VGDEGGF+PNL +   AL LI  + E AGY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLIVEATEAAGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E      +E A YL  LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGRSYTSSEFAEYLEGLVNEFPIVSIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GKKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAAYYPGKA 421


>gi|320103264|ref|YP_004178855.1| enolase [Isosphaera pallida ATCC 43644]
 gi|319750546|gb|ADV62306.1| enolase [Isosphaera pallida ATCC 43644]
          Length = 429

 Score =  518 bits (1335), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/417 (61%), Positives = 319/417 (76%), Gaps = 2/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I  +  R+++DSRG+PT+EVDV L +G  GRA VPSGASTG HEA ELRD +K +Y GKG
Sbjct: 7   IAKVRGRQILDSRGNPTVEVDVTLSNGLVGRAAVPSGASTGAHEAVELRDGDKSKYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN  +    +G D  DQ  +D+ MI  DGTPNK ++GANAILGVS+A +KAAA
Sbjct: 67  VLKAVEHVNGLLAQIAVGRDPFDQTGLDRAMIAADGTPNKGKIGANAILGVSMATAKAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           Q S LPLY+YLGG  A  LP+PLMNILNGG HADN +D QEFMIMPVGA +  EA+R GA
Sbjct: 127 QLSGLPLYRYLGGPHARTLPIPLMNILNGGAHADNNVDIQEFMIMPVGAPSFSEALRCGA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LK  LK KGY+T+VGDEGGF+P+LK+   ALD+I ++I KAGY AGK++L+ALD 
Sbjct: 187 EVFHALKSVLKGKGYNTSVGDEGGFAPSLKSNTEALDVILDAIAKAGYQAGKEVLLALDL 246

Query: 242 AASAFFKKEKYILKGENLELQPN-EMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AA+ F++   Y+L+ +    + + EM  YLA+ V QYPI SIEDG++EDDW G+K+ T K
Sbjct: 247 AANEFYQDGVYLLENDAKPRKTSAEMVEYLADWVRQYPIRSIEDGLAEDDWDGFKLFTEK 306

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   Q+VGDDLFVTN ERL +GI E +AN+IL+K NQIG+++ETL  +  A +A Y SI
Sbjct: 307 LGGQVQIVGDDLFVTNTERLGRGIREGIANSILVKVNQIGTLTETLECVHMATLAKYTSI 366

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ISHRSGETED  IADLAVATN GQIKTGS +RSDRIAKYNQL+RIEE LG  A +AG
Sbjct: 367 ISHRSGETEDAFIADLAVATNAGQIKTGSASRSDRIAKYNQLLRIEEDLGSSAIYAG 423


>gi|326201360|ref|ZP_08191232.1| enolase [Clostridium papyrosolvens DSM 2782]
 gi|325988928|gb|EGD49752.1| enolase [Clostridium papyrosolvens DSM 2782]
          Length = 431

 Score =  518 bits (1335), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 252/417 (60%), Positives = 322/417 (77%), Gaps = 2/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I  + ARE++DSRG+PT+EV+V  E G  GRA VPSGASTG  EA ELRD+   RY GKG
Sbjct: 7   IESVFAREILDSRGNPTVEVEVIAEGGFVGRASVPSGASTGAFEAIELRDENSDRYMGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V+ A+  VN+ I   + G +  DQ+ +DK+MIDLDGTPNK RLGANAILGVSLAV+KAA+
Sbjct: 67  VVTAVDNVNNTIAPEVEGMNVFDQVAVDKLMIDLDGTPNKERLGANAILGVSLAVAKAAS 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   L LY+Y+GG ++  LPVP+MNI+NGG HADN+++ QEFMIMPVGAE+ +EA+RM A
Sbjct: 127 EALGLGLYQYIGGVNSKTLPVPMMNIINGGKHADNSVNIQEFMIMPVGAESFKEALRMCA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L SKG ST VGDEGGF+PNL+T + A+ +I  ++EKAGY  G D  IA+D 
Sbjct: 187 EVFHNLKKVLHSKGLSTAVGDEGGFAPNLETDEQAIQVILEAVEKAGYKPGDDFRIAIDA 246

Query: 242 AASAFFKKE-KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AA+  ++++  Y     N+     EM  Y A+LV++YPI S+EDG+SE+DW GWK+LT+K
Sbjct: 247 AATEMYQEDGSYFFWKTNIRKSKEEMVEYWADLVNKYPIISLEDGVSEEDWEGWKLLTDK 306

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +GS  QLVGDDLFVTN +RL KGI   VAN+ILIK NQIG+++ETL+ I+ A  AGY ++
Sbjct: 307 LGSKIQLVGDDLFVTNTKRLEKGIKMGVANSILIKVNQIGTLTETLDAIQMANRAGYTAV 366

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            SHRSGETED TIAD+AVATN GQIKTG+ +R+DR+AKYNQL+RIEE LG+ A+F G
Sbjct: 367 TSHRSGETEDATIADIAVATNSGQIKTGAPSRTDRVAKYNQLLRIEEELGEVAEFPG 423


>gi|312796693|ref|YP_004029615.1| Enolase [Burkholderia rhizoxinica HKI 454]
 gi|312168468|emb|CBW75471.1| Enolase (EC 4.2.1.11) [Burkholderia rhizoxinica HKI 454]
          Length = 427

 Score =  518 bits (1335), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 316/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EI  A++G DA +Q  +DK +++LDGT NKSR+GANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHVNTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRIGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+P      REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPASQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L  +E   YLA L D++PI SIEDGM E DW GWK+LT+++
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSSEFTDYLATLADKFPIVSIEDGMHESDWDGWKLLTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ A Y +++
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRASYTAVV 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRIAKYNQL+RIEE LG  A + GRS
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDIASYPGRS 421


>gi|168177563|ref|ZP_02612227.1| enolase [Clostridium botulinum NCTC 2916]
 gi|226947451|ref|YP_002802542.1| phosphopyruvate hydratase [Clostridium botulinum A2 str. Kyoto]
 gi|254783242|sp|C1FQW6|ENO_CLOBJ RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|182671146|gb|EDT83120.1| enolase [Clostridium botulinum NCTC 2916]
 gi|226841385|gb|ACO84051.1| phosphopyruvate hydratase [Clostridium botulinum A2 str. Kyoto]
          Length = 431

 Score =  518 bits (1335), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 255/416 (61%), Positives = 319/416 (76%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AR+++DSR +PT+EV+V LEDG+ G A VPSGASTG  EA ELRD +K +Y GKG
Sbjct: 7   IVDVYARQILDSRCNPTVEVEVELEDGTVGVAAVPSGASTGAFEAVELRDGDKSQYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN  I   L+G +  DQ+ IDK MI+LDGT NK++LGANA+LGVSLA +KAAA
Sbjct: 67  VLKAVDNVNTTIADELVGMNVLDQVAIDKTMIELDGTDNKAKLGANAMLGVSLACAKAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +  + LY+Y+GG +  +LPVP+MNI+NGG HADN +D QEFMIMP GA +  EA+RM +
Sbjct: 127 NSLGMSLYQYIGGVNGKVLPVPMMNIINGGKHADNNVDLQEFMIMPAGAPSFSEALRMCS 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LK  LK++GY T VGDEGGF+PNLK+ + A+ +I  +I+KAGY  GKD+ IALD 
Sbjct: 187 EVYHALKSTLKAQGYDTGVGDEGGFAPNLKSNEEAIVVIIEAIKKAGYTPGKDIFIALDP 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S  F+  KY L GE   L P EMA+Y   L ++YPI SIEDGM+E+DW GWKILT KI
Sbjct: 247 ASSEIFEDGKYNLAGEGRVLTPEEMANYYVELAEKYPIISIEDGMAEEDWDGWKILTEKI 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTN ERL KGI   VAN+ILIK NQIG+++ETLN IE A+ AGY +++
Sbjct: 307 GNKVQLVGDDLFVTNTERLSKGIKLGVANSILIKLNQIGTLTETLNAIEMAERAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQL+RIEE L    ++ G
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLLRIEEELNDMGEYRG 422


>gi|310639660|ref|YP_003944418.1| enolase (2-phosphoglycerate dehydratase) [Paenibacillus polymyxa
           SC2]
 gi|309244610|gb|ADO54177.1| enolase (2-phosphoglycerate dehydratase) [Paenibacillus polymyxa
           SC2]
          Length = 428

 Score =  518 bits (1335), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 255/416 (61%), Positives = 324/416 (77%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I+D+ AREV+DSRG+PT+EV+V LE G+ GRA+VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   ISDVYAREVLDSRGNPTVEVEVYLESGAIGRAIVPSGASTGAHEAVELRDNDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VN+ I   ++G DA +Q+ ID +MI LDGTPNK +LGANAIL VS+AV++AAA
Sbjct: 64  VLQAVKNVNEIIAPEVIGLDAVNQVEIDTLMIKLDGTPNKGKLGANAILAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY YLGG +A  LPVP+MNI+NGG HADN +D QEFM++PVGA   +EA+R+GA
Sbjct: 124 EALGLPLYTYLGGFNAKQLPVPMMNIVNGGAHADNNVDVQEFMVLPVGAPTFKEALRVGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LK  L SKG +T VGDEGGF+PN K+ + AL  I  +IEKAGY  G D+ + +D 
Sbjct: 184 EIFHNLKSVLNSKGLNTAVGDEGGFAPNFKSNEEALSTIIEAIEKAGYKPGVDVFLGMDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ FFK  KY L+GE       E    LA+ VD+YPI +IEDG SEDDW GWK+LT K+
Sbjct: 244 ASTEFFKDGKYTLEGEGKSFTSAEFVDLLASWVDKYPIITIEDGCSEDDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTN ERL KGI+E + N+ILIK NQIG+++ET + IE A+ AGY ++I
Sbjct: 304 GNKIQLVGDDLFVTNTERLAKGIDENIGNSILIKVNQIGTLTETFDAIELAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGE+ED TIAD+AVATN GQIKTG+ +R+DRIAKYNQL+RIE+ LG+ A++ G
Sbjct: 364 SHRSGESEDSTIADIAVATNAGQIKTGAPSRTDRIAKYNQLLRIEDQLGELAQYHG 419


>gi|271969770|ref|YP_003343966.1| phosphopyruvate hydratase [Streptosporangium roseum DSM 43021]
 gi|270512945|gb|ACZ91223.1| Phosphopyruvate hydratase [Streptosporangium roseum DSM 43021]
          Length = 425

 Score =  518 bits (1335), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 260/417 (62%), Positives = 323/417 (77%), Gaps = 2/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I  + ARE++DSRG+PTIEVD+ L+DGS  RA VPSGASTG  EA ELRD ++RY GKGV
Sbjct: 4   IEGVTAREILDSRGNPTIEVDILLDDGSEARAAVPSGASTGQFEAVELRDGDERYGGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  V DEI   +LG DA +Q  ID++MIDLDGTPNK+RLGANAILGVSLAV+KAAA+
Sbjct: 64  EKAVLGVTDEIADEILGFDAAEQRSIDQVMIDLDGTPNKARLGANAILGVSLAVAKAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
           ++ LPL++YLGG +AH+LPVP+MNI+NGG HAD  +D QEFMI P+GAE+ REA+RMG E
Sbjct: 124 SAELPLFRYLGGPNAHVLPVPMMNIVNGGAHADTNVDIQEFMIAPIGAESFREAVRMGTE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           V+H LK  LK KGY+T +GDEGGF+PNL +   ALDLI  +IEKAGY  G+D+ +ALD A
Sbjct: 184 VYHALKAVLKEKGYATGLGDEGGFAPNLPSNRDALDLILVAIEKAGYVPGEDIGLALDAA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           AS F+K   Y + G+   L   E+ ++  +LV  YP+ SIED + E DW GW  LT  IG
Sbjct: 244 ASEFYKDGLYTIDGKG--LSAAELIAFYEDLVANYPLVSIEDPLDESDWEGWNALTRAIG 301

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTNPERL +GI E  ANA+L+K NQIG+++ETL+ ++ A   GY  ++S
Sbjct: 302 DKVQLVGDDLFVTNPERLSRGIAEGTANALLVKVNQIGTLTETLDAVDLAHRNGYRCMMS 361

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           HRSGETED TIADLAVATNCGQIKTG+ ARSDR+AKYNQL+RIEE L   A++AGR+
Sbjct: 362 HRSGETEDTTIADLAVATNCGQIKTGAPARSDRVAKYNQLLRIEELLDDAARYAGRA 418


>gi|94968099|ref|YP_590147.1| phosphopyruvate hydratase [Candidatus Koribacter versatilis
           Ellin345]
 gi|119369289|sp|Q1ISS7|ENO_ACIBL RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|94550149|gb|ABF40073.1| enolase [Candidatus Koribacter versatilis Ellin345]
          Length = 433

 Score =  518 bits (1334), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/420 (61%), Positives = 320/420 (76%), Gaps = 3/420 (0%)

Query: 1   MF-INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYF 58
           MF I  + ARE++DSRG+PT+E +V L  G+ GRA VPSGASTG HEA ELRD +  RY 
Sbjct: 1   MFDITLVHAREILDSRGNPTVEAEVTLSGGAVGRAAVPSGASTGEHEAVELRDGDNARYL 60

Query: 59  GKGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSK 118
           GKGVLKA+  V  EI  AL G DA  Q  ID  M+DLDGT NK RLGANAIL VS+A ++
Sbjct: 61  GKGVLKAVENVEGEIAQALGGMDASQQRDIDMRMLDLDGTENKGRLGANAILAVSMASAR 120

Query: 119 AAAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIR 178
           A A   ++PLY+YLGG + +ILPVP+MNILNGG HADN +DFQEFM MPVGAE+  EA+R
Sbjct: 121 AVANQLDIPLYRYLGGVNGNILPVPMMNILNGGAHADNNVDFQEFMAMPVGAESFSEALR 180

Query: 179 MGAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIA 238
            GAEVFHTLK  LK +GY+T VGDEGGF+P+LK+   A+++I  +I++AGY  G+ + IA
Sbjct: 181 WGAEVFHTLKGVLKKRGYNTAVGDEGGFAPSLKSNVEAIEVILEAIQQAGYTPGEQIAIA 240

Query: 239 LDCAASAFFKKEKYIL-KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           LD AAS FFK  KYI  K +  E    +M  + ++  ++YPI SIEDG++EDDW GWK+L
Sbjct: 241 LDPAASEFFKDGKYIFKKSDKSEKTSEQMVRWWSDWANKYPIVSIEDGLAEDDWEGWKLL 300

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T+++G   QLVGDDLFVTNPERL +GI+  VAN+ILIK NQIG++SETL+ IE A+  GY
Sbjct: 301 TDELGDKIQLVGDDLFVTNPERLARGIDNGVANSILIKVNQIGTLSETLDAIEMARRNGY 360

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            ++ISHRSGETED  IADLAVAT  GQIKTGS +R+DR+AKYNQL+RIEE LG  A+F G
Sbjct: 361 TAVISHRSGETEDTFIADLAVATGAGQIKTGSASRTDRVAKYNQLLRIEEQLGAGARFLG 420


>gi|170760746|ref|YP_001785561.1| phosphopyruvate hydratase [Clostridium botulinum A3 str. Loch
           Maree]
 gi|238688507|sp|B1KTJ8|ENO_CLOBM RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|169407735|gb|ACA56146.1| phosphopyruvate hydratase [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 431

 Score =  518 bits (1334), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 257/416 (61%), Positives = 317/416 (76%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGKG 61
           I D+ AR+++DSR +PT+EV+V LEDG+ G A VPSGASTG  EA ELRD  E +Y GKG
Sbjct: 7   IVDVYARQILDSRCNPTVEVEVELEDGTVGVAAVPSGASTGAFEAVELRDGDESKYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN  I   L+G +  DQ+ IDK MI+LDGT NK++LGANA+LGVSLA +KAAA
Sbjct: 67  VLKAVDNVNTIIADELVGMNVLDQVAIDKTMIELDGTDNKAKLGANAMLGVSLACAKAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               + LY+Y+GG +A +LPVP+MNI+NGG HADN +D QEFMIMP GA +  EA+RM +
Sbjct: 127 NFLGMSLYQYIGGVNAKVLPVPMMNIINGGKHADNNVDLQEFMIMPAGAPSFSEALRMCS 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LK  LKS+GY T VGDEGGF+PNLK+ + A+ +I  +I+KAGY  GKD+ IALD 
Sbjct: 187 EVYHALKSTLKSQGYDTGVGDEGGFAPNLKSNEEAIVVIIEAIKKAGYTPGKDIFIALDP 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S  F+  KY L GE   L P EMA+Y   L ++YPI SIEDGM+E+DW GWKILT KI
Sbjct: 247 ASSEIFEDGKYNLAGEGRVLTPEEMANYYVELAEKYPIISIEDGMAEEDWDGWKILTEKI 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN ERL KGI   VAN+ILIK NQIG+++ETLN IE A+ AGY +++
Sbjct: 307 GDKVQLVGDDLFVTNTERLAKGIKLGVANSILIKLNQIGTLTETLNAIEMAERAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQL+RIEE L    ++ G
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLLRIEEELNDMGEYRG 422


>gi|134296288|ref|YP_001120023.1| phosphopyruvate hydratase [Burkholderia vietnamiensis G4]
 gi|166232180|sp|A4JFY5|ENO_BURVG RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|134139445|gb|ABO55188.1| enolase [Burkholderia vietnamiensis G4]
          Length = 427

 Score =  518 bits (1334), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 316/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E   YLA L D++PI SIEDGM E DW GWK+LT ++
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFTDYLATLADKFPIVSIEDGMHEGDWDGWKLLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|29376483|ref|NP_815637.1| enolase [Enterococcus faecalis V583]
 gi|227519303|ref|ZP_03949352.1| phosphopyruvate hydratase [Enterococcus faecalis TX0104]
 gi|229545456|ref|ZP_04434181.1| phosphopyruvate hydratase [Enterococcus faecalis TX1322]
 gi|229549700|ref|ZP_04438425.1| phosphopyruvate hydratase [Enterococcus faecalis ATCC 29200]
 gi|255972398|ref|ZP_05422984.1| enolase [Enterococcus faecalis T1]
 gi|255975501|ref|ZP_05426087.1| enolase [Enterococcus faecalis T2]
 gi|256619435|ref|ZP_05476281.1| enolase [Enterococcus faecalis ATCC 4200]
 gi|256762890|ref|ZP_05503470.1| enolase [Enterococcus faecalis T3]
 gi|256853476|ref|ZP_05558846.1| enolase [Enterococcus faecalis T8]
 gi|256959274|ref|ZP_05563445.1| enolase [Enterococcus faecalis DS5]
 gi|256961550|ref|ZP_05565721.1| enolase [Enterococcus faecalis Merz96]
 gi|256964766|ref|ZP_05568937.1| enolase [Enterococcus faecalis HIP11704]
 gi|257079341|ref|ZP_05573702.1| enolase [Enterococcus faecalis JH1]
 gi|257082219|ref|ZP_05576580.1| enolase [Enterococcus faecalis E1Sol]
 gi|257084837|ref|ZP_05579198.1| enolase [Enterococcus faecalis Fly1]
 gi|257087166|ref|ZP_05581527.1| enolase [Enterococcus faecalis D6]
 gi|257090243|ref|ZP_05584604.1| enolase [Enterococcus faecalis CH188]
 gi|257416397|ref|ZP_05593391.1| enolase [Enterococcus faecalis AR01/DG]
 gi|257419642|ref|ZP_05596636.1| enolase [Enterococcus faecalis T11]
 gi|257422250|ref|ZP_05599240.1| enolase [Enterococcus faecalis X98]
 gi|293384690|ref|ZP_06630545.1| phosphopyruvate hydratase [Enterococcus faecalis R712]
 gi|293387390|ref|ZP_06631945.1| phosphopyruvate hydratase [Enterococcus faecalis S613]
 gi|294779757|ref|ZP_06745144.1| phosphopyruvate hydratase [Enterococcus faecalis PC1.1]
 gi|300860153|ref|ZP_07106240.1| phosphopyruvate hydratase [Enterococcus faecalis TUSoD Ef11]
 gi|307268152|ref|ZP_07549539.1| phosphopyruvate hydratase [Enterococcus faecalis TX4248]
 gi|307272847|ref|ZP_07554094.1| phosphopyruvate hydratase [Enterococcus faecalis TX0855]
 gi|307275900|ref|ZP_07557033.1| phosphopyruvate hydratase [Enterococcus faecalis TX2134]
 gi|307277682|ref|ZP_07558768.1| phosphopyruvate hydratase [Enterococcus faecalis TX0860]
 gi|307287894|ref|ZP_07567927.1| phosphopyruvate hydratase [Enterococcus faecalis TX0109]
 gi|307295923|ref|ZP_07575755.1| phosphopyruvate hydratase [Enterococcus faecalis TX0411]
 gi|312900893|ref|ZP_07760187.1| phosphopyruvate hydratase [Enterococcus faecalis TX0470]
 gi|312902740|ref|ZP_07761944.1| phosphopyruvate hydratase [Enterococcus faecalis TX0635]
 gi|312908324|ref|ZP_07767288.1| phosphopyruvate hydratase [Enterococcus faecalis DAPTO 512]
 gi|312910602|ref|ZP_07769444.1| phosphopyruvate hydratase [Enterococcus faecalis DAPTO 516]
 gi|312951299|ref|ZP_07770200.1| phosphopyruvate hydratase [Enterococcus faecalis TX0102]
 gi|13124132|sp|Q9K596|ENO_ENTFA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|8670811|emb|CAB94910.1| enolase [Enterococcus faecalis]
 gi|29343947|gb|AAO81707.1| enolase [Enterococcus faecalis V583]
 gi|227073232|gb|EEI11195.1| phosphopyruvate hydratase [Enterococcus faecalis TX0104]
 gi|229305180|gb|EEN71176.1| phosphopyruvate hydratase [Enterococcus faecalis ATCC 29200]
 gi|229309372|gb|EEN75359.1| phosphopyruvate hydratase [Enterococcus faecalis TX1322]
 gi|255963416|gb|EET95892.1| enolase [Enterococcus faecalis T1]
 gi|255968373|gb|EET98995.1| enolase [Enterococcus faecalis T2]
 gi|256598962|gb|EEU18138.1| enolase [Enterococcus faecalis ATCC 4200]
 gi|256684141|gb|EEU23836.1| enolase [Enterococcus faecalis T3]
 gi|256711935|gb|EEU26973.1| enolase [Enterococcus faecalis T8]
 gi|256949770|gb|EEU66402.1| enolase [Enterococcus faecalis DS5]
 gi|256952046|gb|EEU68678.1| enolase [Enterococcus faecalis Merz96]
 gi|256955262|gb|EEU71894.1| enolase [Enterococcus faecalis HIP11704]
 gi|256987371|gb|EEU74673.1| enolase [Enterococcus faecalis JH1]
 gi|256990249|gb|EEU77551.1| enolase [Enterococcus faecalis E1Sol]
 gi|256992867|gb|EEU80169.1| enolase [Enterococcus faecalis Fly1]
 gi|256995196|gb|EEU82498.1| enolase [Enterococcus faecalis D6]
 gi|256999055|gb|EEU85575.1| enolase [Enterococcus faecalis CH188]
 gi|257158225|gb|EEU88185.1| enolase [Enterococcus faecalis ARO1/DG]
 gi|257161470|gb|EEU91430.1| enolase [Enterococcus faecalis T11]
 gi|257164074|gb|EEU94034.1| enolase [Enterococcus faecalis X98]
 gi|291077997|gb|EFE15361.1| phosphopyruvate hydratase [Enterococcus faecalis R712]
 gi|291083181|gb|EFE20144.1| phosphopyruvate hydratase [Enterococcus faecalis S613]
 gi|294453131|gb|EFG21546.1| phosphopyruvate hydratase [Enterococcus faecalis PC1.1]
 gi|295113226|emb|CBL31863.1| enolase [Enterococcus sp. 7L76]
 gi|300849192|gb|EFK76942.1| phosphopyruvate hydratase [Enterococcus faecalis TUSoD Ef11]
 gi|306496254|gb|EFM65833.1| phosphopyruvate hydratase [Enterococcus faecalis TX0411]
 gi|306501039|gb|EFM70346.1| phosphopyruvate hydratase [Enterococcus faecalis TX0109]
 gi|306505561|gb|EFM74745.1| phosphopyruvate hydratase [Enterococcus faecalis TX0860]
 gi|306507230|gb|EFM76367.1| phosphopyruvate hydratase [Enterococcus faecalis TX2134]
 gi|306510461|gb|EFM79484.1| phosphopyruvate hydratase [Enterococcus faecalis TX0855]
 gi|306515542|gb|EFM84070.1| phosphopyruvate hydratase [Enterococcus faecalis TX4248]
 gi|310625738|gb|EFQ09021.1| phosphopyruvate hydratase [Enterococcus faecalis DAPTO 512]
 gi|310630735|gb|EFQ14018.1| phosphopyruvate hydratase [Enterococcus faecalis TX0102]
 gi|310633794|gb|EFQ17077.1| phosphopyruvate hydratase [Enterococcus faecalis TX0635]
 gi|311289150|gb|EFQ67706.1| phosphopyruvate hydratase [Enterococcus faecalis DAPTO 516]
 gi|311291992|gb|EFQ70548.1| phosphopyruvate hydratase [Enterococcus faecalis TX0470]
 gi|315025966|gb|EFT37898.1| phosphopyruvate hydratase [Enterococcus faecalis TX2137]
 gi|315028887|gb|EFT40819.1| phosphopyruvate hydratase [Enterococcus faecalis TX4000]
 gi|315033278|gb|EFT45210.1| phosphopyruvate hydratase [Enterococcus faecalis TX0017]
 gi|315034516|gb|EFT46448.1| phosphopyruvate hydratase [Enterococcus faecalis TX0027]
 gi|315143391|gb|EFT87407.1| phosphopyruvate hydratase [Enterococcus faecalis TX2141]
 gi|315147623|gb|EFT91639.1| phosphopyruvate hydratase [Enterococcus faecalis TX4244]
 gi|315149210|gb|EFT93226.1| phosphopyruvate hydratase [Enterococcus faecalis TX0012]
 gi|315152605|gb|EFT96621.1| phosphopyruvate hydratase [Enterococcus faecalis TX0031]
 gi|315157290|gb|EFU01307.1| phosphopyruvate hydratase [Enterococcus faecalis TX0043]
 gi|315159875|gb|EFU03892.1| phosphopyruvate hydratase [Enterococcus faecalis TX0312]
 gi|315161357|gb|EFU05374.1| phosphopyruvate hydratase [Enterococcus faecalis TX0645]
 gi|315163654|gb|EFU07671.1| phosphopyruvate hydratase [Enterococcus faecalis TX1302]
 gi|315167514|gb|EFU11531.1| phosphopyruvate hydratase [Enterococcus faecalis TX1341]
 gi|315169369|gb|EFU13386.1| phosphopyruvate hydratase [Enterococcus faecalis TX1342]
 gi|315574568|gb|EFU86759.1| phosphopyruvate hydratase [Enterococcus faecalis TX0309B]
 gi|315576670|gb|EFU88861.1| phosphopyruvate hydratase [Enterococcus faecalis TX0630]
 gi|315581790|gb|EFU93981.1| phosphopyruvate hydratase [Enterococcus faecalis TX0309A]
 gi|323481097|gb|ADX80536.1| enolase [Enterococcus faecalis 62]
 gi|327535476|gb|AEA94310.1| enolase [Enterococcus faecalis OG1RF]
          Length = 432

 Score =  518 bits (1334), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 256/420 (60%), Positives = 323/420 (76%), Gaps = 6/420 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI AREV+DSRG+PTIEV+V  E G+ GR MVPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   ITDIYAREVLDSRGNPTIEVEVYTESGAFGRGMVPSGASTGEYEAVELRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ I  A++G D RDQ+ IDK MIDLDGTPNK +LGANAILGVS+AV++AAA
Sbjct: 64  VTKAVDNVNNIIAEAIIGYDVRDQMAIDKAMIDLDGTPNKGKLGANAILGVSIAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY YLGG +  +LP P+MNI+NGG HADN++DFQEFMIMPVGA   +EA+RMGA
Sbjct: 124 DYLEVPLYHYLGGFNTKVLPTPMMNIINGGSHADNSIDFQEFMIMPVGAPTFKEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH L   LK +G +T+VGDEGGF+PNL + +   ++I  +IEKAGY  GKD+++A+D 
Sbjct: 184 EVFHALASILKGRGLATSVGDEGGFAPNLGSNEEGFEVIIEAIEKAGYVPGKDVVLAMDA 243

Query: 242 AASAFFKKEK--YIL--KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           A+S F+ KEK  Y+L   GE  E    EM ++   LV +YPI SIEDG+ E+DW G+K L
Sbjct: 244 ASSEFYDKEKGVYVLADSGEG-EKTTEEMIAFYEELVSKYPIISIEDGLDENDWDGFKKL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T  +G   QLVGDDLFVTN  +L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY
Sbjct: 303 TEVLGDKVQLVGDDLFVTNTTKLAEGIEKGIANSILIKVNQIGTLTETFEAIEMAKEAGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +++SHRSGETED TI+D+AVATN GQIKTGSL+R+DRIAKYNQL+RIE+ LG  A++ G
Sbjct: 363 TAVVSHRSGETEDSTISDIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGDVAEYKG 422


>gi|167837144|ref|ZP_02464027.1| phosphopyruvate hydratase [Burkholderia thailandensis MSMB43]
          Length = 427

 Score =  518 bits (1334), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 316/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILGDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E   YLA L D++PI SIEDGM E DW GWK+LT ++
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFTDYLATLADKFPIVSIEDGMHESDWDGWKLLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|149928510|ref|ZP_01916742.1| phosphopyruvate hydratase [Limnobacter sp. MED105]
 gi|149822770|gb|EDM82025.1| phosphopyruvate hydratase [Limnobacter sp. MED105]
          Length = 427

 Score =  518 bits (1334), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 252/418 (60%), Positives = 316/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+I REVIDSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDVIGREVIDSRGNPTVECDVLLESGAMGRAAVPSGASTGTREAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  +N EI  A+LG DA++Q+ +D+ +IDLDGT NKSRLGANA L VS+AV++AAA
Sbjct: 64  VLRAVENINTEISEAILGLDAQEQVFLDQNLIDLDGTENKSRLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG     LPVP+MN++NGG HA+N LD QEFMI+PVGA + REAIR GA
Sbjct: 124 EETGLPLYRYFGGMGGMSLPVPMMNVINGGAHANNNLDLQEFMILPVGAPSFREAIRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK +  KG ST VGDEGGF+P++   ++A+ +I  +IE AG+  G  + + LDC
Sbjct: 184 EVFHALKKIIHDKGMSTAVGDEGGFAPSVANHEAAIQMIIQAIETAGFEPGTQIALGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY L GE +EL   E A  L +  ++YPI SIEDGM+EDDW GW  L+  +
Sbjct: 244 AASEFYKGGKYKLAGEGMELSSQEFAHLLESWCNKYPIISIEDGMAEDDWDGWAYLSKTM 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN + L +GI +++AN+ILIK NQIG+++ET   IE A+ A Y ++I
Sbjct: 304 GRKVQLVGDDLFVTNTKILAEGIEKKIANSILIKINQIGTLTETFAAIEMAKRARYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV TN  QIKTGS++RSDRIAKYNQL+RIEE LG  A + GRS
Sbjct: 364 SHRSGETEDSTIADIAVGTNAMQIKTGSMSRSDRIAKYNQLLRIEEDLGDIAYYPGRS 421


>gi|237742905|ref|ZP_04573386.1| enolase [Fusobacterium sp. 4_1_13]
 gi|229430553|gb|EEO40765.1| enolase [Fusobacterium sp. 4_1_13]
          Length = 434

 Score =  518 bits (1334), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 262/432 (60%), Positives = 327/432 (75%), Gaps = 19/432 (4%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+I RE++DSRG+PT+EVDV LE G+ GRA VPSGASTG HEA ELRD++K RY GKG
Sbjct: 4   IVDVIGREILDSRGNPTVEVDVILECGARGRAAVPSGASTGSHEAVELRDEDKTRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EIR ALLG DA +Q+ ID++MI+LDGT NK RLGANAILGVSLAVSKAAA
Sbjct: 64  VLKAVNNVNTEIREALLGRDALNQVEIDRVMIELDGTANKGRLGANAILGVSLAVSKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLYKYLGG +A  LP+P+MNILNGG HAD+A+D QEFMI PVGA++ REA++MGA
Sbjct: 124 EALGLPLYKYLGGVNAKELPLPMMNILNGGAHADSAVDLQEFMIQPVGAKSFREAMQMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPN-LKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           EVFH L K LK+ G STNVG+EGG++P+ ++  + AL LI+ +++ AGY  GKD+  ALD
Sbjct: 184 EVFHHLGKILKANGDSTNVGNEGGYAPSKIQGTEGALSLISEAVKAAGYELGKDITFALD 243

Query: 241 CAASAF-----------FKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSED 289
            A+S F           FK+E  I++        + M  +   L+++YPI SIEDG+ ED
Sbjct: 244 AASSEFCEKVNGEYQYHFKREGGIVR------NTDAMIKWYEELINKYPIVSIEDGLGED 297

Query: 290 DWHGWKILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTI 349
           DW GW  LT  IG   Q+VGDDLFVTN ERL KGI     N+ILIK NQIGS++ETL+ I
Sbjct: 298 DWDGWIKLTKAIGDRVQIVGDDLFVTNTERLKKGIELGAGNSILIKLNQIGSLTETLDAI 357

Query: 350 EKAQMAGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESL 409
           E A+ AGY +++SHRSGETED TIAD+AVATN GQIKTGS +R+DR+AKYNQL+RIEE L
Sbjct: 358 EMAKRAGYTAVVSHRSGETEDATIADVAVATNAGQIKTGSTSRTDRMAKYNQLLRIEEEL 417

Query: 410 GKQAKFAGRSIL 421
           G  A++ G+ + 
Sbjct: 418 GSVAQYKGKDVF 429


>gi|332528284|ref|ZP_08404289.1| enolase [Hylemonella gracilis ATCC 19624]
 gi|332042304|gb|EGI78625.1| enolase [Hylemonella gracilis ATCC 19624]
          Length = 428

 Score =  518 bits (1333), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 255/419 (60%), Positives = 325/419 (77%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIVGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  ++LG DA +Q  +DK +IDLDGT NKSRLGANA+L VS+AV++AAA
Sbjct: 64  VLKAVEHINTEISESVLGLDAAEQSFLDKTLIDLDGTDNKSRLGANAMLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG SA  +PVP+MN++NGG HA+N+LD QEFMI+PVGA + RE++R GA
Sbjct: 124 EEAGLPLYRYFGGMSAVQMPVPMMNVINGGAHANNSLDLQEFMILPVGATSFRESLRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK + +KG  T+VGDEGGF+PN+   ++A+ LI  +I  AGY AG  + + LDC
Sbjct: 184 EVFHALKKIIDAKGMPTSVGDEGGFAPNVANHEAAIQLILEAIASAGYEAGSQIALGLDC 243

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           A+S F+K+ KY+L+GE  L+L   E    LA   D+YPI SIEDGM+E DW GWK LT +
Sbjct: 244 ASSEFYKEGKYVLEGEGGLKLSAPEWTDMLATWCDKYPIISIEDGMAEGDWEGWKTLTER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN + L +GI++ +AN+ILIK NQIG++SET   IE A+ AGY ++
Sbjct: 304 LGKKVQLVGDDLFVTNTKILKEGIDKSIANSILIKINQIGTLSETFAAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ISHRSGETED TIAD+AV TN GQIKTGSL+RSDR+AKYNQL+RIEE LG+ A + GR+
Sbjct: 364 ISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRMAKYNQLLRIEEDLGEVAVYPGRA 422


>gi|121604091|ref|YP_981420.1| phosphopyruvate hydratase [Polaromonas naphthalenivorans CJ2]
 gi|166232215|sp|A1VLH1|ENO_POLNA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|120593060|gb|ABM36499.1| enolase [Polaromonas naphthalenivorans CJ2]
          Length = 428

 Score =  518 bits (1333), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 257/419 (61%), Positives = 326/419 (77%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ RE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIVGREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+ ++N+EI  A+LG DA +Q  +D+ +I+LDGT NKSRLGANA+L VS+AV++AAA
Sbjct: 64  VLKAVGYINNEISEAVLGLDASEQAFLDRTLIELDGTENKSRLGANAMLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG +A  +PVP+MN++NGG HA+N LD QE MI+P+GA + REA+R GA
Sbjct: 124 EEAGLPLYRYFGGMAAVQMPVPMMNVINGGEHANNNLDLQELMIIPLGAPSFREALRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTA-DSALDLIANSIEKAGYNAGKDLLIALD 240
           EVFH LKK L  KG ST VGDEGGF+PN+    ++A+ +I  +I+KAGY AG+ + + LD
Sbjct: 184 EVFHALKKILHDKGISTAVGDEGGFAPNVPGGHEAAIQMILEAIDKAGYVAGEQIALGLD 243

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           CAAS F+K  KY L GE L L   E    LA  VD+YPI SIEDGM+E DW GWKILT++
Sbjct: 244 CAASEFYKDGKYELSGEGLSLSAQEWTDMLATWVDKYPIISIEDGMAEGDWDGWKILTDR 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G N Q+VGDDLFVTN + L +GI++ +AN+ILIK NQIG+++ET   IE A+ AGY ++
Sbjct: 304 LGKNVQIVGDDLFVTNTKILKEGIDKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ISHRSGETED TIAD+AV TN GQIKTGSL+RSDR+AKYNQL+RIEE LG+ A + GRS
Sbjct: 364 ISHRSGETEDSTIADIAVGTNAGQIKTGSLSRSDRMAKYNQLLRIEEDLGEVASYPGRS 422


>gi|221133352|ref|ZP_03559657.1| phosphopyruvate hydratase [Glaciecola sp. HTCC2999]
          Length = 430

 Score =  518 bits (1333), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 256/422 (60%), Positives = 315/422 (74%), Gaps = 5/422 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I+ II REV+DSRG+PT+E DV LE G  GRA+ PSGASTG  EA ELRD +K RY GKG
Sbjct: 4   ISRIIGREVLDSRGNPTVEADVYLESGVMGRAVAPSGASTGSREALELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+A +ND+I  AL+G DA DQ  ID++MIDLDGT NK  LGANAIL VSLAV+KA A
Sbjct: 64  VLKAVAAINDKITPALIGLDAADQANIDQVMIDLDGTENKEVLGANAILAVSLAVAKAEA 123

Query: 122 QTSNLPLYKYL----GGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAI 177
             + +PLY+++    G    + +PVP+MNI+NGG HADN +D QEFM+ PVGA N +EA+
Sbjct: 124 IATGIPLYEHIANLNGTPGQYSMPVPMMNIINGGEHADNNIDIQEFMVQPVGAANFKEAL 183

Query: 178 RMGAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLI 237
           RMGAE+FH+LKK L +KG +T VGDEGGF+PNL + + AL  I  ++E AGY    D+ +
Sbjct: 184 RMGAEIFHSLKKVLNAKGLNTAVGDEGGFAPNLGSNEEALSTIITAVENAGYKMNDDITL 243

Query: 238 ALDCAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           ALDCAAS F+K  +Y+L GE+          YLA L  +YPI SIEDG+ E DW GW  L
Sbjct: 244 ALDCAASEFYKDNQYVLSGEDKSFDSEGFGDYLAELSQRYPIVSIEDGLDESDWDGWASL 303

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T KIG   QLVGDDLFVTN + L +GI+  + N+ILIK NQIGS++ETLN I+ A+ AG+
Sbjct: 304 TKKIGDKVQLVGDDLFVTNTKILKRGIDNGIGNSILIKFNQIGSLTETLNAIKMAKAAGF 363

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
             +ISHRSGETED TIADLAV T  GQIKTGSL RSDR+AKYNQL+RIEE+LG +AK+ G
Sbjct: 364 TVVISHRSGETEDATIADLAVGTAAGQIKTGSLCRSDRVAKYNQLLRIEEALGAEAKYLG 423

Query: 418 RS 419
           RS
Sbjct: 424 RS 425


>gi|148243462|ref|YP_001228619.1| enolase [Synechococcus sp. RCC307]
 gi|147851772|emb|CAK29266.1| Enolase [Synechococcus sp. RCC307]
          Length = 440

 Score =  518 bits (1333), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 319/418 (76%), Gaps = 3/418 (0%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFG 59
           + I+ ++AREV+DSRG+PT+E +V LE G++GRA+VPSGASTG HEA ELRD +  RYFG
Sbjct: 15  LVIDTVVAREVLDSRGTPTVEAEVLLEGGASGRAIVPSGASTGAHEAHELRDGDAMRYFG 74

Query: 60  KGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKA 119
           KGV +A++ V + +  AL G  A DQ+ +D  M +LDG+ NKS LGANAIL VS+AV++A
Sbjct: 75  KGVNQAVSNVEERLAPALCGLSALDQVAVDGAMNELDGSANKSSLGANAILAVSMAVARA 134

Query: 120 AAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRM 179
           AA    LPLY+YLGG SA +LPVPLMN++NGG HA N LDFQEFMI+P GA + REA+R 
Sbjct: 135 AANGVGLPLYRYLGGPSATVLPVPLMNVINGGEHATNNLDFQEFMIVPHGAGSFREALRW 194

Query: 180 GAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIAL 239
           GAEVFHTLK  L  +G ST VGDEGGF+PNL   D+A DL+  +IEKAGY  G+ + +AL
Sbjct: 195 GAEVFHTLKGLLNEQGLSTAVGDEGGFAPNLDGNDAAGDLLVRAIEKAGYKPGEQIALAL 254

Query: 240 DCAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           D A++ F+K  +Y   G N      EM   LA LV +YPI SIEDG++EDDW GWK+LT 
Sbjct: 255 DVASTEFYKDGRYSFGGGN--YSSAEMVDQLAQLVSRYPIVSIEDGLAEDDWDGWKLLTE 312

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++GS+ QLVGDDLFVTN  RL +GI+  VAN+ILIK NQIGS+SETL  I+     GY S
Sbjct: 313 RLGSSVQLVGDDLFVTNSTRLQRGIDLGVANSILIKVNQIGSLSETLQAIDLGGRNGYTS 372

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           +ISHRSGETED TIADLAVAT  GQIKTGSL+RS+RIAKYNQL+RIE+ LG QA +AG
Sbjct: 373 VISHRSGETEDTTIADLAVATGAGQIKTGSLSRSERIAKYNQLLRIEDELGSQAVYAG 430


>gi|313678903|ref|YP_004056642.1| enolase [Oceanithermus profundus DSM 14977]
 gi|313151618|gb|ADR35469.1| enolase [Oceanithermus profundus DSM 14977]
          Length = 422

 Score =  518 bits (1333), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 252/415 (60%), Positives = 315/415 (75%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I ++ AREV+DSRG+PT+E +V LE G  G AMVPSGASTG HEA ELRD   R+ GKGV
Sbjct: 4   IVEVSAREVLDSRGNPTVEAEVTLEGGQIGHAMVPSGASTGEHEAVELRDGGPRFGGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
           L+A+A VN+ I   ++G +A DQ  ID+ M+DLDGTPNK+ LGANAIL VSLAVS+AAA+
Sbjct: 64  LQAVANVNERIAPEIIGMNALDQEGIDRAMLDLDGTPNKANLGANAILAVSLAVSRAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
              LPL+ YLGG     LPVPLMN++NGG HADN +DFQEFM++P GA + REA+R G E
Sbjct: 124 AVELPLFAYLGGVQGVTLPVPLMNVINGGKHADNRVDFQEFMLVPAGAPSFREALRYGVE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
            FH LK  LK +GY TNVGDEGGF+PNL++ + A++++  +I+ AGY  GK++ IALD A
Sbjct: 184 TFHALKGVLKKRGYGTNVGDEGGFAPNLQSNEEAVEVLLEAIQAAGYEPGKEISIALDPA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           AS F+K  KY L+ E   L  +EM  Y A  V++YPI S+EDG+ E+DW GW+ LT ++G
Sbjct: 244 ASEFYKDGKYHLEAEGKVLGSDEMVEYWAEWVERYPIVSLEDGLDENDWAGWRRLTERLG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTNP+ L +GI E VANAIL+K NQIG++SETL T+  AQ   Y ++IS
Sbjct: 304 DRIQLVGDDLFVTNPDFLVRGIREGVANAILVKLNQIGTLSETLETVRLAQRHRYRTVIS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           HRSGETED  IADLAVA N GQIKTGS +RSDR+AKYNQL+RIEE+LG  A+F G
Sbjct: 364 HRSGETEDSYIADLAVAVNAGQIKTGSASRSDRLAKYNQLLRIEEALGAAARFLG 418


>gi|332799908|ref|YP_004461407.1| Enolase [Tepidanaerobacter sp. Re1]
 gi|332697643|gb|AEE92100.1| Enolase [Tepidanaerobacter sp. Re1]
          Length = 428

 Score =  518 bits (1333), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 257/417 (61%), Positives = 319/417 (76%), Gaps = 1/417 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGK 60
            I D+ ARE++DSRG+PT+E +V LEDG+ GRA VPSGASTG  EA ELRD++  R+ GK
Sbjct: 3   IILDVFAREILDSRGNPTVEAEVILEDGTMGRAAVPSGASTGKFEAVELRDKDVARFGGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN+EI   L G D  DQ+ ID+++IDLD TPNK RLGANAILGVSLA + AA
Sbjct: 63  GVLKAVQNVNEEIAPELRGMDVLDQVAIDQLLIDLDNTPNKGRLGANAILGVSLAAAHAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    + LYKY+GG +A +LPVP+MNILNGG HADN +D QEFMIMP GA++  +A++MG
Sbjct: 123 ANYLGVSLYKYIGGANAKVLPVPMMNILNGGEHADNNIDLQEFMIMPAGAKSFAQALQMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AE FHTLKK L  +G ST VGDEGGF+PNL + + A+  I  +IEKAGY  GKD+ IALD
Sbjct: 183 AETFHTLKKVLGDRGLSTAVGDEGGFAPNLSSNEEAIKYIIEAIEKAGYVPGKDIFIALD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A+S F+   KY LKGE LE     M  Y A LV++YPI SIEDGM+E+DW GWK+LT+ 
Sbjct: 243 PASSEFYNDGKYQLKGEGLEYDAAGMVDYYARLVEKYPIISIEDGMAEEDWEGWKLLTDA 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IGS  QLVGDDLFVTN ERL +GI + VAN+ILIK NQIG+++ETL+ I  A+ A Y ++
Sbjct: 303 IGSKVQLVGDDLFVTNTERLKRGIEKGVANSILIKLNQIGTLTETLDAISMAERAKYTAV 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           +SHRSGETED TIADL VA N GQIKTG+ +R+DR+AKYNQL+RIE+ L   A++ G
Sbjct: 363 VSHRSGETEDTTIADLVVAVNAGQIKTGAPSRTDRVAKYNQLLRIEQELDTTARYLG 419


>gi|260223073|emb|CBA33272.1| Enolase [Curvibacter putative symbiont of Hydra magnipapillata]
          Length = 427

 Score =  518 bits (1333), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 256/418 (61%), Positives = 324/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGKG 61
           I DI+ RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD  +KRY GKG
Sbjct: 4   IVDIVGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGDKKRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A+LG DA +Q  +DK +IDLDGT NKSRLGANA+L VS+AV++AAA
Sbjct: 64  VLKAVEHINTEISEAVLGLDASEQAFLDKTLIDLDGTENKSRLGANAMLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  +  +PVP+MN++NGG HA+N LD QE MI+PVGA + REA+R GA
Sbjct: 124 EEAGLPLYRYFGGMGSVQMPVPMMNVMNGGEHANNNLDLQELMIIPVGAPSFREALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  KG ST VGDEGGF+PN++  ++A+ +I  +I+KAGY AG+ + + LDC
Sbjct: 184 EVFHALKKILHDKGISTAVGDEGGFAPNVENHEAAILMILEAIDKAGYVAGEQIALGLDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY L+GE L L   E    LA  VD+YPI SIEDGM+E DW GWK+LT+++
Sbjct: 244 AASEFYKDGKYELEGEGLSLTAQEWTDMLATWVDKYPIISIEDGMAEGDWDGWKVLTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   Q+VGDDLFVTN + L +GI++ +AN+ILIK NQIG++SET   IE A+ AGY ++I
Sbjct: 304 GKRVQIVGDDLFVTNTKILKEGIDKGIANSILIKINQIGTLSETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TI+D+AV TN GQIKTGSL+RSDR+AKYNQL+RIEE LG  A + GR+
Sbjct: 364 SHRSGETEDSTISDIAVGTNAGQIKTGSLSRSDRMAKYNQLLRIEEDLGDVAVYPGRA 421


>gi|294813045|ref|ZP_06771688.1| Enolase [Streptomyces clavuligerus ATCC 27064]
 gi|294325644|gb|EFG07287.1| Enolase [Streptomyces clavuligerus ATCC 27064]
          Length = 454

 Score =  518 bits (1333), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 325/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 32  IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYQGKG 91

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 92  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATENKGSLGANAILGVSLAVAHAAS 151

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R G 
Sbjct: 152 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGT 211

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LK KG +T +GDEGGF+PNL +  +ALDLI  +I++AGY  GKD+ +ALD 
Sbjct: 212 EVYHTLKKVLKQKGLATGLGDEGGFAPNLDSNRAALDLILEAIKEAGYVPGKDIALALDV 271

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G+   L   E+  Y   LV  YP+ SIED + EDDW GWK+LT+K+
Sbjct: 272 AASEFYKDGVYEFEGK--PLSAAELTEYYEELVAAYPLVSIEDPLFEDDWAGWKVLTDKL 329

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  Q+VGDDLFVTNPERL +GI E  ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 330 GTKVQIVGDDLFVTNPERLARGIEEGSANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 389

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 390 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 447


>gi|288554073|ref|YP_003426008.1| enolase [Bacillus pseudofirmus OF4]
 gi|288545233|gb|ADC49116.1| phosphopyruvate hydratase [Bacillus pseudofirmus OF4]
          Length = 429

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 255/420 (60%), Positives = 327/420 (77%), Gaps = 2/420 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKG 61
            I D+ AREV+DSRG+PT+EV+V LE G+ GRA+VPSGASTG +EA ELRD  +RY GKG
Sbjct: 3   MITDVYAREVLDSRGNPTVEVEVYLESGAMGRALVPSGASTGEYEAVELRDGGERYMGKG 62

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V++A+  VND I   L+G DA DQL ID++MI+LDGT NKS+LGANAILGVS+AV+ AAA
Sbjct: 63  VIQAVDNVNDVIAPELIGFDALDQLGIDQLMIELDGTENKSKLGANAILGVSMAVAHAAA 122

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   +PLY YLGG +A  LPVP+MNI+NGG HADN +D QEFM+MP+GAEN +EA+RMGA
Sbjct: 123 EALGVPLYVYLGGFNAKQLPVPMMNIINGGEHADNNVDIQEFMVMPIGAENFKEALRMGA 182

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LK  LK KGY+T VGDEGGF+PNL + + AL  I  +IEKAGY  G+++++A+D 
Sbjct: 183 EIFHNLKAVLKGKGYNTAVGDEGGFAPNLSSNEEALSTIIEAIEKAGYKPGEEVVLAMDV 242

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           AAS  + K+  KY L GE   L   EM S+   LV +YPI SIEDG+ E+DW G+K+LT+
Sbjct: 243 AASEIYNKDDGKYHLSGEGKVLSSEEMVSFYEELVSKYPIISIEDGLDENDWDGFKLLTD 302

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++G   QLVGDDLFVTN  +L +GI + + N+ILIK NQIG+++ET   IE A+ AGY +
Sbjct: 303 RLGDKVQLVGDDLFVTNTTKLSEGIEKGIGNSILIKVNQIGTLTETFEAIEMAKRAGYTA 362

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           +ISHRSGETED TIAD+AVATN GQIKTG+ +R+DR+AKYNQL+RIE+ L   A++ GRS
Sbjct: 363 VISHRSGETEDATIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDELANVAQYGGRS 422


>gi|303248901|ref|ZP_07335149.1| enolase [Desulfovibrio fructosovorans JJ]
 gi|302489700|gb|EFL49635.1| enolase [Desulfovibrio fructosovorans JJ]
          Length = 435

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/416 (60%), Positives = 318/416 (76%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I  + ARE++DSRG+PT+EV+V LE G++GRA VPSGASTG  EA ELRDQ+  RY GKG
Sbjct: 4   IAAVWAREILDSRGNPTVEVEVTLESGASGRAAVPSGASTGSREALELRDQDASRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V+KA+  V  E+  A++G DA  Q+ +D +MID DGT NKSRLGANAILGVSLA ++AAA
Sbjct: 64  VVKAVENVQGELAEAVIGMDALQQVAVDNLMIDTDGTENKSRLGANAILGVSLATARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+YLGG +A +LPVP+MNI+NGG+HA N LD QEFMI+P+GA    +A+RMGA
Sbjct: 124 SFLGLPLYQYLGGVNAKVLPVPMMNIINGGMHAPNNLDIQEFMIVPLGARTFADALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E FHTLK  L + G+ T VGDEGGF+PNLK  D A   I  +IE+AGY  G ++ +A+D 
Sbjct: 184 ETFHTLKTILAADGHMTTVGDEGGFAPNLKDHDEAFKYIIKAIEEAGYRPGDEISLAIDP 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS FFK  KY+L  E   +  +EM +YL+  VD+YPI SIEDG++E DW GWK LT ++
Sbjct: 244 AASEFFKNGKYVLGSEKRTMSADEMVAYLSGFVDRYPIISIEDGLAESDWDGWKKLTVEL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDD+FVTNP+ L +GI++ VAN+ILIK NQIG+V+ETL+TIE A+ A Y +++
Sbjct: 304 GERIQLVGDDIFVTNPDILAEGIDQGVANSILIKLNQIGTVTETLDTIEMAKQAAYTTVV 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED  I+DLAVA N GQIK+GSL+RSDR++KYNQL+RIEE L   A F G
Sbjct: 364 SHRSGETEDSFISDLAVAVNAGQIKSGSLSRSDRLSKYNQLLRIEEELEDMAIFYG 419


>gi|167756375|ref|ZP_02428502.1| hypothetical protein CLORAM_01908 [Clostridium ramosum DSM 1402]
 gi|237733039|ref|ZP_04563520.1| phosphopyruvate hydratase [Mollicutes bacterium D7]
 gi|167703783|gb|EDS18362.1| hypothetical protein CLORAM_01908 [Clostridium ramosum DSM 1402]
 gi|229383841|gb|EEO33932.1| phosphopyruvate hydratase [Coprobacillus sp. D7]
          Length = 429

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 252/419 (60%), Positives = 317/419 (75%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I  + AREV+DSRG+PT+EV+V  E G+   A+VPSGASTG+HEA ELRD +K RY G G
Sbjct: 4   IKSVYAREVLDSRGNPTVEVEVTTECGAFASAIVPSGASTGVHEAVELRDGDKNRYLGLG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
             KA+  VN+ I   L+G +  +Q  ID+ MI LDGTPNK +LGANAILGVSLA++K AA
Sbjct: 64  TEKAVKNVNEIIAKELIGKEVTNQREIDETMIALDGTPNKGKLGANAILGVSLAIAKCAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + +LPLY+Y+GG +A++LP P+MNI+NGG HADN +DFQEFMIMPV A   +EAIRMGA
Sbjct: 124 TSLDLPLYRYIGGANAYVLPTPMMNIINGGAHADNNVDFQEFMIMPVSAPTFKEAIRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LK  LK KG +T VGDEGGF+PNL + + A+  I  ++EKAGY  G+D+ +A+D 
Sbjct: 184 EVFHALKAVLKGKGLNTAVGDEGGFAPNLASNEDAIKTILEAVEKAGYKPGEDIKLAMDV 243

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           A+S F++  KY+L GE N      E+  + A L  +YPI SIEDG+ +DDW GW  LT K
Sbjct: 244 ASSEFYQDGKYVLPGENNKSFTSKELVDFYAELCSKYPIISIEDGLDQDDWEGWDYLTEK 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDD FVTN +RL +GI   VAN+ILIK NQIG+++ETL  IE AQ A Y ++
Sbjct: 304 LGDKVQLVGDDFFVTNTKRLEEGIKRGVANSILIKVNQIGTLTETLEAIEMAQKANYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ISHRSGETED TIAD+AVATN GQIKTGS +R+DRIAKYNQLIRIE+ LGKQ+K++G S
Sbjct: 364 ISHRSGETEDTTIADIAVATNAGQIKTGSASRTDRIAKYNQLIRIEDRLGKQSKYSGLS 422


>gi|187735678|ref|YP_001877790.1| Phosphopyruvate hydratase [Akkermansia muciniphila ATCC BAA-835]
 gi|187425730|gb|ACD05009.1| Phosphopyruvate hydratase [Akkermansia muciniphila ATCC BAA-835]
          Length = 426

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 263/422 (62%), Positives = 322/422 (76%), Gaps = 4/422 (0%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFG 59
           M I D+  RE+IDSRG+PT+EVDV L  G+ GRA VPSGASTG HEA+ELRD + KRY G
Sbjct: 1   MEIIDVRGREIIDSRGNPTVEVDVALAGGAIGRASVPSGASTGEHEAWELRDGDAKRYGG 60

Query: 60  KGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKA 119
           KGVLKA+  +N  I   + G DA  Q  IDKIMIDLDGTPNKSRLGANAILGVSLAV+KA
Sbjct: 61  KGVLKAVENINKIIAPEISGHDATLQPAIDKIMIDLDGTPNKSRLGANAILGVSLAVAKA 120

Query: 120 AAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRM 179
           AA   NLPL+KYLGG +A +LPVP+MNI+NGG H+D+ +DFQEFMIMP GA   RE++R 
Sbjct: 121 AAIQLNLPLFKYLGGPNAKVLPVPMMNIINGGAHSDSPIDFQEFMIMPKGAPTFRESLRY 180

Query: 180 GAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIAL 239
           GAEVFH LK  L  +G ST VGDEGGF+P LK+AD AL+ IA ++++AGY  G D+ IAL
Sbjct: 181 GAEVFHALKDVLHDRGLSTAVGDEGGFAPALKSADDALECIAQAVKRAGYTLGTDIFIAL 240

Query: 240 DCAASAFFKKEK--YIL-KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKI 296
           D A+S F+   +  Y+  K + L     E+ +Y   L  +YPI SIEDG +E+DW GW+ 
Sbjct: 241 DVASSEFYDPSRNLYVFKKSDGLGRTAEELTAYYQELQKKYPIISIEDGCAENDWLGWEQ 300

Query: 297 LTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAG 356
           LT  +G N QLVGDDLFVTN E L++GI+  VANA+L+K NQIGS++ETL+T+E A+   
Sbjct: 301 LTKAMGGNTQLVGDDLFVTNVEFLNQGISRHVANAVLVKVNQIGSLTETLDTVELAKDNK 360

Query: 357 YPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFA 416
           Y +IISHRSGETED TIAD+AVATN GQIKTGSL+RSDR+AKYNQL+RIEE LG  A + 
Sbjct: 361 YSAIISHRSGETEDATIADIAVATNAGQIKTGSLSRSDRMAKYNQLLRIEEELGNDAVYG 420

Query: 417 GR 418
           G+
Sbjct: 421 GK 422


>gi|110639506|ref|YP_679715.1| enolase [Cytophaga hutchinsonii ATCC 33406]
 gi|119369316|sp|Q11QE1|ENO_CYTH3 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|110282187|gb|ABG60373.1| enolase [Cytophaga hutchinsonii ATCC 33406]
          Length = 427

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 259/423 (61%), Positives = 327/423 (77%), Gaps = 4/423 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKR-YFGK 60
            I +I+AR++ DSRG+PTIEVDV  E+G  GRA VPSGASTG HEA ELRD +K  Y GK
Sbjct: 3   LIEEIVARQIFDSRGNPTIEVDVITENGLIGRAAVPSGASTGKHEAVELRDNDKSIYMGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
            VLKA+A VND I   L+G    +Q LID++MIDLDGT NK +LGANAILGVSLA++KAA
Sbjct: 63  SVLKAVANVNDIIAPELIGSHVFEQNLIDRLMIDLDGTANKGKLGANAILGVSLALAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           AQ + LPLY+Y+GG SA+ LPVP+MNI+NGG HADN++DFQEFMIMP GA++  EA+RMG
Sbjct: 123 AQEAGLPLYRYVGGVSANTLPVPMMNIINGGSHADNSIDFQEFMIMPTGAKSFTEAMRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           +E+FH L K LKSKG STNVGDEGGF+PN+ + + AL  +  +IE AGY  G+D++IA D
Sbjct: 183 SEIFHNLAKVLKSKGMSTNVGDEGGFAPNIASNEDALITVIQAIEAAGYRPGEDVMIAFD 242

Query: 241 CAASAFFKKEK---YILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
            A+S F+  E    +  K    +L  ++MASY A+LV +YPI SIEDGM EDDW GW  L
Sbjct: 243 AASSEFYDSETKLYHFKKSTGDKLTSSQMASYWADLVKRYPIVSIEDGMDEDDWSGWAEL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T  +G   QLVGDDLFVTN  RL +GI++ +AN+IL+K NQIGS++ET++ +  A+   Y
Sbjct: 303 TKLVGDKVQLVGDDLFVTNVSRLQQGIDQGIANSILVKVNQIGSLTETISAVNLAKRNSY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            S++SHRSGETED+TIADLAVA NCGQIKTGS +RSDR+AKYNQL+RIEE LG+ A F G
Sbjct: 363 TSVMSHRSGETEDNTIADLAVALNCGQIKTGSCSRSDRMAKYNQLLRIEEELGEAAYFPG 422

Query: 418 RSI 420
           +++
Sbjct: 423 KNM 425


>gi|121535410|ref|ZP_01667221.1| Phosphopyruvate hydratase [Thermosinus carboxydivorans Nor1]
 gi|121306009|gb|EAX46940.1| Phosphopyruvate hydratase [Thermosinus carboxydivorans Nor1]
          Length = 430

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 259/421 (61%), Positives = 324/421 (76%), Gaps = 1/421 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I D++ARE++DSRG+PT+EVDV LEDG+ GRA VPSGASTG +EA ELRD EK RY GK
Sbjct: 5   IITDVMAREILDSRGNPTVEVDVVLEDGTLGRAAVPSGASTGAYEAVELRDGEKDRYLGK 64

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV +A+A VN+ I   ++G DA DQ+ ID+ +I LDGT NK +LGANAILGVS+AV+KAA
Sbjct: 65  GVRQAVANVNEVIGPEIVGMDACDQVAIDQALIALDGTLNKGKLGANAILGVSMAVAKAA 124

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A +  LPLY+YLGG +A  LPVP+MNILNGG HADN +D QEFMIMPVGA N   A+RM 
Sbjct: 125 AASLGLPLYQYLGGFNAKELPVPMMNILNGGKHADNNVDIQEFMIMPVGAVNFSYALRMC 184

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEV+H LKK L+ +G ST +GDEGGF+PNL + + AL +I  +I++AGY  G  + +ALD
Sbjct: 185 AEVYHNLKKVLQERGLSTAIGDEGGFAPNLASNEEALSVIMEAIKRAGYQPGTQIALALD 244

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            AA+  +K  KY L GE +     EM +Y  +LV +YPI SIEDGM+EDDW GW++LT +
Sbjct: 245 VAATELYKDGKYHLAGEGVVRTAAEMVAYYEDLVAKYPIVSIEDGMAEDDWEGWRLLTER 304

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDD+FVTN ERL +GI E+VANAILIK NQIG+++ET + IE A+ AGY  I
Sbjct: 305 LGGKIQLVGDDVFVTNTERLRRGIGEKVANAILIKVNQIGTLTETFDAIEMAKRAGYTCI 364

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           ISHRSGETED TIAD+AVA N GQIKTG+ AR+DR+AKYNQL+RIEE LG  A++ G  +
Sbjct: 365 ISHRSGETEDATIADIAVAVNAGQIKTGAPARTDRVAKYNQLLRIEEELGDVAQYKGGDV 424

Query: 421 L 421
            
Sbjct: 425 F 425


>gi|39997384|ref|NP_953335.1| phosphopyruvate hydratase [Geobacter sulfurreducens PCA]
 gi|59797601|sp|Q74AR6|ENO_GEOSL RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|39984275|gb|AAR35662.1| enolase [Geobacter sulfurreducens PCA]
 gi|298506323|gb|ADI85046.1| enolase [Geobacter sulfurreducens KN400]
          Length = 428

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 261/423 (61%), Positives = 329/423 (77%), Gaps = 2/423 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I D+ ARE++DSRG+PT+EV+V LE G  GRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   ITDVYAREILDSRGNPTLEVEVFLESGVMGRAAVPSGASTGEREALELRDGDASRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VND I   L+G +A DQ+ ID+ M++LDGT  KS LGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVDNVNDIIAEQLIGMEATDQVGIDRRMLELDGTEYKSTLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   LPLY+Y+GGC+A  LP+P+MNILNGG HADN +D QEFMIMP GA +  EA+RMGA
Sbjct: 124 EEVGLPLYQYIGGCNARELPLPMMNILNGGAHADNNVDIQEFMIMPAGARSFSEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LK  LK KGY+T VGDEGGF+PNLK+ + AL++I  +I KAGY AG+D+L+ALD 
Sbjct: 184 EVFHALKSVLKGKGYNTAVGDEGGFAPNLKSNEEALEVIMEAIAKAGYKAGEDILLALDV 243

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           A+S  FK  KY L+ E   E   +E+  +  NLV++YPI SIEDGM+E+DW GWK +T++
Sbjct: 244 ASSELFKDGKYFLENEAKPEKTADELIDFYENLVNKYPIISIEDGMAENDWEGWKKITDR 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN + L +GI++ VAN+ILIK NQIG+++ETL+ IE A+ AGY ++
Sbjct: 304 LGKRVQLVGDDLFVTNTKILKEGISKGVANSILIKLNQIGTLTETLDAIETAKRAGYTTV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           ISHRSGETED T+ADLAVA N GQIKTGSL R+DR+AKYNQL+RIE+ L   A+F G+ +
Sbjct: 364 ISHRSGETEDTTLADLAVAVNAGQIKTGSLCRTDRVAKYNQLLRIEDELDVTAQFRGKDV 423

Query: 421 LIH 423
             +
Sbjct: 424 FYN 426


>gi|124024460|ref|YP_001018767.1| phosphopyruvate hydratase [Prochlorococcus marinus str. MIT 9303]
 gi|166232218|sp|A2CDE2|ENO_PROM3 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|123964746|gb|ABM79502.1| Enolase [Prochlorococcus marinus str. MIT 9303]
          Length = 431

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 252/417 (60%), Positives = 317/417 (76%), Gaps = 2/417 (0%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGK 60
           + I+ I+AREV+DSRG+PT+E +V LE G+ GRA+VPSGASTG HEA ELRD + RY GK
Sbjct: 7   LVIDTIVAREVLDSRGNPTVEAEVLLEAGAIGRAIVPSGASTGAHEAHELRDGDSRYMGK 66

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV KA+  + D I  AL G  + DQ  +D  M +LDG+ NKS LGANAIL VS+A ++AA
Sbjct: 67  GVTKAVNHIEDRIAPALCGISSLDQASVDGTMQELDGSDNKSSLGANAILAVSMATARAA 126

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    LPLY+YLGG  A +LPVPLMN++NGG HA N LDFQEFM++P GA   RE++RMG
Sbjct: 127 ANGLGLPLYRYLGGPMASLLPVPLMNVINGGAHAANNLDFQEFMLVPHGASTFRESLRMG 186

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFHTLK  L ++G ST VGDEGGF+PNL   D+A DL+  +IEKAGY+ GKD+ +ALD
Sbjct: 187 AEVFHTLKGLLSAQGLSTAVGDEGGFAPNLTNNDAAGDLLIQAIEKAGYSPGKDISLALD 246

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A++ F+K   Y   G +      EM + L  LVD+YPI SIEDG++EDDW GW +LT K
Sbjct: 247 VASTEFYKDGCYAFGGGS--YTSTEMVNELEKLVDRYPIISIEDGLAEDDWQGWALLTKK 304

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QL+GDD+FVT+ +RL +GI++ VAN+ILIK NQIGS++ETL  I+ A  +GY S+
Sbjct: 305 LGKRIQLIGDDIFVTSTKRLQQGIDQNVANSILIKVNQIGSLTETLQAIDLAGRSGYTSV 364

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ISHRSGETED TIADLAVAT  GQIKTGSL+RS+R+AKYNQL+RIE+ LG QA +AG
Sbjct: 365 ISHRSGETEDTTIADLAVATRAGQIKTGSLSRSERVAKYNQLLRIEDELGTQALYAG 421


>gi|297564487|ref|YP_003683459.1| enolase [Meiothermus silvanus DSM 9946]
 gi|296848936|gb|ADH61951.1| enolase [Meiothermus silvanus DSM 9946]
          Length = 422

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 253/418 (60%), Positives = 317/418 (75%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I ++ AREV+DSRG+PT+E +V LE G+ G AMVPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IVELKAREVLDSRGNPTVEAEVTLEGGARGSAMVPSGASTGAHEALELRDGGPRYAGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
           L+A+A VN+ I   L+G DA DQ  +D+ M+ LDGTPNK+ LGANAIL VSLA ++AAA 
Sbjct: 64  LRAVAAVNERIAPELIGYDALDQAGVDRAMLQLDGTPNKANLGANAILAVSLATARAAAN 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
              LPLY+YLGG     LPVPLMN++NGG HADN +DFQEFM++P GA + REA+RMG E
Sbjct: 124 ALGLPLYRYLGGVQGLTLPVPLMNVINGGKHADNNVDFQEFMLVPAGATSFREALRMGVE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
            FH LK  LK +GY+TNVGDEGGF+P+LK+   A++++  +IEKAGY  G+++ +ALD A
Sbjct: 184 TFHALKGVLKGRGYNTNVGDEGGFAPDLKSNVEAVEVLLQAIEKAGYKPGQEISLALDPA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           ++ F+K  KY L+ EN  L   EM +Y  + V QYPI SIEDG++EDDW  WK+LT ++G
Sbjct: 244 STEFYKDGKYRLEAENKTLSSEEMVAYWESWVGQYPIVSIEDGLAEDDWEAWKMLTERVG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTNP RL +GI + V NAIL+K NQIG++SETL  I  AQ +GY ++IS
Sbjct: 304 HKIQLVGDDLFVTNPARLAEGIEKGVGNAILVKVNQIGTLSETLEAIALAQRSGYNAVIS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           HRSGETED  IADLAVA N GQIKTGS +RSDR+AKYNQL+RIE+ LG  A+F G  +
Sbjct: 364 HRSGETEDTFIADLAVAVNAGQIKTGSASRSDRLAKYNQLLRIEDELGVGARFLGYGV 421


>gi|171321919|ref|ZP_02910810.1| Phosphopyruvate hydratase [Burkholderia ambifaria MEX-5]
 gi|171092784|gb|EDT38056.1| Phosphopyruvate hydratase [Burkholderia ambifaria MEX-5]
          Length = 427

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 315/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E   YLA L D++PI SIEDGM E DW GWK+LT ++
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFTDYLATLADKFPIVSIEDGMHEGDWEGWKLLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + + N+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIGNSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|218297057|ref|ZP_03497734.1| Phosphopyruvate hydratase [Thermus aquaticus Y51MC23]
 gi|218242612|gb|EED09149.1| Phosphopyruvate hydratase [Thermus aquaticus Y51MC23]
          Length = 422

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 252/415 (60%), Positives = 319/415 (76%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I  + A EV+DSRG PT+E +V LE G  GRAMVPSGASTG HEA ELRD  +RY GKGV
Sbjct: 4   IVSVRAWEVLDSRGFPTVEAEVELEGGVRGRAMVPSGASTGTHEALELRDGGRRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            +A+  + + I   L+G DA DQ  +D+ M++LDGTPNK+ LGANAIL VSLA ++AAA+
Sbjct: 64  RRAVENILERIAPELIGRDALDQEGVDRAMLELDGTPNKANLGANAILAVSLATARAAAE 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
              LPLY+YLGG    +LPVPLMN++NGG HADN +DFQEFM++P GAE+ REA+R+GAE
Sbjct: 124 ALGLPLYRYLGGVQGVVLPVPLMNVINGGKHADNRVDFQEFMLVPAGAESFREALRIGAE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFH LK  LK +GYSTNVGDEGGF+P+LK+ + A++L+  +IE+AGY  G+++ +ALD A
Sbjct: 184 VFHHLKGVLKERGYSTNVGDEGGFAPDLKSNEEAVELLLMAIERAGYTPGQEVSLALDPA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
            S  ++  +Y L+GE   L   EM ++    V++YPI S+EDG++EDDW GW++LT ++G
Sbjct: 244 MSELYRDGRYHLEGEGKVLTSEEMVAFWEAWVEKYPIRSLEDGLAEDDWEGWRLLTERLG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTNPERL +GI   VANAIL+K NQIG++SETL  I  AQ AGY ++IS
Sbjct: 304 GKVQLVGDDLFVTNPERLKRGIEAGVANAILVKVNQIGTLSETLEAIRLAQRAGYRAVIS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           HRSGETED  IADLAVA N GQIKTGSL+RSDR+AKYNQL+RIEE LG  A+F G
Sbjct: 364 HRSGETEDSFIADLAVAVNAGQIKTGSLSRSDRLAKYNQLLRIEEELGPAARFLG 418


>gi|229916588|ref|YP_002885234.1| phosphopyruvate hydratase [Exiguobacterium sp. AT1b]
 gi|259645920|sp|C4L5H4|ENO_EXISA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|229468017|gb|ACQ69789.1| enolase [Exiguobacterium sp. AT1b]
          Length = 430

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 320/419 (76%), Gaps = 3/419 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I +I ARE++DSRG+P++EV+V  EDG  GRA+VPSGASTG HEA ELRD +K RY GK
Sbjct: 3   MITEIYAREILDSRGNPSVEVEVFTEDGGFGRALVPSGASTGEHEAVELRDGDKSRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+A VND I   L+G D  DQ  ID  MI+LDGTPNK++LGANAILGVS+A + AA
Sbjct: 63  GVLKAVANVNDTIAPELIGYDVFDQNAIDAKMIELDGTPNKAKLGANAILGVSMAAAHAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    LPLY YLGG +A  LP P+MNI+NGG HADN +DFQEFMIMPVGA   REA+RMG
Sbjct: 123 ADELGLPLYTYLGGFNAKTLPTPMMNIINGGSHADNNVDFQEFMIMPVGAPTFREALRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFH LK  L   G +T VGDEGGF+PNLK+ + A+ +I  +IEKAGY  G+D+ +A+D
Sbjct: 183 AEVFHALKSVLSGMGLNTAVGDEGGFAPNLKSNEEAITVILEAIEKAGYKPGEDVYLAMD 242

Query: 241 CAASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILT 298
            A+S F+ K   KY L GE   L   E+  + A LVD+YPI SIEDG  E+DW G K+LT
Sbjct: 243 VASSEFYDKSTGKYELAGEGKSLTTAELVDFYAELVDKYPILSIEDGCDENDWDGHKLLT 302

Query: 299 NKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYP 358
           +KIG   QLVGDDLFVTN  +L +GI + +AN+ILIK NQIG+++ET + IE A+ AGY 
Sbjct: 303 DKIGHKVQLVGDDLFVTNTSKLAEGIEKGIANSILIKVNQIGTLTETFDAIEMAKKAGYT 362

Query: 359 SIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           +++SHRSGETED TIAD+AVATN GQIKTGSL+R+DRIAKYNQL+RIE+ LG  AK+ G
Sbjct: 363 AVVSHRSGETEDATIADIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDMLGDVAKYDG 421


>gi|307729230|ref|YP_003906454.1| enolase [Burkholderia sp. CCGE1003]
 gi|307583765|gb|ADN57163.1| enolase [Burkholderia sp. CCGE1003]
          Length = 427

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 315/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGETGRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E   YLA L D++PI SIEDGM E DW GWK+LT K+
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFTDYLATLADKFPIVSIEDGMHEGDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
               QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 RKKIQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|29839250|sp|Q8GR70|ENO_ENTHR RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|34810921|pdb|1IYX|A Chain A, Crystal Structure Of Enolase From Enterococcus Hirae
 gi|34810922|pdb|1IYX|B Chain B, Crystal Structure Of Enolase From Enterococcus Hirae
 gi|22852211|dbj|BAC16223.1| enolase [Enterococcus hirae]
          Length = 432

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 254/420 (60%), Positives = 326/420 (77%), Gaps = 6/420 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ ARE++DSRG+PTIEV+V  E G+ GR MVPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   ITDVYAREILDSRGNPTIEVEVYTESGAFGRGMVPSGASTGEYEAVELRDGDKARYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ I  A++G D RDQ+ IDK MI LDGTPNK +LGANAILGVS+AV++AAA
Sbjct: 64  VTKAVDNVNNIIAEAIIGYDVRDQMAIDKAMIALDGTPNKGKLGANAILGVSIAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY YLGG +  +LP P+MNI+NGG HADN++DFQEFMIMPVGA   +EA+RMGA
Sbjct: 124 DYLEVPLYHYLGGFNTKVLPTPMMNIINGGSHADNSIDFQEFMIMPVGAPTFKEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH L   LKS+G +T+VGDEGGF+PNL + +   ++I  +IEKAGY  GKD+++A+D 
Sbjct: 184 EVFHALAAILKSRGLATSVGDEGGFAPNLGSNEEGFEVIIEAIEKAGYVPGKDVVLAMDA 243

Query: 242 AASAFFKKEK--YIL--KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           A+S F+ KEK  Y+L   GE  E   +EM  +   LV +YPI SIEDG+ E+DW G+K L
Sbjct: 244 ASSEFYDKEKGVYVLADSGEG-EKTTDEMIKFYEELVSKYPIISIEDGLDENDWDGFKKL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T+ +G   QLVGDDLFVTN ++L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY
Sbjct: 303 TDVLGDKVQLVGDDLFVTNTQKLSEGIEKGIANSILIKVNQIGTLTETFEAIEMAKEAGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +++SHRSGETED TI+D+AVATN GQIKTGSL+R+DRIAKYNQL+RIE+ LG+ A++ G
Sbjct: 363 TAVVSHRSGETEDSTISDIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGEVAEYKG 422


>gi|187777182|ref|ZP_02993655.1| hypothetical protein CLOSPO_00728 [Clostridium sporogenes ATCC
           15579]
 gi|187774110|gb|EDU37912.1| hypothetical protein CLOSPO_00728 [Clostridium sporogenes ATCC
           15579]
          Length = 431

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 254/416 (61%), Positives = 319/416 (76%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AR+++DSR +PT+EV+V LEDG+ G A VPSGASTG  EA ELRD +K +Y GKG
Sbjct: 7   IVDVYARQILDSRCNPTVEVEVELEDGTVGVAAVPSGASTGAFEAVELRDGDKSQYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN  I   L+G +  DQ+ IDK MI+LDGT NK++LGANA+LGVSLA +KAAA
Sbjct: 67  VLKAVDNVNTTIADELVGMNVLDQVAIDKTMIELDGTDNKAKLGANAMLGVSLACAKAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +  + LY+Y+GG +  +LPVP+MNI+NGG HADN +D QEFMIMP GA +  EA+RM +
Sbjct: 127 NSLGMSLYQYIGGVNGKVLPVPMMNIINGGKHADNNVDLQEFMIMPAGAPSFSEALRMCS 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LK  LK++GY T VGDEGGF+PNLK+ + A+ +I  +I+KAGY  G+D+ IALD 
Sbjct: 187 EVYHALKSTLKAQGYDTGVGDEGGFAPNLKSNEEAIVVIIEAIKKAGYTPGEDIFIALDP 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S  F+  KY L GE   L P EMA+Y   L ++YPI SIEDGM+E+DW GWKILT KI
Sbjct: 247 ASSEIFEDGKYNLAGEGRVLTPEEMANYYVELAEKYPIISIEDGMAEEDWDGWKILTEKI 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTN ERL KGI   VAN+ILIK NQIG+++ETLN IE A+ AGY +++
Sbjct: 307 GNKVQLVGDDLFVTNTERLSKGIKLGVANSILIKLNQIGTLTETLNAIEMAERAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQL+RIEE L    ++ G
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLLRIEEELNDMGEYRG 422


>gi|239981775|ref|ZP_04704299.1| phosphopyruvate hydratase [Streptomyces albus J1074]
          Length = 428

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 256/418 (61%), Positives = 323/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 6   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYQGKG 65

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 66  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATDNKGSLGANAILGVSLAVAHAAS 125

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R G 
Sbjct: 126 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGT 185

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LK KG +T +GDEGGF+PNL +  +ALDLI  ++++AGY  GKD+ +ALD 
Sbjct: 186 EVYHTLKKVLKRKGLATGLGDEGGFAPNLDSNRAALDLILEAVKEAGYVPGKDIALALDV 245

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G++      EM  Y   LV  YP+ SIED + EDDW GW ++T K+
Sbjct: 246 AASEFYKDGSYEFEGKS--RSAAEMTEYYEELVAAYPLVSIEDPLFEDDWAGWNVITEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI E+ ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 304 GDKVQLVGDDLFVTNPERLARGIEEKSANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 364 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 421


>gi|189501609|ref|YP_001957326.1| enolase [Candidatus Amoebophilus asiaticus 5a2]
 gi|238692324|sp|B3EUH8|ENO_AMOA5 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|189497050|gb|ACE05597.1| enolase [Candidatus Amoebophilus asiaticus 5a2]
          Length = 427

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 249/421 (59%), Positives = 319/421 (75%), Gaps = 4/421 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKR-YFGK 60
            I  + AR+++DSRG+PTIEVDVC E G  GRA VPSGASTG+HEA ELRD++   Y GK
Sbjct: 3   IIKSVYARQILDSRGNPTIEVDVCTEQGFVGRAAVPSGASTGLHEAMELRDKDSAVYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV KAI  V + I   L+G    +Q  ID ++I+LDGT NK+RLGANAILG S+AV+KAA
Sbjct: 63  GVQKAIKHVKEIIAPVLIGRSVFNQQAIDTLLIELDGTLNKARLGANAILGTSIAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A + N+PLY+Y+GG +A+ILP P++NI NGG HADN +D QEFM+MP+ A +  EA+RMG
Sbjct: 123 AMSLNIPLYQYIGGLNAYILPTPMINIFNGGAHADNNVDIQEFMVMPIKANSFAEALRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            EVFH L + LK KG STNVGDEGG++ NL + ++A++ I  +IEKAGY  G+D+ IALD
Sbjct: 183 VEVFHQLGRILKEKGLSTNVGDEGGYASNLPSNEAAMEFILQAIEKAGYQPGEDISIALD 242

Query: 241 CAASAFFKKEKYIL---KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
            A++ F++ EK +    K   ++L   E+  +  N V +YPI SIEDGM+EDDW GW  L
Sbjct: 243 AASTEFYQAEKEVYHFKKSTGIKLTSTELVDFWKNWVQKYPIISIEDGMAEDDWEGWHQL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T  IGS  QLVGDDLFVTN +RL KGI + +ANA+LIK NQ+G++SETL+T+  A+  GY
Sbjct: 303 TQAIGSKVQLVGDDLFVTNTKRLAKGIEQNIANAVLIKMNQVGTLSETLDTVNLAKKHGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +IISHRSGETED TIADLAVA N GQIKTGS++R+DR AKYNQL+RIEE+LG+ A+FAG
Sbjct: 363 QNIISHRSGETEDSTIADLAVALNAGQIKTGSVSRTDRTAKYNQLLRIEETLGEHARFAG 422

Query: 418 R 418
            
Sbjct: 423 H 423


>gi|190570657|ref|YP_001975015.1| enolase [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|213019093|ref|ZP_03334900.1| enolase [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
 gi|238064665|sp|B3CNP3|ENO_WOLPP RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|190356929|emb|CAQ54313.1| enolase [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|212995202|gb|EEB55843.1| enolase [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
          Length = 424

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 256/414 (61%), Positives = 321/414 (77%), Gaps = 4/414 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQ-EKRYFGKG 61
           I+ + ARE++DSRG PTIEV++ L DG+TGRA VPSGASTG  EA ELRDQ EKRY GKG
Sbjct: 6   ISSVFAREILDSRGYPTIEVEIELCDGATGRAAVPSGASTGKLEALELRDQDEKRYCGKG 65

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  V+  I   ++G DA +Q  IDK++I+LDGT NKS+LGANA LGVSLAV+KAAA
Sbjct: 66  VLKAVQSVSGVIANKIIGMDAANQSAIDKVLIELDGTKNKSKLGANATLGVSLAVAKAAA 125

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +   PLYKYLG      +PVPL+N++NGG+HADN LDFQEFMI+PVGAE   EAIR+ A
Sbjct: 126 NSFKTPLYKYLG-VGEKQMPVPLINVINGGVHADNKLDFQEFMILPVGAETFSEAIRISA 184

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH L+  LK KGYSTNVGDEGGF+PN+ + + AL+LI  ++E AGY+      + LD 
Sbjct: 185 EVFHNLRSILKKKGYSTNVGDEGGFAPNIGSTEEALNLIIQAVESAGYSMKNHFALGLDV 244

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+  E  + K EN EL   E+  Y  +LV +YPI SIED M+EDD+ GWK+LT K+
Sbjct: 245 AASTFY--EDGVYKFENRELTSEELVQYYFDLVGKYPIISIEDAMNEDDYEGWKLLTVKL 302

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTN + + KGI E++ANA+LIKPNQIG+++ET   IE A++ GY +II
Sbjct: 303 GNKVQLVGDDLFVTNCKLISKGIEEKMANAVLIKPNQIGTLTETFAAIEMAKLNGYRAII 362

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           SHRSGETED TI+ +AVA+NCGQIKTGSL+RSDR+AKYN+L+RIE SLG+ AK+
Sbjct: 363 SHRSGETEDTTISHIAVASNCGQIKTGSLSRSDRLAKYNELMRIESSLGENAKY 416


>gi|153932900|ref|YP_001382634.1| phosphopyruvate hydratase [Clostridium botulinum A str. ATCC 19397]
 gi|153936384|ref|YP_001386186.1| phosphopyruvate hydratase [Clostridium botulinum A str. Hall]
 gi|166232186|sp|A7FQP0|ENO_CLOB1 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|152928944|gb|ABS34444.1| enolase [Clostridium botulinum A str. ATCC 19397]
 gi|152932298|gb|ABS37797.1| phosphopyruvate hydratase [Clostridium botulinum A str. Hall]
          Length = 431

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 254/416 (61%), Positives = 319/416 (76%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AR+++DSR +PT+EV+V LEDG+ G A VPSGASTG  EA ELRD +K +Y GKG
Sbjct: 7   IVDVYARQILDSRCNPTVEVEVELEDGTVGVAAVPSGASTGAFEAVELRDGDKSKYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN  I   L+G +  DQ+ IDK MI+LDGT NK++LGANA+LGVSLA +KAAA
Sbjct: 67  VLKAVDNVNTIIADELVGMNVLDQVAIDKTMIELDGTDNKAKLGANAMLGVSLACAKAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +  + LY+Y+GG +  +LPVP+MNI+NGG HADN +D QEFMIMP GA +  EA+RM +
Sbjct: 127 NSLGMSLYQYIGGVNGKVLPVPMMNIINGGKHADNNVDLQEFMIMPAGAPSFSEALRMCS 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LK  LK++GY T VGDEGGF+PNLK+ + A+ +I  +I+KAGY  G+D+ IALD 
Sbjct: 187 EVYHALKSTLKAQGYDTGVGDEGGFAPNLKSNEEAIVVIIEAIKKAGYTPGEDIFIALDP 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S  F+  KY L GE   L P EMA+Y   L ++YPI SIEDGM+E+DW GWKILT KI
Sbjct: 247 ASSEIFEDGKYNLAGEGRVLTPEEMANYYVELAEKYPIISIEDGMAEEDWDGWKILTEKI 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTN ERL KGI   VAN+ILIK NQIG+++ETLN IE A+ AGY +++
Sbjct: 307 GNKVQLVGDDLFVTNTERLSKGIKLGVANSILIKLNQIGTLTETLNAIEMAERAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQL+RIEE L    ++ G
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLLRIEEELNDMGEYRG 422


>gi|315224542|ref|ZP_07866369.1| enolase [Capnocytophaga ochracea F0287]
 gi|314945563|gb|EFS97585.1| enolase [Capnocytophaga ochracea F0287]
          Length = 430

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 257/412 (62%), Positives = 319/412 (77%), Gaps = 4/412 (0%)

Query: 8   AREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGVLKAIA 67
           AR+++DSRG+PT+EVDV  E+G  GRA VPSGASTG +EA ELRD  K Y GKGVLKA+A
Sbjct: 9   ARQILDSRGNPTVEVDVMTENGFLGRAAVPSGASTGEYEAVELRDGGKSYMGKGVLKAVA 68

Query: 68  FVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTSNLP 127
            VND I   ++G D  +Q LIDK MI+LDGTPNKS+LGANAILGVSLAV++AAA+   LP
Sbjct: 69  NVNDIIAEEIVGMDVFEQNLIDKTMIELDGTPNKSKLGANAILGVSLAVARAAAEELGLP 128

Query: 128 LYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVFHTL 187
           LY+Y+GG SAH LPVP+MNI+N G H+D  + FQEFMIMPV A++  +AI+MGAEVFH L
Sbjct: 129 LYRYVGGVSAHTLPVPMMNIINAGAHSDAPIAFQEFMIMPVNAKDFSQAIQMGAEVFHNL 188

Query: 188 KKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAASAFF 247
           KK L  KG  T VGDEGGF+P  K  + ALD I  ++ KAGY  G+D+ IALDCA+S F+
Sbjct: 189 KKVLHDKGLGTAVGDEGGFAPAFKDIEDALDSIKEAVNKAGYKWGEDIKIALDCASSEFY 248

Query: 248 KKEKY---ILKGENLELQPN-EMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGS 303
           K  KY   I +G   +++ + E A YLA LV +YPI SIEDGM ++DW GWK+LT+KIG+
Sbjct: 249 KDGKYDYTIFEGAKGKVRTSAEQADYLAELVAKYPIISIEDGMDQNDWDGWKLLTDKIGN 308

Query: 304 NCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISH 363
             QLVGDDLFVTN   L +GI + +AN+ILIK NQIG++SET+  ++ A  AGY +++SH
Sbjct: 309 RVQLVGDDLFVTNVSILERGIAKGIANSILIKVNQIGTLSETIAAVDMANRAGYTAVMSH 368

Query: 364 RSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           RSGETED+TIADLAVA N GQIKTGS +RSDR+AKYNQL+RIEESLG  A +
Sbjct: 369 RSGETEDNTIADLAVALNTGQIKTGSASRSDRMAKYNQLLRIEESLGSVAYY 420


>gi|109450810|emb|CAK50216.1| enolase [Enterococcus faecalis]
          Length = 432

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 325/423 (76%), Gaps = 10/423 (2%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I DI AREV+DSRG+PTIEV+V  E G+ GR MVPSGASTG +EA ELRD +K RY GK
Sbjct: 3   IITDIYAREVLDSRGNPTIEVEVYTESGAFGRGMVPSGASTGEYEAVELRDGDKARYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV KA+  VN+ I  A++G D RDQ+ IDK MIDLDGTPNK +LGANAILGVS+AV++AA
Sbjct: 63  GVTKAVDNVNNIIAEAIIGYDVRDQMAIDKAMIDLDGTPNKGKLGANAILGVSIAVARAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    +PLY YLGG +  +LP P+MNI+NGG HADN++DFQEFMIMPVGA   +EA+RMG
Sbjct: 123 ADYLEVPLYHYLGGFNTKVLPTPMMNIINGGSHADNSIDFQEFMIMPVGAPTFKEALRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEV+H L   LK +G +T+VGDEGGF+PNL + +   ++I  +IEKAGY  GKD+++A+D
Sbjct: 183 AEVYHALASILKGRGLATSVGDEGGFAPNLGSNEEGFEVIIEAIEKAGYVPGKDVVLAMD 242

Query: 241 CAASAFFKKEK--YIL----KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGW 294
            A+S F+ KEK  Y+L    +GEN  +   +M ++   LV  YPI SIEDG+ E+DW G+
Sbjct: 243 AASSEFYDKEKGGYVLADSGEGENTTV---DMIAFYVVLVSIYPIISIEDGLDENDWDGF 299

Query: 295 KILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQM 354
           KILT  +G   QLVGDDLFVTN  +L +GI + +AN+ILIK NQIG+++ET   IE A+ 
Sbjct: 300 KILTEVLGDKVQLVGDDLFVTNTTKLAEGIEKGIANSILIKVNQIGTLTETFEAIEMAKE 359

Query: 355 AGYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAK 414
           AGY +++SHRSGETED TI+D+AVATN GQIKTGSL+R+DRIAKYNQL+RIE+ LG  A+
Sbjct: 360 AGYTAVVSHRSGETEDSTISDIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGDVAE 419

Query: 415 FAG 417
           + G
Sbjct: 420 YKG 422


>gi|160900540|ref|YP_001566122.1| phosphopyruvate hydratase [Delftia acidovorans SPH-1]
 gi|160366124|gb|ABX37737.1| Phosphopyruvate hydratase [Delftia acidovorans SPH-1]
          Length = 428

 Score =  516 bits (1329), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 257/418 (61%), Positives = 322/418 (77%), Gaps = 2/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIVGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A+LG DA +Q  +DK +IDLDGT NK RLGANA+L VS+AV++AAA
Sbjct: 64  VLKAVEHINTEISEAVLGLDASEQAFLDKTLIDLDGTDNKGRLGANAMLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG     LPVP+MN++NGG HA+N+LD QEFMI+PVGA + REA+R GA
Sbjct: 124 EEAGLPLYRYLGGMGGMQLPVPMMNVINGGAHANNSLDLQEFMIIPVGAPSFREAVRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK +  KG ST VGDEGGF+P+++  ++A+ LI  +IE AGY AG+ + + LDC
Sbjct: 184 EVFHALKKIIHDKGMSTAVGDEGGFAPSVENHEAAIQLILQAIENAGYKAGEQIALGLDC 243

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AAS F+K   Y+L GE NL L   +    LA   D+YPI SIEDGM+E DW GWKILT++
Sbjct: 244 AASEFYKDGMYVLAGEGNLTLTATQWTDMLAGWCDKYPIISIEDGMAEGDWDGWKILTDR 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           + +  QLVGDDLFVTN + L +GI++++AN+ILIK NQIG+++ET   IE A+ AGY ++
Sbjct: 304 LAAKVQLVGDDLFVTNTKILKEGIDKKIANSILIKINQIGTLTETFAAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           ISHRSGETED TIAD++V TN GQIKTGSL+RSDRIAKYNQL+RIEE LG  A + GR
Sbjct: 364 ISHRSGETEDSTIADISVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDIAHYPGR 421


>gi|291453635|ref|ZP_06593025.1| phosphopyruvate hydratase [Streptomyces albus J1074]
 gi|291356584|gb|EFE83486.1| phosphopyruvate hydratase [Streptomyces albus J1074]
          Length = 426

 Score =  516 bits (1329), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 256/418 (61%), Positives = 323/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ ++ARE++DSRG+PT+EV+V L+DGSTGRA VPSGASTG  EA ELRD +  RY GKG
Sbjct: 4   IDVVVAREILDSRGNPTVEVEVGLDDGSTGRAAVPSGASTGAFEAIELRDGDPNRYQGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V ++I   L+G DA +Q LID+ M DLD T NK  LGANAILGVSLAV+ AA+
Sbjct: 64  VEKAVLAVIEQIGPELVGYDATEQRLIDQAMFDLDATDNKGSLGANAILGVSLAVAHAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPL++YLGG +AH+LPVP+MNILNGG HAD+ +D QEFMI P+GAE+  EA+R G 
Sbjct: 124 EASDLPLFRYLGGPNAHLLPVPMMNILNGGSHADSNVDIQEFMIAPIGAESFSEALRWGT 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK LK KG +T +GDEGGF+PNL +  +ALDLI  ++++AGY  GKD+ +ALD 
Sbjct: 184 EVYHTLKKVLKRKGLATGLGDEGGFAPNLDSNRAALDLILEAVKEAGYVPGKDIALALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K   Y  +G++      EM  Y   LV  YP+ SIED + EDDW GW ++T K+
Sbjct: 244 AASEFYKDGSYEFEGKS--RSAAEMTEYYEELVAAYPLVSIEDPLFEDDWAGWNVITEKL 301

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNPERL +GI E+ ANA+L+K NQIGS++ETL+ +E AQ  G+  ++
Sbjct: 302 GDKVQLVGDDLFVTNPERLARGIEEKSANALLVKVNQIGSLTETLDAVELAQRNGFKCMM 361

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNCGQIKTG+ ARS+R+AKYNQL+RIEE L   A +AGRS
Sbjct: 362 SHRSGETEDVTIADLAVATNCGQIKTGAPARSERVAKYNQLLRIEEILDDAAVYAGRS 419


>gi|220911991|ref|YP_002487300.1| phosphopyruvate hydratase [Arthrobacter chlorophenolicus A6]
 gi|254783228|sp|B8HEU5|ENO_ARTCA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|219858869|gb|ACL39211.1| Phosphopyruvate hydratase [Arthrobacter chlorophenolicus A6]
          Length = 426

 Score =  516 bits (1329), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 260/419 (62%), Positives = 320/419 (76%), Gaps = 3/419 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I+ I ARE++DSRG+PT+EV+V L DG  GRA VPSGASTG HEA ELRD +K RY GK
Sbjct: 3   LIDAIHAREILDSRGNPTVEVEVLLSDGQIGRAAVPSGASTGEHEAVELRDGDKGRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV KA+  V D+I  AL G DA DQ  ID+ M+DLDGTPNK +LGANAILGVSLAV+ AA
Sbjct: 63  GVQKAVDAVIDQIAPALTGFDATDQRSIDQAMLDLDGTPNKGKLGANAILGVSLAVANAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A +++LPLYKYLGG +AH+LPVPLMNILNGG HAD+ +D QEFMI P+GAE   E +R G
Sbjct: 123 AASADLPLYKYLGGPNAHVLPVPLMNILNGGSHADSDVDIQEFMIAPIGAETFSEGLRWG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            EV+H LK  LK +G ST +GDEGGF+PNL +  +ALDLI  +I+ AGY  GKD+ +ALD
Sbjct: 183 VEVYHNLKSVLKEQGLSTGLGDEGGFAPNLPSNRAALDLIQEAIKNAGYTPGKDIALALD 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A+S FFK   Y  +G+   L  +EM++Y A LV  YP+ SIED + E+DW GWK LT+ 
Sbjct: 243 VASSEFFKDGAYQFEGK--ALSASEMSAYYAELVADYPLVSIEDPLDENDWEGWKTLTDA 300

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG   QLVGDDLFVTNP  L +GI+   AN++L+K NQIGS++ETL+ +  AQ AGY +I
Sbjct: 301 IGDKVQLVGDDLFVTNPAILQRGIDTRTANSLLVKVNQIGSLTETLDAVSLAQRAGYTTI 360

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
            SHRSGETED TIAD++VATN GQIKTG+ ARS+R+AKYNQL+RIEE L   A++AGRS
Sbjct: 361 TSHRSGETEDTTIADISVATNAGQIKTGAPARSERVAKYNQLLRIEEELDDAARYAGRS 419


>gi|167563332|ref|ZP_02356248.1| phosphopyruvate hydratase [Burkholderia oklahomensis EO147]
 gi|167570505|ref|ZP_02363379.1| phosphopyruvate hydratase [Burkholderia oklahomensis C6786]
          Length = 427

 Score =  516 bits (1329), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 315/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E   YLA L D++PI SIEDGM E DW GWK LT ++
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFTDYLATLADKFPIVSIEDGMHEGDWDGWKRLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRAGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|114332432|ref|YP_748654.1| phosphopyruvate hydratase [Nitrosomonas eutropha C91]
 gi|122312933|sp|Q0AD93|ENO_NITEC RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|114309446|gb|ABI60689.1| enolase [Nitrosomonas eutropha C91]
          Length = 428

 Score =  516 bits (1329), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 252/418 (60%), Positives = 318/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I D+IARE+IDSRG+PTIE DV LE G  GRA VPSGAS G  EA ELRD + +RY+GKG
Sbjct: 4   IVDVIAREIIDSRGNPTIEADVLLESGVLGRASVPSGASVGTREAVELRDGDTQRYYGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EI   ++G DA +Q  IDK +I+LDG+ NKSRLGANAIL VSLAV+KAAA
Sbjct: 64  VLKAVENVNGEISEEIMGLDATEQCFIDKTLIELDGSENKSRLGANAILAVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S+LPLY+YLGG ++  LPVP+MN++NGG+HA+N LD QEFMI+P+G  ++REA+R GA
Sbjct: 124 EESSLPLYRYLGGTNSKWLPVPMMNLINGGVHANNRLDMQEFMIIPLGLPSLREAVRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVF  L+  L  K   T VGDEGGF+P     + AL LI  +I++AGY  G ++ I +DC
Sbjct: 184 EVFGKLRTLLHKKNLPTTVGDEGGFAPGFAHNEEALGLIVQAIDEAGYQPGSEVAIGVDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S FF+  KY L  + L L   +   YLA+ V++YPI SIEDG+SE DW GWK+LT ++
Sbjct: 244 ASSEFFRDGKYHLAVDGLSLTSAQFIDYLASWVEKYPIISIEDGISEQDWDGWKLLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDD+F TN + L KGIN  +AN+ILIK NQIG+++ETLN IE A+ AGY +++
Sbjct: 304 GQTVQLVGDDIFATNTKILKKGINRNIANSILIKINQIGTLTETLNAIEMAKCAGYTAVV 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED  IAD+AV TN  QIKTGSL+RSDR+AKYNQL+RIEE LG  A++AGRS
Sbjct: 364 SHRSGETEDTMIADIAVGTNALQIKTGSLSRSDRLAKYNQLLRIEEDLGDVAQYAGRS 421


>gi|331694764|ref|YP_004331003.1| Enolase [Pseudonocardia dioxanivorans CB1190]
 gi|326949453|gb|AEA23150.1| Enolase [Pseudonocardia dioxanivorans CB1190]
          Length = 430

 Score =  516 bits (1329), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 252/417 (60%), Positives = 327/417 (78%), Gaps = 4/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I  + ARE++DSRG+PT+EV+V L+DG+  RA VPSGASTG HEA ELRD + KRY GKG
Sbjct: 4   IEQVGAREILDSRGNPTVEVEVALDDGTLARAAVPSGASTGEHEAVELRDGDAKRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+A V DEI   L G +A DQ L+D+ ++DLDGTP+KSRLGANA+LGVSLAV+KAAA
Sbjct: 64  VEKAVAAVLDEIGPELTGMEAVDQRLVDQRLVDLDGTPDKSRLGANALLGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           ++S L L++Y+GG +AH+LPVP+MNILNGG HAD ++D QEFMI P+GAE+ REA+R GA
Sbjct: 124 ESSGLELFRYVGGPNAHVLPVPMMNILNGGAHADTSVDVQEFMIAPIGAESFREALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTAD-SALDLIANSIEKAGYNAGKDLLIALD 240
           EV+H LK  LK  G +T +GDEGGF+P++      AL+LI+++IE  G++ G D+++ALD
Sbjct: 184 EVYHALKAVLKKNGLATGLGDEGGFAPDVAGGTRGALELISSAIETTGFSLGTDVVLALD 243

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            AA+ FF+K  Y  +G+  +L   E+++  A LVD++P+ SIED ++EDDW GW  LT  
Sbjct: 244 VAATEFFEKGSYSYEGK--QLGSAELSAVWAGLVDEFPLVSIEDPLAEDDWDGWVSLTES 301

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           IG   QLVGDDLFVTNPERL  GI    ANA+L+K NQIG++SETL+ +  AQ AGY  +
Sbjct: 302 IGGKVQLVGDDLFVTNPERLEDGILRGAANALLVKVNQIGTLSETLDAVTLAQSAGYRCM 361

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           +SHRSGETED TIADLAVAT+CGQIKTG+ ARS+R+AKYNQL+RIEE+LG  A++AG
Sbjct: 362 MSHRSGETEDTTIADLAVATSCGQIKTGAPARSERVAKYNQLLRIEEALGDAARYAG 418


>gi|69249235|ref|ZP_00604912.1| Enolase [Enterococcus faecium DO]
 gi|227552063|ref|ZP_03982112.1| phosphopyruvate hydratase [Enterococcus faecium TX1330]
 gi|257879698|ref|ZP_05659351.1| enolase [Enterococcus faecium 1,230,933]
 gi|257882691|ref|ZP_05662344.1| enolase [Enterococcus faecium 1,231,502]
 gi|257884005|ref|ZP_05663658.1| enolase [Enterococcus faecium 1,231,501]
 gi|257886775|ref|ZP_05666428.1| enolase [Enterococcus faecium 1,141,733]
 gi|257890362|ref|ZP_05670015.1| enolase [Enterococcus faecium 1,231,410]
 gi|257892969|ref|ZP_05672622.1| enolase [Enterococcus faecium 1,231,408]
 gi|257895343|ref|ZP_05674996.1| enolase [Enterococcus faecium Com12]
 gi|257897955|ref|ZP_05677608.1| enolase [Enterococcus faecium Com15]
 gi|258616693|ref|ZP_05714463.1| enolase [Enterococcus faecium DO]
 gi|260559643|ref|ZP_05831823.1| enolase [Enterococcus faecium C68]
 gi|261208708|ref|ZP_05923145.1| enolase [Enterococcus faecium TC 6]
 gi|289566035|ref|ZP_06446472.1| phosphopyruvate hydratase [Enterococcus faecium D344SRF]
 gi|293378214|ref|ZP_06624383.1| phosphopyruvate hydratase [Enterococcus faecium PC4.1]
 gi|293560044|ref|ZP_06676548.1| phosphopyruvate hydratase [Enterococcus faecium E1162]
 gi|293568831|ref|ZP_06680145.1| phosphopyruvate hydratase [Enterococcus faecium E1071]
 gi|293572442|ref|ZP_06683422.1| phosphopyruvate hydratase [Enterococcus faecium E980]
 gi|294614361|ref|ZP_06694277.1| phosphopyruvate hydratase [Enterococcus faecium E1636]
 gi|294617564|ref|ZP_06697194.1| phosphopyruvate hydratase [Enterococcus faecium E1679]
 gi|294622559|ref|ZP_06701562.1| phosphopyruvate hydratase [Enterococcus faecium U0317]
 gi|314939628|ref|ZP_07846855.1| phosphopyruvate hydratase [Enterococcus faecium TX0133a04]
 gi|314941254|ref|ZP_07848150.1| phosphopyruvate hydratase [Enterococcus faecium TX0133C]
 gi|314949813|ref|ZP_07853123.1| phosphopyruvate hydratase [Enterococcus faecium TX0082]
 gi|314953395|ref|ZP_07856320.1| phosphopyruvate hydratase [Enterococcus faecium TX0133A]
 gi|314993472|ref|ZP_07858837.1| phosphopyruvate hydratase [Enterococcus faecium TX0133B]
 gi|314997305|ref|ZP_07862270.1| phosphopyruvate hydratase [Enterococcus faecium TX0133a01]
 gi|68194237|gb|EAN08760.1| Enolase [Enterococcus faecium DO]
 gi|227178816|gb|EEI59788.1| phosphopyruvate hydratase [Enterococcus faecium TX1330]
 gi|257813926|gb|EEV42684.1| enolase [Enterococcus faecium 1,230,933]
 gi|257818349|gb|EEV45677.1| enolase [Enterococcus faecium 1,231,502]
 gi|257819843|gb|EEV46991.1| enolase [Enterococcus faecium 1,231,501]
 gi|257822829|gb|EEV49761.1| enolase [Enterococcus faecium 1,141,733]
 gi|257826722|gb|EEV53348.1| enolase [Enterococcus faecium 1,231,410]
 gi|257829348|gb|EEV55955.1| enolase [Enterococcus faecium 1,231,408]
 gi|257831908|gb|EEV58329.1| enolase [Enterococcus faecium Com12]
 gi|257835867|gb|EEV60941.1| enolase [Enterococcus faecium Com15]
 gi|260074311|gb|EEW62633.1| enolase [Enterococcus faecium C68]
 gi|260077210|gb|EEW64930.1| enolase [Enterococcus faecium TC 6]
 gi|289162142|gb|EFD10005.1| phosphopyruvate hydratase [Enterococcus faecium D344SRF]
 gi|291588548|gb|EFF20382.1| phosphopyruvate hydratase [Enterococcus faecium E1071]
 gi|291592669|gb|EFF24262.1| phosphopyruvate hydratase [Enterococcus faecium E1636]
 gi|291596170|gb|EFF27433.1| phosphopyruvate hydratase [Enterococcus faecium E1679]
 gi|291597954|gb|EFF29073.1| phosphopyruvate hydratase [Enterococcus faecium U0317]
 gi|291605911|gb|EFF35341.1| phosphopyruvate hydratase [Enterococcus faecium E1162]
 gi|291607504|gb|EFF36846.1| phosphopyruvate hydratase [Enterococcus faecium E980]
 gi|292643078|gb|EFF61219.1| phosphopyruvate hydratase [Enterococcus faecium PC4.1]
 gi|313588596|gb|EFR67441.1| phosphopyruvate hydratase [Enterococcus faecium TX0133a01]
 gi|313592137|gb|EFR70982.1| phosphopyruvate hydratase [Enterococcus faecium TX0133B]
 gi|313594588|gb|EFR73433.1| phosphopyruvate hydratase [Enterococcus faecium TX0133A]
 gi|313599978|gb|EFR78821.1| phosphopyruvate hydratase [Enterococcus faecium TX0133C]
 gi|313641168|gb|EFS05748.1| phosphopyruvate hydratase [Enterococcus faecium TX0133a04]
 gi|313643886|gb|EFS08466.1| phosphopyruvate hydratase [Enterococcus faecium TX0082]
          Length = 432

 Score =  516 bits (1329), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 253/420 (60%), Positives = 326/420 (77%), Gaps = 6/420 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ ARE++DSRG+PTIEV+V  E G+ GR MVPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   ITDVYAREILDSRGNPTIEVEVYTESGAFGRGMVPSGASTGEYEAVELRDGDKARYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ I  A++G D RDQ+ IDK MI LDGTPNK +LGANAILGVS+AV++AAA
Sbjct: 64  VTKAVDNVNNIIAEAIIGYDVRDQMAIDKAMIALDGTPNKGKLGANAILGVSIAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY YLGG +  +LP P+MNI+NGG HADN++DFQEFMIMPVGA   +EA+RMGA
Sbjct: 124 DYLEVPLYHYLGGFNTKVLPTPMMNIINGGSHADNSIDFQEFMIMPVGAPTFKEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH L   LK++G +T+VGDEGGF+PNL + +   ++I  +IEKAGY  GKD+++A+D 
Sbjct: 184 EVFHALASILKARGLATSVGDEGGFAPNLGSNEEGFEVIIEAIEKAGYVPGKDVVLAMDA 243

Query: 242 AASAFFKKEK--YIL--KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           A+S F+ KEK  Y+L   GE  E   +EM  +   LV +YPI SIEDG+ E+DW G+K L
Sbjct: 244 ASSEFYDKEKGVYVLADSGEG-EKTTDEMIKFYEELVSKYPIISIEDGLDENDWDGFKKL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T+ +G   QLVGDDLFVTN ++L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY
Sbjct: 303 TDVLGDKVQLVGDDLFVTNTQKLSEGIEKGIANSILIKVNQIGTLTETFEAIEMAKEAGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +++SHRSGETED TI+D+AVATN GQIKTGSL+R+DRIAKYNQL+RIE+ LG+ A++ G
Sbjct: 363 TAVVSHRSGETEDSTISDIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGEVAEYKG 422


>gi|148378233|ref|YP_001252774.1| enolase [Clostridium botulinum A str. ATCC 3502]
 gi|148287717|emb|CAL81782.1| enolase [Clostridium botulinum A str. ATCC 3502]
          Length = 431

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 254/416 (61%), Positives = 319/416 (76%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AR+++DSR +PT+EV+V LEDG+ G A VPSGASTG  EA ELRD +K +Y GKG
Sbjct: 7   IVDVYARQILDSRCNPTVEVEVELEDGTVGVAAVPSGASTGAFEAVELRDGDKSKYLGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN  I   L+G +  DQ+ IDK MI+LDGT NK++LGANA+LGVSLA +KAAA
Sbjct: 67  VLKAVDNVNTIIADELVGMNVLDQVAIDKTMIELDGTDNKAKLGANAMLGVSLACAKAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +  + LY+Y+GG +  +LPVP+MNI+NGG HADN +D QEFMIMP GA +  EA+RM +
Sbjct: 127 NSLGISLYQYIGGVNGKVLPVPMMNIINGGKHADNNVDLQEFMIMPAGAPSFSEALRMCS 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+H LK  LK++GY T VGDEGGF+PNLK+ + A+ +I  +I+KAGY  G+D+ IALD 
Sbjct: 187 EVYHALKSTLKAQGYDTGVGDEGGFAPNLKSNEEAIVVIIEAIKKAGYTPGEDIFIALDP 246

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S  F+  KY L GE   L P EMA+Y   L ++YPI SIEDGM+E+DW GWKILT KI
Sbjct: 247 ASSEIFEDGKYNLAGEGRVLTPEEMANYYVELAEKYPIISIEDGMAEEDWDGWKILTEKI 306

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  QLVGDDLFVTN ERL KGI   VAN+ILIK NQIG+++ETLN IE A+ AGY +++
Sbjct: 307 GNKVQLVGDDLFVTNTERLSKGIKLGVANSILIKLNQIGTLTETLNAIEMAERAGYTAVV 366

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQL+RIEE L    ++ G
Sbjct: 367 SHRSGETEDTTIADLVVAVNAGQIKTGAPARSERVAKYNQLLRIEEELNDMGEYRG 422


>gi|33864347|ref|NP_895907.1| phosphopyruvate hydratase [Prochlorococcus marinus str. MIT 9313]
 gi|59797617|sp|Q7V483|ENO_PROMM RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|33641127|emb|CAE22257.1| Enolase [Prochlorococcus marinus str. MIT 9313]
          Length = 431

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/417 (60%), Positives = 317/417 (76%), Gaps = 2/417 (0%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGK 60
           + I+ I+AREV+DSRG+PT+E +V LE G+ GRA+VPSGASTG HEA ELRD + RY GK
Sbjct: 7   LVIDTIVAREVLDSRGNPTVEAEVLLEAGAIGRAIVPSGASTGAHEAHELRDGDSRYLGK 66

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV KA+  + D I  AL G  + DQ  +D  M +LDG+ NKS LGANAIL VS+A ++AA
Sbjct: 67  GVTKAVNHIEDRIAPALCGISSLDQASVDGTMQELDGSDNKSSLGANAILAVSMATARAA 126

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    LPLY+YLGG  A +LPVPLMN++NGG HA N LDFQEFM++P GA + RE++RMG
Sbjct: 127 ANGLGLPLYRYLGGPMASLLPVPLMNVINGGAHAANNLDFQEFMLVPHGASSFRESLRMG 186

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFHTLK  L ++G ST VGDEGGF+PNL   D+A DL+  +IEKAGY+ GKD+ +ALD
Sbjct: 187 AEVFHTLKGLLSAQGLSTAVGDEGGFAPNLANNDAAGDLLIQAIEKAGYSPGKDISLALD 246

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A++ F++   Y   G        EM + L  LVD+YPI SIEDG++EDDW GW +LT K
Sbjct: 247 VASTEFYQDGCYAFGGG--RYTSTEMVNELEKLVDRYPIISIEDGLAEDDWQGWALLTKK 304

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QL+GDD+FVT+ +RL +GI++ VAN+ILIK NQIGS++ETL  I+ A  +GY S+
Sbjct: 305 LGKRIQLIGDDIFVTSTKRLQQGIDQNVANSILIKVNQIGSLTETLQAIDLAGRSGYTSV 364

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ISHRSGETED TIADLAVAT  GQIKTGSL+RS+R+AKYNQL+RIE+ LG QA +AG
Sbjct: 365 ISHRSGETEDTTIADLAVATRAGQIKTGSLSRSERVAKYNQLLRIEDELGSQAVYAG 421


>gi|312143201|ref|YP_003994647.1| enolase [Halanaerobium sp. 'sapolanicus']
 gi|311903852|gb|ADQ14293.1| enolase [Halanaerobium sp. 'sapolanicus']
          Length = 428

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 253/416 (60%), Positives = 324/416 (77%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I D+ ARE++DSRG+PT+EV+V LEDG  GRA VPSGASTG +EA ELRD   RY GKGV
Sbjct: 6   IVDVYAREILDSRGNPTVEVEVVLEDGVMGRAAVPSGASTGAYEAVELRDGGDRYLGKGV 65

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
           LKA+  +N+ I   ++G D R Q+ ID IM++LDGT NK +LGANAILGVS+AV+KAAA+
Sbjct: 66  LKAVENINEIIAPEIIGYDVRSQIEIDNIMLELDGTANKGKLGANAILGVSMAVAKAAAE 125

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            +   LY Y+GG  A+ LPVP+MNILNGG HADN +D QEFMIMPVGA + REA++MGAE
Sbjct: 126 ATGTFLYNYIGGAKANTLPVPMMNILNGGEHADNNVDLQEFMIMPVGAVSFREALQMGAE 185

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           V+H LKK L+ KG  T VGDEGGF+P+L + ++AL++I  +IE AGY +G+D  IALD A
Sbjct: 186 VYHNLKKVLQDKGLGTGVGDEGGFAPDLDSNEAALEVIVEAIEAAGYESGEDFYIALDPA 245

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ F+K  KY+L GE +E    EM  + A L D+YPI SIEDG++EDDW G+  +T ++G
Sbjct: 246 ATEFYKDGKYVLAGEGVEKTSEEMIEFYAELADKYPIISIEDGLAEDDWEGFAKMTAQLG 305

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              Q+VGDDL+VTN ERL +GI E  +N+ILIK NQIG+++ETL TIE A  AG+ S++S
Sbjct: 306 DRMQIVGDDLYVTNTERLSRGIEENSSNSILIKVNQIGTLTETLETIEMATRAGFTSVVS 365

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           HRSGETED TI+DL VA N GQIKTG+ ARS+R+AKYNQL+RIEESLG+ A++AG+
Sbjct: 366 HRSGETEDVTISDLVVAMNTGQIKTGAPARSERVAKYNQLLRIEESLGEAAQYAGK 421


>gi|304317438|ref|YP_003852583.1| enolase [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778940|gb|ADL69499.1| enolase [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 428

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 261/420 (62%), Positives = 326/420 (77%), Gaps = 2/420 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I D+ ARE++DSRG+PT+EV+V L+ G+ GRA VPSGASTG  EA ELRD +  RY GK
Sbjct: 3   IIVDVYAREILDSRGNPTVEVEVELDSGAVGRAAVPSGASTGQFEAVELRDGDNNRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLKA+  VN++I   ++G DA DQ+ IDK MIDLDGTPNKS LGANAILGVSLAV+KAA
Sbjct: 63  GVLKAVENVNEKIAPEIIGMDAIDQVAIDKAMIDLDGTPNKSNLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A+   LPLY+YLGG +A ILPVP+MNILNGG HADN +D QEFMIMPVGA++  EA+R  
Sbjct: 123 AEEVGLPLYQYLGGVNAKILPVPMMNILNGGKHADNNVDIQEFMIMPVGAQSFHEALRTC 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFH L+  LKSKG ST VGDEGGF+PNL + + A+ +I  +I+KAGY  G+D+ IALD
Sbjct: 183 AEVFHNLRSVLKSKGLSTTVGDEGGFAPNLTSNEEAIQVILEAIQKAGYVPGEDVAIALD 242

Query: 241 CAASAFFKKE-KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
            A+S  +K++ KY   GE +     EM  Y   LV++YPI SIEDG++E+DW GWK+LT 
Sbjct: 243 PASSEMYKEDGKYHFDGEGVVRTSEEMVDYWEQLVNKYPIVSIEDGLAEEDWDGWKLLTE 302

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++G   QLVGDDLFVTN ERL KGI   VAN+ILIK NQIG+++ETL+ IE A+ AGY +
Sbjct: 303 RLGKRIQLVGDDLFVTNTERLSKGIKMGVANSILIKLNQIGTLTETLDAIEMAKKAGYTA 362

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ++SHRSGETED TIADL VA N GQIKTG+ +R+DR+ KYNQL+RIEE LG  A++ G++
Sbjct: 363 VVSHRSGETEDSTIADLVVAVNAGQIKTGAPSRTDRVVKYNQLMRIEEGLGGIAQYLGKA 422


>gi|183221090|ref|YP_001839086.1| phosphopyruvate hydratase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189911182|ref|YP_001962737.1| phosphopyruvate hydratase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|238687767|sp|B0S8S8|ENO_LEPBA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|238687845|sp|B0SRL5|ENO_LEPBP RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|167775858|gb|ABZ94159.1| Enolase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167779512|gb|ABZ97810.1| Enolase (2-phosphoglycerate dehydratase; 2-phospho-D-glycerate
           hydro-lyase) [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 433

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 262/419 (62%), Positives = 326/419 (77%), Gaps = 4/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGKG 61
           I  + ARE++DSRG+PT+EVDV LEDGS GRA VPSGASTG HEA ELRD  +KRY GKG
Sbjct: 7   IRSVRAREIMDSRGNPTVEVDVTLEDGSFGRAAVPSGASTGEHEAVELRDGDKKRYGGKG 66

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN +I  ++LG  A DQL ID  MI LDGT NKS+LGANAILGVS+AV+KAAA
Sbjct: 67  VQKAVDNVNAKISKSILGLSATDQLQIDGTMIALDGTANKSKLGANAILGVSMAVAKAAA 126

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             + LPLY+Y+GG  A  LPVP+MNI+NGG HADN +DFQEFMI+PV A N +EA+RMGA
Sbjct: 127 VHAGLPLYRYIGGTFARELPVPMMNIINGGAHADNNIDFQEFMILPVSAPNFKEALRMGA 186

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH+LK  LK KG +T VGDEGGF+PNL +   A+++I  +IEKAGY    D+ I LDC
Sbjct: 187 EVFHSLKTVLKGKGLNTAVGDEGGFAPNLTSNSEAIEVILTAIEKAGYKPDLDIKIGLDC 246

Query: 242 AASAFF--KKEKYILKGENL-ELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILT 298
           AAS F+  KK+KYILK E   E    E+  Y +NLV +YPI ++EDG+ E+DW GWK L+
Sbjct: 247 AASEFYDEKKKKYILKAEKKPEKTAEELVEYYSNLVSKYPIITMEDGLDENDWSGWKKLS 306

Query: 299 NKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYP 358
            K+G   QLVGDDLFVTN ++L +GI++ + N+ILIK NQIGS++ETL+ IE A+ A Y 
Sbjct: 307 EKLGKKIQLVGDDLFVTNIKKLAQGIDKGIGNSILIKVNQIGSLTETLSAIEMAKKAQYT 366

Query: 359 SIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           +++SHRSGETED TI+ +AVATN GQIKTGSL+R+DRIAKYN+L+RIEE LGK A ++G
Sbjct: 367 AVVSHRSGETEDATISHIAVATNSGQIKTGSLSRTDRIAKYNELLRIEEELGKNATYSG 425


>gi|319637981|ref|ZP_07992745.1| enolase [Neisseria mucosa C102]
 gi|317400626|gb|EFV81283.1| enolase [Neisseria mucosa C102]
          Length = 428

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 257/418 (61%), Positives = 321/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVDHVNNQIAQALIGIDASEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDAGLPLYRYLGGAGPMALPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   SKG+ T VGDEGGF+PNL +   AL L+  + E AGY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  +Y L+ E       E A YL  LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGQYHLEAEGRSYTSAEFAEYLEGLVNEFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GKKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLQAVDLAKRNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAAYYPGKA 421


>gi|315174302|gb|EFU18319.1| phosphopyruvate hydratase [Enterococcus faecalis TX1346]
          Length = 432

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 255/420 (60%), Positives = 322/420 (76%), Gaps = 6/420 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI AREV+DSRG+PTIEV+V  E G+ GR MVPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   ITDIYAREVLDSRGNPTIEVEVYTESGAFGRGMVPSGASTGEYEAVELRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ I  A++G D RDQ+ IDK MIDLDGTPNK +LGANAIL VS+AV++AAA
Sbjct: 64  VTKAVDNVNNIIAEAIIGYDVRDQMAIDKAMIDLDGTPNKGKLGANAILSVSIAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY YLGG +  +LP P+MNI+NGG HADN++DFQEFMIMPVGA   +EA+RMGA
Sbjct: 124 DYLEVPLYHYLGGFNTKVLPTPMMNIINGGSHADNSIDFQEFMIMPVGAPTFKEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH L   LK +G +T+VGDEGGF+PNL + +   ++I  +IEKAGY  GKD+++A+D 
Sbjct: 184 EVFHALASILKGRGLATSVGDEGGFAPNLGSNEEGFEVIIEAIEKAGYVPGKDVVLAMDA 243

Query: 242 AASAFFKKEK--YIL--KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           A+S F+ KEK  Y+L   GE  E    EM ++   LV +YPI SIEDG+ E+DW G+K L
Sbjct: 244 ASSEFYDKEKGVYVLADSGEG-EKTTEEMIAFYEELVSKYPIISIEDGLDENDWDGFKKL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T  +G   QLVGDDLFVTN  +L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY
Sbjct: 303 TEVLGDKVQLVGDDLFVTNTTKLAEGIEKGIANSILIKVNQIGTLTETFEAIEMAKEAGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +++SHRSGETED TI+D+AVATN GQIKTGSL+R+DRIAKYNQL+RIE+ LG  A++ G
Sbjct: 363 TAVVSHRSGETEDSTISDIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGDVAEYKG 422


>gi|268317243|ref|YP_003290962.1| enolase [Rhodothermus marinus DSM 4252]
 gi|262334777|gb|ACY48574.1| enolase [Rhodothermus marinus DSM 4252]
          Length = 427

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 259/420 (61%), Positives = 326/420 (77%), Gaps = 3/420 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
           +I++IIAR+++DSRG+PT+EVDV  ++G  GRA VPSGASTG HEA ELRD +K RY GK
Sbjct: 3   YIDEIIARQILDSRGNPTLEVDVITDEGIVGRAAVPSGASTGEHEAVELRDGDKSRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVL+A+A VN++I   L G    +Q  ID+ +I LDGTPNKS+LGANAILGVSLAV+KAA
Sbjct: 63  GVLQAVANVNEKIAPELTGFSVFEQAAIDEALIALDGTPNKSKLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A T++LPLY+Y+GG +A  LPVPLMNI+NGG HADN LD QEFMI PVG  +  EA+R+G
Sbjct: 123 AATADLPLYRYVGGTNARTLPVPLMNIINGGRHADNNLDLQEFMIAPVGGGSFSEALRIG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
            E+FH LK+ LKSKGYST VGDEGGF+PNL+  + A+++I  +IEKAGY AG+D+ +ALD
Sbjct: 183 VEIFHHLKQVLKSKGYSTAVGDEGGFAPNLRANEEAVEVILEAIEKAGYRAGEDVFLALD 242

Query: 241 CAASAFFKKEKYILKGENLELQ--PNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILT 298
            A S  ++   Y+    + + +    +M ++    V+QYPI SIEDGM+EDDW GW++LT
Sbjct: 243 PATSEMYRDGYYVFWKSDPDTKRTSEDMVAFWERWVNQYPIISIEDGMAEDDWEGWRLLT 302

Query: 299 NKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYP 358
            ++G   QLVGDDLFVTN ERL +GI+   AN+ILIKPNQIG+++ETL  IE A   GY 
Sbjct: 303 ERLGHRVQLVGDDLFVTNTERLQRGIDSGCANSILIKPNQIGTLTETLAAIELAHKHGYT 362

Query: 359 SIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           +I+SHRSGETED TIADLAVA N GQIKTGS +RSDRIAKYNQL+RIEE LG  A+F GR
Sbjct: 363 AILSHRSGETEDTTIADLAVAANTGQIKTGSASRSDRIAKYNQLLRIEEQLGDTARFLGR 422


>gi|158520356|ref|YP_001528226.1| phosphopyruvate hydratase [Desulfococcus oleovorans Hxd3]
 gi|238686875|sp|A8ZSY5|ENO_DESOH RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|158509182|gb|ABW66149.1| Phosphopyruvate hydratase [Desulfococcus oleovorans Hxd3]
          Length = 426

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 256/412 (62%), Positives = 321/412 (77%), Gaps = 1/412 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGKG 61
           I ++ ARE++DSRG+PT+EVDV L  G+TGRA VPSGASTG  EA ELRD ++KRY GKG
Sbjct: 4   IIEVQAREILDSRGNPTVEVDVTLSGGATGRAAVPSGASTGTREALELRDTRKKRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN  I   L G  A +Q ++D  MI LDGT NKS+LGANAILGVS+AV++AAA
Sbjct: 64  VEKAVENVNTLIGPVLYGMPADEQFMVDSTMIGLDGTANKSKLGANAILGVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+YLGG  A  LP+P+MNI+NGG HA N+LD QEFMI+PVG + I E +RMGA
Sbjct: 124 DAYELPLYRYLGGIHAKHLPMPMMNIVNGGAHAANSLDIQEFMIIPVGGKTIAECVRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTLKK LK+KG++T VGDEGGF+P+L++ ++A+  I  +I+KAGY  G+D+ IALD 
Sbjct: 184 EVFHTLKKLLKAKGFATAVGDEGGFAPDLESNEAAIGFIMEAIKKAGYRPGRDVGIALDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F++K KY+LKGE  +L   +M  Y  NL+D+YPI SIEDG++E DW  W ++T+++
Sbjct: 244 AASEFYEKGKYVLKGEGKKLSSKQMVDYYENLIDKYPILSIEDGLAEQDWDNWVMMTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G+  Q+VGDD+FVTNP    KGI E +AN+ILIK NQIG+VSETL  I+ A+ AGY ++I
Sbjct: 304 GNTTQIVGDDVFVTNPAIFEKGIREGLANSILIKLNQIGTVSETLQAIDMAKQAGYTTVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQA 413
           SHRSGETED  IADLAV  N GQIKTGSL+RSDRIAKYNQLIRIEE+LG  A
Sbjct: 364 SHRSGETEDAFIADLAVGVNGGQIKTGSLSRSDRIAKYNQLIRIEEALGAGA 415


>gi|121635000|ref|YP_975245.1| phosphopyruvate hydratase [Neisseria meningitidis FAM18]
 gi|166232210|sp|A1KUB6|ENO_NEIMF RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|120866706|emb|CAM10458.1| enolase [Neisseria meningitidis FAM18]
 gi|254673343|emb|CBA08551.1| Enolase [Neisseria meningitidis alpha275]
 gi|325132511|gb|EGC55204.1| phosphopyruvate hydratase [Neisseria meningitidis M6190]
 gi|325138285|gb|EGC60854.1| phosphopyruvate hydratase [Neisseria meningitidis ES14902]
 gi|325142427|gb|EGC64831.1| phosphopyruvate hydratase [Neisseria meningitidis 961-5945]
 gi|325198440|gb|ADY93896.1| phosphopyruvate hydratase [Neisseria meningitidis G2136]
          Length = 428

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 322/418 (77%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYSGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVEHVNNQIAQALIGIDASEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDAGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   SKG+ T VGDEGGF+PNL +   AL L+  + E AGY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YL +LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGRSYTNAEFAEYLESLVNEFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GGKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAADYPGKA 421


>gi|148263837|ref|YP_001230543.1| phosphopyruvate hydratase [Geobacter uraniireducens Rf4]
 gi|189037217|sp|A5GEW5|ENO_GEOUR RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|146397337|gb|ABQ25970.1| enolase [Geobacter uraniireducens Rf4]
          Length = 429

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 258/424 (60%), Positives = 326/424 (76%), Gaps = 8/424 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ ARE++DSRG+PT+EV+V LE G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   ITDVYAREILDSRGNPTLEVEVFLESGAMGRAAVPSGASTGEREALELRDGDKGRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+A VND I   ++G +A DQ+ ID+ M+DLDGT  KS+LGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVANVNDIIADEVIGMEATDQVGIDRKMLDLDGTEYKSKLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               L LY+Y+GG +A  LP+P+MNI+NGG HADN +D QEFMIMP GA+N  EA+RMGA
Sbjct: 124 DEVGLSLYQYIGGSNAKELPLPMMNIINGGAHADNNVDIQEFMIMPAGAKNFAEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LK  LK+KGY+T VGDEGGF+PNLK+ + AL +I  +I KAG+  G+D+L+ALD 
Sbjct: 184 EIFHALKAVLKAKGYNTAVGDEGGFAPNLKSNEEALQVIMEAITKAGFKPGEDVLLALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYL----ANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           A+S  FK   Y L  EN E QP + A  L     NLV++YPI SIEDGM+E+DW GWK +
Sbjct: 244 ASSELFKDGVYTL--EN-EAQPQKTADQLIDFYENLVNKYPIISIEDGMAENDWDGWKKM 300

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T ++G   Q+VGDDLFVTNP  L +GI++ +AN+ILIK NQIG+++ETL+ IE A+ AGY
Sbjct: 301 TERLGKRIQIVGDDLFVTNPRILKEGIDKGIANSILIKLNQIGTLTETLDAIEMAKRAGY 360

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            ++ISHRSGETED T+ADL+VA N GQIKTGSL R+DR+ KYNQL+RIE+ L   A F G
Sbjct: 361 TTVISHRSGETEDTTLADLSVAVNAGQIKTGSLCRTDRVCKYNQLLRIEDELDAVALFRG 420

Query: 418 RSIL 421
           + + 
Sbjct: 421 KEVF 424


>gi|161524338|ref|YP_001579350.1| phosphopyruvate hydratase [Burkholderia multivorans ATCC 17616]
 gi|189350906|ref|YP_001946534.1| phosphopyruvate hydratase [Burkholderia multivorans ATCC 17616]
 gi|221198412|ref|ZP_03571458.1| phosphopyruvate hydratase [Burkholderia multivorans CGD2M]
 gi|221208911|ref|ZP_03581908.1| phosphopyruvate hydratase [Burkholderia multivorans CGD2]
 gi|221214758|ref|ZP_03587727.1| phosphopyruvate hydratase [Burkholderia multivorans CGD1]
 gi|238687035|sp|A9AGW2|ENO_BURM1 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|160341767|gb|ABX14853.1| Phosphopyruvate hydratase [Burkholderia multivorans ATCC 17616]
 gi|189334928|dbj|BAG43998.1| enolase [Burkholderia multivorans ATCC 17616]
 gi|221165297|gb|EED97774.1| phosphopyruvate hydratase [Burkholderia multivorans CGD1]
 gi|221171194|gb|EEE03644.1| phosphopyruvate hydratase [Burkholderia multivorans CGD2]
 gi|221182344|gb|EEE14745.1| phosphopyruvate hydratase [Burkholderia multivorans CGD2M]
          Length = 427

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 316/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILSDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E   YL+ L D++PI SIEDGM E DW GWK+LT+++
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFTDYLSTLADKFPIVSIEDGMHESDWDGWKLLTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ A Y ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRASYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|269837695|ref|YP_003319923.1| enolase [Sphaerobacter thermophilus DSM 20745]
 gi|269786958|gb|ACZ39101.1| enolase [Sphaerobacter thermophilus DSM 20745]
          Length = 433

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 253/417 (60%), Positives = 318/417 (76%), Gaps = 1/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I  I ARE++DSRG+PT+EVDV L  G+ GRA VPSGASTG +EA ELRD+++RY GKGV
Sbjct: 6   IEAIKAREILDSRGNPTVEVDVILAGGARGRAAVPSGASTGAYEAVELRDKDQRYGGKGV 65

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
             A+  VN  I   LLG DA+DQ  ID  MI+LDGTPNKSRLGANAILGVSLA ++AAA 
Sbjct: 66  RTAVDNVNGPIAGVLLGMDAQDQRAIDMAMIELDGTPNKSRLGANAILGVSLATARAAAA 125

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNA-LDFQEFMIMPVGAENIREAIRMGA 181
            + LPLY+YLGG SAH+LPVP+MNILNGG HA+ + +D QEFM+MPVGA   RE +R GA
Sbjct: 126 AAGLPLYQYLGGPSAHVLPVPMMNILNGGKHAEGSTVDMQEFMVMPVGAPTFREGLRWGA 185

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH+LKK L S GY+T VGDEGG++P+LK+   AL  I  +IE+AGY  G+D+L+ALD 
Sbjct: 186 EIFHSLKKVLSSAGYATGVGDEGGYAPSLKSNQEALAYITQAIEQAGYRPGEDVLLALDP 245

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++  ++  +Y+L+GE   L   EM  + A  VD+YPI SIEDG++EDDW GW  LT ++
Sbjct: 246 ASTELYEDGRYVLRGEGRTLTTAEMVDFWAEWVDRYPIISIEDGLAEDDWDGWAELTRRL 305

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN +RL +GI   V N+IL+K NQIG++SET + I  A  AG+ ++I
Sbjct: 306 GDRVQLVGDDLFVTNTQRLARGIELGVGNSILVKLNQIGTLSETFDAIAMAHRAGFTAVI 365

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           SHRSGET D  +ADLAVATN GQIKTG+ +R DR+ KYNQL+RIEE LG QA++AGR
Sbjct: 366 SHRSGETADSFVADLAVATNAGQIKTGAPSRMDRVEKYNQLLRIEEELGTQAEYAGR 422


>gi|83721440|ref|YP_442424.1| phosphopyruvate hydratase [Burkholderia thailandensis E264]
 gi|167581353|ref|ZP_02374227.1| phosphopyruvate hydratase [Burkholderia thailandensis TXDOH]
 gi|167619430|ref|ZP_02388061.1| phosphopyruvate hydratase [Burkholderia thailandensis Bt4]
 gi|257138627|ref|ZP_05586889.1| phosphopyruvate hydratase [Burkholderia thailandensis E264]
 gi|119369304|sp|Q2SXC5|ENO_BURTA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|83655265|gb|ABC39328.1| enolase [Burkholderia thailandensis E264]
          Length = 427

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 317/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYNGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILGDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E + YLA L D++PI SIEDGM E DW GWK+LT+++
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFSDYLATLADKFPIVSIEDGMHESDWDGWKLLTDRL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ A Y ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRARYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|257784163|ref|YP_003179380.1| enolase [Atopobium parvulum DSM 20469]
 gi|257472670|gb|ACV50789.1| enolase [Atopobium parvulum DSM 20469]
          Length = 429

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 255/418 (61%), Positives = 324/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AREV+DSRG+PT+EV+V L+DGS GRA+VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IFDVHAREVLDSRGNPTVEVEVVLDDGSFGRAIVPSGASTGEFEAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EIR  ++G DA DQ  +D  MI LDGTPNK RLGANAILGVSLAV+ AAA
Sbjct: 64  VLKAVEHVNTEIRDLVIGWDAEDQRGLDLAMIKLDGTPNKGRLGANAILGVSLAVAHAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            ++ LPLY YLGG +AH LPVP+MN+LNGG+HADN +DFQEFMIMPVGA +   A+R  A
Sbjct: 124 ASAELPLYAYLGGANAHTLPVPMMNVLNGGVHADNNVDFQEFMIMPVGAPDFTTALRWCA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           +V+HTLK  LKS+G +T VGDEGGF+P+LK+ +  L+L++ +++ AG+  GKD   A+D 
Sbjct: 184 QVYHTLKDTLKSQGLNTGVGDEGGFAPDLKSNEEPLELLSEAVKAAGFELGKDFRFAMDP 243

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           A+S F+ KE  KY LKGE   L   EM +Y   +V+++PI SIEDG++E+DW GWK+LT 
Sbjct: 244 ASSEFYNKETGKYDLKGEGRSLTSEEMVAYYEEMVEKFPIVSIEDGLAEEDWDGWKVLTQ 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++G   QLVGDDLFVTN +RL KGI     N+ILIK NQIG+++E+L  IE A+ AGY +
Sbjct: 304 RLGKKIQLVGDDLFVTNTQRLKKGIEVHAGNSILIKVNQIGTLTESLEAIEMAKRAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIADL VATN GQIKTG+ AR++R+AKYNQL+RIE+ L   A++ G
Sbjct: 364 VVSHRSGETEDTTIADLVVATNAGQIKTGAPARTERVAKYNQLLRIEDDLADGAEYLG 421


>gi|291294407|ref|YP_003505805.1| enolase [Meiothermus ruber DSM 1279]
 gi|290469366|gb|ADD26785.1| enolase [Meiothermus ruber DSM 1279]
          Length = 424

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 246/415 (59%), Positives = 314/415 (75%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I +I  REV+DSRG+PT+E +V LE G+ GRAMVPSGASTG HEA ELRD   R+ GKGV
Sbjct: 4   IVEIKGREVLDSRGNPTVEAEVVLESGARGRAMVPSGASTGAHEAVELRDGGPRFGGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
           L+A+A +N+ I   ++G DA +Q  +DK M++LDGTPNK  LGANAIL VSLA + AAA 
Sbjct: 64  LRAVAAINERIADEVIGLDALNQEAVDKTMLELDGTPNKGNLGANAILAVSLATAHAAAS 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
              LPLY+YLGG     LPVPLMN++NGG HADN +DFQEFM++P G     EA+R G E
Sbjct: 124 GLGLPLYRYLGGVQGVTLPVPLMNVINGGKHADNNVDFQEFMLVPGGLPTFSEALRAGVE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
            FH LK  LK+KGY+TNVGDEGGF+P+LK+ + A++++  +IEKAGY  G+++ IALD A
Sbjct: 184 TFHALKSVLKAKGYNTNVGDEGGFAPDLKSNEEAVEVLLTAIEKAGYKPGQEIAIALDPA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           +S F+++ +Y+L+ +   L   EM +Y  N V+QYPI SIEDG++EDDW  WK+LT ++G
Sbjct: 244 SSEFYQEGRYVLEADGKSLSGPEMVAYWENWVNQYPIVSIEDGLAEDDWETWKLLTERLG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTNP  L +GI   V N+IL+K NQIG++SETL  I  A  +GY +I+S
Sbjct: 304 RRIQLVGDDLFVTNPAILKRGIELGVGNSILVKVNQIGTLSETLEAIRLAHRSGYTTILS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           HRSGETED+TIAD+AVA N GQIKTGS +RSDR+AKYNQL+RIEE LG  A+F G
Sbjct: 364 HRSGETEDNTIADIAVAVNAGQIKTGSASRSDRLAKYNQLLRIEEELGTGARFLG 418


>gi|283851392|ref|ZP_06368673.1| enolase [Desulfovibrio sp. FW1012B]
 gi|283573130|gb|EFC21109.1| enolase [Desulfovibrio sp. FW1012B]
          Length = 435

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 252/416 (60%), Positives = 315/416 (75%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I  + ARE++DSRG+PT+EV+V LE G+TGRA VPSGASTG  EA ELRDQ+  RY GKG
Sbjct: 4   IAAVWAREILDSRGNPTVEVEVTLESGATGRAAVPSGASTGSREALELRDQDASRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V  E+   ++G DA  Q+ ID +MID DGT NKSRLGANAILGVS+AV++AA+
Sbjct: 64  VGKAVENVQGELAETVIGMDALQQVAIDNLMIDTDGTENKSRLGANAILGVSMAVARAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LP Y+YLGG +A +LPVPLMNI+NGG HA N LD QEFMI+P+GA    +A+RMGA
Sbjct: 124 TFLGLPFYQYLGGINAKVLPVPLMNIINGGAHAPNNLDIQEFMIVPLGARTFSDALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E FHTLK  L + G+ T+VGDEGGF+PNLK  D A   I  +IE+AGY  G ++ +A+D 
Sbjct: 184 ETFHTLKTILAADGHVTSVGDEGGFAPNLKDHDEAFKYIIKAIEEAGYRPGDEISLAIDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY+L GE   +   EM +YL+  VD+YPI SIEDG++E DW GWK LT  +
Sbjct: 244 AASEFYKNGKYVLGGEKRTMSSEEMVAYLSGFVDRYPIISIEDGLAESDWDGWKKLTMHL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDD+FVTNP+ L +GI++ VAN+ILIK NQIG+V+ETL+TIE A+ A Y ++I
Sbjct: 304 GERIQLVGDDIFVTNPDILAEGIDQGVANSILIKLNQIGTVTETLDTIEMAKQAAYTTVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED  IADL+VA N GQIK+GS++RSDR+AKYNQL+RIEE L   A F G
Sbjct: 364 SHRSGETEDSFIADLSVAVNAGQIKSGSISRSDRLAKYNQLLRIEEELEDSAIFYG 419


>gi|239905804|ref|YP_002952543.1| enolase [Desulfovibrio magneticus RS-1]
 gi|259645916|sp|C4XLR9|ENO_DESMR RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|239795668|dbj|BAH74657.1| enolase [Desulfovibrio magneticus RS-1]
          Length = 436

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 250/416 (60%), Positives = 315/416 (75%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I  + ARE++DSRG+PT+EV+V LE G++GRA VPSGASTG  EA E+RDQ+  RY GKG
Sbjct: 4   IAAVWAREILDSRGNPTVEVEVTLESGASGRAAVPSGASTGSREALEMRDQDASRYAGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  V  E+   ++G DA  Q+ ID +MID DGT NKSRLGANAILGVSLAV +AA+
Sbjct: 64  VTKAVENVQGELADTVIGMDALQQVAIDNLMIDTDGTENKSRLGANAILGVSLAVCRAAS 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+Y+GG ++ +LPVP+MNI+NGG HA N LD QEFMI+P+GA    +A+RMGA
Sbjct: 124 NFLGLPLYQYIGGINSKVLPVPMMNIINGGAHAPNNLDIQEFMIIPLGARTFADALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E FHTLKK L + G+ T VGDEGGF+PNLK+ D A   I  +IE++GY  G ++ +A+D 
Sbjct: 184 ETFHTLKKILAADGHMTAVGDEGGFAPNLKSHDEAFKYIIKAIEESGYRPGSEISLAIDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+K  KY+L GENL L   EM  YL   V++YP+ SIEDG++E DW GWK LT  +
Sbjct: 244 AASEFYKNGKYVLTGENLSLSSTEMVDYLGGFVERYPLISIEDGLAESDWPGWKTLTLNL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDD+FVTNP+ L +GI++ VAN+ILIK NQIG+V+ETL+TIE A+ A Y +++
Sbjct: 304 GERIQLVGDDIFVTNPDILAEGIDQGVANSILIKLNQIGTVTETLDTIEMAKQAAYTTVV 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED  IADL+VA N GQIKTGSL RSDR+AKYNQL+RIEE L   A + G
Sbjct: 364 SHRSGETEDSFIADLSVAVNAGQIKTGSLCRSDRLAKYNQLLRIEEELEDMAIYYG 419


>gi|293557155|ref|ZP_06675708.1| phosphopyruvate hydratase [Enterococcus faecium E1039]
 gi|291600680|gb|EFF30979.1| phosphopyruvate hydratase [Enterococcus faecium E1039]
          Length = 432

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 252/420 (60%), Positives = 326/420 (77%), Gaps = 6/420 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ ARE++DSRG+PTIEV+V  E G+ GR MVPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   ITDVYAREILDSRGNPTIEVEVYTESGAFGRGMVPSGASTGEYEAVELRDGDKARYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ I  A++G D RDQ+ IDK MI LDGTPNK +LGANAILGVS+AV++AAA
Sbjct: 64  VTKAVDNVNNIIAEAIIGYDVRDQMAIDKAMIALDGTPNKGKLGANAILGVSIAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY YLGG +  +LP P+MNI+NGG HADN++DFQEFMIMP+GA   +EA+RMGA
Sbjct: 124 DYLEVPLYHYLGGFNTKVLPTPMMNIINGGSHADNSIDFQEFMIMPIGAPTFKEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH L   LK++G +T+VGDEGGF+PNL + +   ++I  +IEKAGY  GKD+++A+D 
Sbjct: 184 EVFHALASILKARGLATSVGDEGGFAPNLGSNEEGFEVIIEAIEKAGYVPGKDVVLAMDA 243

Query: 242 AASAFFKKEK--YIL--KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           A+S F+ KEK  Y+L   GE  E   +EM  +   LV +YPI SIEDG+ E+DW G+K L
Sbjct: 244 ASSEFYDKEKGVYVLADSGEG-EKTTDEMIKFYEELVSKYPIISIEDGLDENDWDGFKKL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T+ +G   QLVGDDLFVTN ++L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY
Sbjct: 303 TDVLGDKVQLVGDDLFVTNTQKLSEGIEKGIANSILIKVNQIGTLTETFEAIEMAKEAGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +++SHRSGETED TI+D+AVATN GQIKTGSL+R+DRIAKYNQL+RIE+ LG+ A++ G
Sbjct: 363 TAVVSHRSGETEDSTISDIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGEVAEYKG 422


>gi|94310121|ref|YP_583331.1| enolase [Cupriavidus metallidurans CH34]
 gi|119369287|sp|Q1LP64|ENO2_RALME RecName: Full=Enolase 2; AltName: Full=2-phospho-D-glycerate
           hydro-lyase 2; AltName: Full=2-phosphoglycerate
           dehydratase 2
 gi|93353973|gb|ABF08062.1| Enolase (2-phosphoglycerate dehydratase 2) (2-phospho- D-glycerate
           hydro-lyase 2) [Cupriavidus metallidurans CH34]
          Length = 425

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 245/416 (58%), Positives = 316/416 (75%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           + +I   EV+DSRG+PT+EV+V L+DG+ GRA+VPSGASTG  EA ELRD + +RY G+G
Sbjct: 4   VAEIRGLEVLDSRGNPTVEVEVVLDDGAVGRAIVPSGASTGAREAVELRDADPRRYLGRG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL+A+  VN E+  ALLG DA DQ  ID IMIDLDGTP+K RLGANA+LGVSLAV+ AAA
Sbjct: 64  VLRAVQAVNTELCEALLGRDAGDQPEIDTIMIDLDGTPDKRRLGANALLGVSLAVAHAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            ++ LPL+ YLGG  A +LPVPL+N++NGG HADNALDFQEFMI+P GA    EA+R  A
Sbjct: 124 MSNGLPLFAYLGGERASLLPVPLINVINGGAHADNALDFQEFMIVPAGAPTFTEAVRASA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTL+  LK+ GY+TNVGDEGGF+P    A+ ALD++  +I KAGY  G+D+ +A+D 
Sbjct: 184 EVFHTLRAMLKAAGYTTNVGDEGGFAPEFHAAEEALDILVAAIAKAGYRPGEDIALAIDP 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS  +    Y+ +GE +E    E  +YL  L D+YPI SIEDGM+EDD  GW++LT ++
Sbjct: 244 AASELYVNGSYVYQGEGVERSREEQVAYLVRLADRYPIVSIEDGMAEDDAMGWQLLTRQL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDD+F T+P  L +G+ + +ANAIL+K NQIG++SE   T+  A    Y +++
Sbjct: 304 GKRCQLVGDDVFCTHPTLLRQGVEQGMANAILVKANQIGTLSEMRETVRVAHGYAYSAVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADLAVA  CGQIKTGS++R+DR AKYN+L+RIE  LG +A++AG
Sbjct: 364 SHRSGETEDVTIADLAVALRCGQIKTGSMSRADRTAKYNRLLRIERELGSRAEYAG 419


>gi|225075541|ref|ZP_03718740.1| hypothetical protein NEIFLAOT_00554 [Neisseria flavescens
           NRL30031/H210]
 gi|224953176|gb|EEG34385.1| hypothetical protein NEIFLAOT_00554 [Neisseria flavescens
           NRL30031/H210]
          Length = 428

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 257/418 (61%), Positives = 321/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVDHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDAGLPLYRYLGGAGPMALPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   +KG+ T VGDEGGF+PNL +   AL LI  + E AGY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDAKGFPTTVGDEGGFAPNLNSHKEALQLIVEATEAAGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  +Y L+ E       E A YL  LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGQYHLEAEGRSYTSAEFAEYLEGLVNEFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GDRVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAAYYPGKA 421


>gi|256783060|ref|ZP_05521491.1| enolase [Streptomyces lividans TK24]
 gi|289766942|ref|ZP_06526320.1| phosphopyruvate hydratase [Streptomyces lividans TK24]
 gi|289697141|gb|EFD64570.1| phosphopyruvate hydratase [Streptomyces lividans TK24]
          Length = 434

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/420 (59%), Positives = 317/420 (75%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I+ + AR +IDSRG+PT+EVDV LEDGS GRA VPSGASTG  EA ELRD++  R+ GKG
Sbjct: 12  IDTVTARRIIDSRGNPTVEVDVVLEDGSLGRAAVPSGASTGAREAVELRDEDPTRWHGKG 71

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V +A+A VN EI  ++ G DA DQ  +D  +I LDGT  KSRLGANA+LGVSLA +KAAA
Sbjct: 72  VDRAVAHVNGEIAASVRGRDAADQAGLDAALIALDGTAAKSRLGANALLGVSLAAAKAAA 131

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
                PLY+YLGG  AH+LP+P+MNI+NGG HADN LDFQEFMI+PVGA+   EA+RMG+
Sbjct: 132 TARRQPLYRYLGGADAHLLPLPMMNIVNGGAHADNPLDFQEFMIVPVGADTFAEAVRMGS 191

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTL+++L + G+ST VGDEGGF+P L+TA+ ALD +  +IE+ GY AG D+ + +D 
Sbjct: 192 EVFHTLRRDLLAAGHSTGVGDEGGFAPALRTAEEALDFVVAAIERTGYRAGPDIGLVMDP 251

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S FF+   Y   GE +   P E A +LA L+D YP+ SIED M+EDD  GW+ LT+++
Sbjct: 252 ASSEFFRDGGYDYAGEGVRRSPAEHADHLAGLIDAYPVVSIEDPMAEDDLDGWRELTDRV 311

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQL GDD+F TN   + +GI   V N++L+K NQIG+++E L T+  A  AG+  ++
Sbjct: 312 GDRCQLTGDDVFCTNEALVREGIRTGVGNSVLVKVNQIGTLTEALATVATAHEAGWTVVM 371

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVAT CGQIKTGSL+RSDR AKYN+LIRIEE LG  A+FAGRS L
Sbjct: 372 SHRSGETEDTTIADLAVATGCGQIKTGSLSRSDRTAKYNRLIRIEEELGASARFAGRSAL 431


>gi|109899571|ref|YP_662826.1| phosphopyruvate hydratase [Pseudoalteromonas atlantica T6c]
 gi|119369370|sp|Q15QR6|ENO_PSEA6 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|109701852|gb|ABG41772.1| enolase [Pseudoalteromonas atlantica T6c]
          Length = 430

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 257/421 (61%), Positives = 312/421 (74%), Gaps = 5/421 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I+ II RE++DSRG+PT+E DV LE G+ GRA  PSGASTG  EA ELRD +K RY GKG
Sbjct: 4   ISKIIGREIMDSRGNPTVEADVYLESGAMGRATAPSGASTGSREALELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+A +N++I  ALLG  A DQ  +D+IMIDLDGT NK + GANAIL VSLAV+KAAA
Sbjct: 64  VLKAVAAINEDIAPALLGNSAFDQKKVDQIMIDLDGTENKEKFGANAILAVSLAVAKAAA 123

Query: 122 QTSNLPLYKYL----GGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAI 177
               +PLY+++    G    + +PVP+MNI+NGG HADN +D QEFM+ PVGA N REA+
Sbjct: 124 LDKQIPLYQHISELNGTAGKYSMPVPMMNIINGGEHADNNVDIQEFMVQPVGAPNFREAL 183

Query: 178 RMGAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLI 237
           RMGAE+FH+LKK L +KG ST VGDEGGF+PNL + + AL +I  ++E AGY   KD+ +
Sbjct: 184 RMGAEIFHSLKKVLSAKGLSTAVGDEGGFAPNLASNEEALKVIIQAVENAGYEMNKDVTL 243

Query: 238 ALDCAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           ALDCA+S F+   KY LKGE           YLA+L  +YPI SIEDG+ E DW GW  L
Sbjct: 244 ALDCASSEFYVDGKYDLKGEGKVFDSETFGDYLADLAAKYPIISIEDGLDESDWDGWASL 303

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T KIG   QLVGDDLFVTN + L +GI+  VAN+ILIK NQIGS++ETL  I  AQ AG+
Sbjct: 304 TKKIGDKVQLVGDDLFVTNTKILKRGIDNGVANSILIKFNQIGSLTETLEAIRMAQDAGF 363

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            ++ISHRSGETED TIADLAV T  GQIKTGSL RSDR+AKYNQL+RIEE+LG  A + G
Sbjct: 364 TAVISHRSGETEDATIADLAVGTAAGQIKTGSLCRSDRVAKYNQLLRIEEALGDAATYGG 423

Query: 418 R 418
           R
Sbjct: 424 R 424


>gi|159902768|ref|YP_001550112.1| enolase [Prochlorococcus marinus str. MIT 9211]
 gi|238687137|sp|A9BDH2|ENO_PROM4 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|159887944|gb|ABX08158.1| Enolase [Prochlorococcus marinus str. MIT 9211]
          Length = 432

 Score =  515 bits (1326), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 249/417 (59%), Positives = 315/417 (75%), Gaps = 2/417 (0%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGK 60
           + I+ ++AREV+DSRG+PT+E +V LE G+ GRA+VPSGASTG +EA ELRD   RYFGK
Sbjct: 7   LVIDTVLAREVLDSRGNPTVEAEVLLEGGAIGRAIVPSGASTGAYEAHELRDAGDRYFGK 66

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GVLK +  + + I   + G  A DQ  ID +M +LDGT NKS+LGANAIL VS+A +++A
Sbjct: 67  GVLKVVENIEERIAPTICGLSASDQATIDGVMSELDGTENKSKLGANAILAVSIATARSA 126

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A    +PLY+YLGG  A +LPVPLMN++NGG HA N LDFQEFM++P GA   REA+RMG
Sbjct: 127 ANGYGMPLYRYLGGPMASLLPVPLMNVINGGAHAANNLDFQEFMLVPHGANTFREALRMG 186

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFHTLK+ L  KG ST VGDEGGF+PNL++  +A DL+  SIEKAG+  G+ + +ALD
Sbjct: 187 AEVFHTLKQLLSEKGLSTAVGDEGGFAPNLQSNQAAGDLLVKSIEKAGFIPGEQISLALD 246

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A++ FFK   Y   G N   +   M   L  LV+ YPI SIEDG++EDDW GW +LT +
Sbjct: 247 VASTEFFKDGAYFFGGRNYSTEG--MIEELVKLVNAYPIVSIEDGLAEDDWEGWGLLTKE 304

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN  RL +GIN++VAN+ILIK NQIGS++ETL  I+ A  +GY S+
Sbjct: 305 LGEKVQLVGDDLFVTNTSRLQRGINQKVANSILIKVNQIGSLTETLQAIDLANRSGYTSV 364

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ISHRSGETED TIADL+VAT  GQIKTGSL+RS+R+AKYNQL+RIE+ LG +A +AG
Sbjct: 365 ISHRSGETEDTTIADLSVATRAGQIKTGSLSRSERVAKYNQLLRIEDELGSEATYAG 421


>gi|221195875|ref|ZP_03568928.1| phosphopyruvate hydratase [Atopobium rimae ATCC 49626]
 gi|221184349|gb|EEE16743.1| phosphopyruvate hydratase [Atopobium rimae ATCC 49626]
          Length = 429

 Score =  515 bits (1326), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 256/418 (61%), Positives = 322/418 (77%), Gaps = 3/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ AREV+DSRG+PT+EV+V L+DGS GRA+VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IYDVHAREVLDSRGNPTVEVEVVLDDGSFGRAIVPSGASTGEFEAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EIR  ++G DA DQ  +D  MI LDGTPNK RLGANAILGVSLAV+ AAA
Sbjct: 64  VLKAVEHVNTEIRDLVIGMDAEDQRGLDLAMIKLDGTPNKGRLGANAILGVSLAVAHAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            ++ LPLY YLGG + H LPVP+MN+LNGG+HADN +DFQEFMIMPVGA +   A+R  A
Sbjct: 124 ASAELPLYAYLGGANGHTLPVPMMNVLNGGVHADNNVDFQEFMIMPVGASDFTTALRWCA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           +V+HTLK  LKS G ST VGDEGGF+P+L + +  L+ +A ++ +AG+  GKD   A+D 
Sbjct: 184 QVYHTLKNTLKSAGLSTGVGDEGGFAPDLNSNEEPLEYLAKAVTEAGFELGKDFRFAMDP 243

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           A+S F+ KE  KY LKGE   L   EM +Y   +V+++PI SIEDG++E+DW GWKILT 
Sbjct: 244 ASSEFYNKETGKYELKGEGRALTAEEMVAYYEEMVEKFPIISIEDGLAEEDWDGWKILTE 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++G   QLVGDDLFVTN +RL KGI     N+ILIK NQIG+++E+L  IE A+ AGY +
Sbjct: 304 RLGKKIQLVGDDLFVTNTQRLKKGIELHAGNSILIKVNQIGTLTESLEAIEMAKRAGYTA 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ++SHRSGETED TIADL VATN GQIKTG+ AR++R+AKYNQL+RIE+ LG+ A++ G
Sbjct: 364 VVSHRSGETEDTTIADLVVATNAGQIKTGAPARTERVAKYNQLLRIEDDLGEGAEYLG 421


>gi|241760002|ref|ZP_04758100.1| phosphopyruvate hydratase [Neisseria flavescens SK114]
 gi|241319456|gb|EER55886.1| phosphopyruvate hydratase [Neisseria flavescens SK114]
          Length = 428

 Score =  515 bits (1326), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 256/418 (61%), Positives = 321/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVDHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDAGLPLYRYLGGAGPMALPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   +KG+ T VGDEGGF+PNL +   AL LI  + E AGY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDAKGFPTTVGDEGGFAPNLNSHKEALQLIVEATEAAGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  +Y L+ E       E A YL  L++++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGQYHLEAEGRSYTSAEFAEYLEGLINEFPIVSIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GGRVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYTSVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A + G++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAAYYPGKA 421


>gi|160891980|ref|ZP_02072983.1| hypothetical protein BACUNI_04439 [Bacteroides uniformis ATCC 8492]
 gi|270296367|ref|ZP_06202567.1| phosphopyruvate hydratase [Bacteroides sp. D20]
 gi|317480435|ref|ZP_07939531.1| phosphopyruvate hydratase [Bacteroides sp. 4_1_36]
 gi|156858458|gb|EDO51889.1| hypothetical protein BACUNI_04439 [Bacteroides uniformis ATCC 8492]
 gi|270273771|gb|EFA19633.1| phosphopyruvate hydratase [Bacteroides sp. D20]
 gi|316903382|gb|EFV25240.1| phosphopyruvate hydratase [Bacteroides sp. 4_1_36]
          Length = 426

 Score =  515 bits (1326), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 262/425 (61%), Positives = 321/425 (75%), Gaps = 5/425 (1%)

Query: 1   MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFG 59
           M I  I+ARE++DSRG+PT+EVDV LE G  GRA VPSGASTG HEA ELRD +K RY G
Sbjct: 1   MKIEKIVAREILDSRGNPTVEVDVILECGVMGRAAVPSGASTGEHEALELRDGDKQRYGG 60

Query: 60  KGVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKA 119
           KG LKA+  VN  I  AL+G  + +Q  ID  M++LDGTP KS+LGANAILGVSLAV+KA
Sbjct: 61  KGTLKAVENVNKIIAPALIGWSSLEQRTIDHKMLELDGTPTKSKLGANAILGVSLAVAKA 120

Query: 120 AAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRM 179
           AA   ++PLY+Y+GG + +++PVP+MNI+NGG H+D  + FQEFMI PVGA + RE +RM
Sbjct: 121 AANYLDIPLYRYIGGVNTYVMPVPMMNIINGGSHSDAPIAFQEFMIRPVGASSFREGLRM 180

Query: 180 GAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIAL 239
           GAEVFH LKK L  +G ST VGDEGGF+P L   + ALD I ++I+ AGY  GKD+ I +
Sbjct: 181 GAEVFHALKKVLHDRGLSTAVGDEGGFAPALAGTEDALDSIMSAIKAAGYEPGKDVKIGM 240

Query: 240 DCAASAFFKKEKY---ILKGENLELQ-PNEMASYLANLVDQYPIYSIEDGMSEDDWHGWK 295
           DCA+S FFK   Y   I +GEN + +  +E  +YL +L++ YPI SIEDGMSE+DW GWK
Sbjct: 241 DCASSEFFKNGIYDYSIFEGENGKKRTADEQIAYLEDLINNYPIDSIEDGMSENDWEGWK 300

Query: 296 ILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMA 355
            LT +IG+ CQLVGDDLFVTN E L KGI    AN+ILIK NQIGS+SETL+ IE A   
Sbjct: 301 KLTERIGNRCQLVGDDLFVTNVEFLEKGIAMGCANSILIKVNQIGSLSETLDAIEMAHRH 360

Query: 356 GYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           GY ++ SHRSGETED TIAD+AVATN GQIKTGSL+RSDR+AKYNQL+RIEE LG  A +
Sbjct: 361 GYTTVTSHRSGETEDATIADIAVATNSGQIKTGSLSRSDRMAKYNQLLRIEEELGNLAVY 420

Query: 416 AGRSI 420
             + I
Sbjct: 421 GYKRI 425


>gi|262039453|ref|ZP_06012757.1| phosphopyruvate hydratase [Leptotrichia goodfellowii F0264]
 gi|261746520|gb|EEY34055.1| phosphopyruvate hydratase [Leptotrichia goodfellowii F0264]
          Length = 434

 Score =  514 bits (1325), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 256/424 (60%), Positives = 328/424 (77%), Gaps = 7/424 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+EV+V LE G+ GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IEDIYAREILDSRGNPTVEVEVFLEGGAMGRASVPSGASTGEHEAVELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN  +   L+G DA DQ+ IDK MI+LDGTPNK +LGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVENVNTVLAENLIGMDALDQVAIDKAMIELDGTPNKGKLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY+YLGG +A  LPVP+MNILNGG HAD+A+D QEFM+ PVGA+  +EA+RMGA
Sbjct: 124 NQLGIPLYRYLGGVNAKELPVPMMNILNGGSHADSAVDVQEFMVQPVGAKTYKEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSP-NLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           E+FH L K LK+ G STNVG+EGG++P N+   + ALD+I+ ++E AGY  G+++  A+D
Sbjct: 184 EIFHHLGKLLKANGDSTNVGNEGGYAPSNINGTEGALDIISKAVEAAGYKLGEEITFAMD 243

Query: 241 CAASAFFKKEK----YILKGENLELQPN-EMASYLANLVDQYPIYSIEDGMSEDDWHGWK 295
            A+S F  KE     Y  K E   ++ + EM  + A L  +YPI SIEDG++EDDW G+K
Sbjct: 244 AASSEFATKEGDKYVYTFKREGGVVRTSEEMVEWYAGLCAKYPIISIEDGLAEDDWAGFK 303

Query: 296 ILTNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMA 355
           +LT K+G   QLVGDDLFVTN ERL +GI E +AN+ILIK NQIG+++ETL+ IE A+ A
Sbjct: 304 LLTEKLGKKVQLVGDDLFVTNTERLSRGIKEGIANSILIKVNQIGTLTETLDAIEMAKKA 363

Query: 356 GYPSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           GY +++SHRSGETED TIAD+AVATN GQIKTGS +R+DR+AKYNQL+RIE+ L ++A +
Sbjct: 364 GYTAVVSHRSGETEDDTIADIAVATNAGQIKTGSASRTDRMAKYNQLLRIEDDLAEEAVY 423

Query: 416 AGRS 419
            G++
Sbjct: 424 EGKA 427


>gi|297190272|ref|ZP_06907670.1| enolase 2 [Streptomyces pristinaespiralis ATCC 25486]
 gi|197719141|gb|EDY63049.1| enolase 2 [Streptomyces pristinaespiralis ATCC 25486]
          Length = 432

 Score =  514 bits (1325), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 244/414 (58%), Positives = 311/414 (75%), Gaps = 1/414 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           +  + AR V+DSRG+PT+EVDV L DGS GRA VPSGASTG  EA ELRD + +R+ G+G
Sbjct: 11  VRRVTARAVLDSRGNPTVEVDVVLADGSLGRAAVPSGASTGAREAVELRDGDPRRWHGRG 70

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V +A+A V  EI  A+ G DA DQ  +D  ++ LDGTP K+RLGANA+LGVSLA +KAAA
Sbjct: 71  VDRAVAHVKGEIADAVTGRDADDQAGLDAALVALDGTPTKARLGANALLGVSLATAKAAA 130

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +   PLY+YLGG  A +LPVP+MNI+NGG HADN LDFQEFMI PVGAE+  EA+RMG+
Sbjct: 131 VSHRQPLYRYLGGADARVLPVPMMNIVNGGAHADNPLDFQEFMIAPVGAESFAEAVRMGS 190

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTL+++L + G+ST VGDEGGF+P L+TA+ ALD +  +IE+AGY AG D+ + +D 
Sbjct: 191 EVFHTLRRDLLAAGHSTGVGDEGGFAPALRTAEEALDFVMAAIERAGYRAGADIGLVMDP 250

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F++   Y   GE ++  P E   YLA L+D YPI S+ED M+EDD  GW+ LT ++
Sbjct: 251 ASSEFYRAGVYAYVGEGVQRTPAEQVDYLAKLIDAYPIVSVEDPMAEDDLDGWRELTARV 310

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQL GDD+F TN   + +GI   V NA+LIK NQIG+++E L T+  A+ AG+ +++
Sbjct: 311 GDRCQLTGDDVFCTNEALVREGIRTGVGNAVLIKVNQIGTLTEALGTVNAARRAGWVAVM 370

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           SHRSGETED TIADLAVAT CGQIKTGSL+RSDR AKYNQL+RIEE LG  A +
Sbjct: 371 SHRSGETEDTTIADLAVATGCGQIKTGSLSRSDRTAKYNQLMRIEEELGASAVY 424


>gi|121609604|ref|YP_997411.1| phosphopyruvate hydratase [Verminephrobacter eiseniae EF01-2]
 gi|166232242|sp|A1WL86|ENO_VEREI RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|121554244|gb|ABM58393.1| enolase [Verminephrobacter eiseniae EF01-2]
          Length = 428

 Score =  514 bits (1325), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 321/423 (75%), Gaps = 2/423 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I DI+ REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA E+RD + +RY GKG
Sbjct: 4   IVDIVGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIEMRDGDPRRYQGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN EI  A+LG DA +Q  +DK +IDLDGT NKSRLGANA+L VS+AV++AAA
Sbjct: 64  VLKAVEHVNTEISEAVLGLDASEQAFLDKTLIDLDGTENKSRLGANAMLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + S LPLY+YLGG  +  LPVP+MN++NGG HA+N+LD QEFMI+PVGA N REA+R GA
Sbjct: 124 EESGLPLYRYLGGMGSVQLPVPMMNVINGGAHANNSLDLQEFMIIPVGAPNFREALRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK +   G ST VGDEGGF+P+++  ++A+ LI  +I  AGY+AG+ + + LDC
Sbjct: 184 EVFHALKKIIHDLGMSTAVGDEGGFAPSVENHEAAIRLILQAITAAGYSAGEQIALGLDC 243

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AAS F++   Y+L GE  L+L   +    LA  VD+YPI SIEDGM E D  GWK L+ +
Sbjct: 244 AASEFYQDGLYVLHGEGGLKLSAPQWIDMLAAWVDKYPIISIEDGMHEGDQDGWKQLSER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +    QLVGDDLFVTN   L +GI++ +AN+ILIK NQIG+++ET   IE A+ AGY ++
Sbjct: 304 LRDKVQLVGDDLFVTNTRLLQQGIDQRIANSILIKINQIGTLTETFAAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           ISHRSGETED TIAD+AV TN GQIKTGSL+RSDRIAKYNQL+RIEE LG+ A++ GR+ 
Sbjct: 364 ISHRSGETEDCTIADIAVGTNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGEVAQYPGRAA 423

Query: 421 LIH 423
             H
Sbjct: 424 FRH 426


>gi|325294954|ref|YP_004281468.1| Enolase [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325065402|gb|ADY73409.1| Enolase [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 429

 Score =  514 bits (1325), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 255/421 (60%), Positives = 325/421 (77%), Gaps = 2/421 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I D+ ARE++DSRG+PT+EV+V LE G   RA VPSGASTG  EA ELRD++ KRY GKG
Sbjct: 4   IVDVRAREILDSRGNPTVEVEVTLESGVRARAAVPSGASTGEREALELRDKDPKRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ I   L+G ++ DQ+ IDK+MI+LDGT NKS LGANAILGVS+AV +A+A
Sbjct: 64  VSKAVKNVNEVIAPTLIGVESTDQVNIDKLMIELDGTENKSNLGANAILGVSMAVCRASA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +  ++PL+KY+GG +A  LPVP+MNILNGG+HADN +D QEFMIMPVG E   EA+RMG 
Sbjct: 124 EELDMPLFKYIGGANAKELPVPMMNILNGGVHADNNVDLQEFMIMPVGGETFSEALRMGV 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EV+HTLKK L+  G+STNVGDEGGF+PNL + + A+ +I  +IE+AGY  G+D+LIALD 
Sbjct: 184 EVYHTLKKVLQRMGHSTNVGDEGGFAPNLSSNEEAIQVILKAIEEAGYTPGEDVLIALDA 243

Query: 242 AASAFFKKEK-YILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           A+S F+K +  Y L+GE  +L   E+  +  NLV++YPI SIEDGM+E+D+ GWK+LT  
Sbjct: 244 ASSEFYKGDGVYELEGEGKKLGREELVDFYRNLVEKYPIISIEDGMAENDYEGWKLLTAA 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDD+FVTN E L  GI E  AN+ILIK NQIG+V+ETL+ IE A+ A Y ++
Sbjct: 304 LGDRVQLVGDDVFVTNTELLRIGIKEGFANSILIKLNQIGTVTETLDAIEMAKRANYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           ISHRSGETED  IADLAVA N GQIKTG+ ARS+R AKYNQL+RIEE+LG+ A + G  +
Sbjct: 364 ISHRSGETEDTFIADLAVAVNSGQIKTGAPARSERNAKYNQLLRIEEALGQAAIYKGVDV 423

Query: 421 L 421
            
Sbjct: 424 F 424


>gi|296126439|ref|YP_003633691.1| enolase [Brachyspira murdochii DSM 12563]
 gi|296018255|gb|ADG71492.1| enolase [Brachyspira murdochii DSM 12563]
          Length = 431

 Score =  514 bits (1325), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 322/421 (76%), Gaps = 4/421 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I++I+ARE++DSRG+PT+EVDV L+ G  GRA VPSGASTG HEA ELRD +K RY GK
Sbjct: 3   LIDNIVAREILDSRGNPTVEVDVYLDSGVMGRAAVPSGASTGEHEAVELRDGDKSRYMGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV KA+  VN+ I   L+  DA DQ+ ID+ MI+LDGT NK +LGANAILGVSLAV+KAA
Sbjct: 63  GVQKAVENVNEIICNELIDMDALDQVEIDRTMIELDGTENKGKLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A+   +PLY+Y+GG +A  LPVP+ NILNGG H+   +DFQE+M+MPVGA   +E +R  
Sbjct: 123 AEELGMPLYRYIGGTNAKTLPVPMANILNGGAHSSAPIDFQEYMVMPVGAPTFKEGLRYV 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFH LK  L  +G ST VGDEGGF+P LK  +  L +I  +IEKAGY  G+D++IA+D
Sbjct: 183 AEVFHNLKNILHDRGLSTTVGDEGGFAPTLKDNEEPLQVIMQAIEKAGYKPGEDVMIAMD 242

Query: 241 CAASAFFKKE--KYIL-KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
            A+S F+ K+  KY+  K +N EL P EM  + A+L  +YPI SIEDG++EDDW GWKIL
Sbjct: 243 PASSEFYNKDKKKYVFHKSDNRELTPAEMVDFYADLCSKYPIISIEDGVAEDDWEGWKIL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T K+G   QLVGDDLFVTN +RL  G+++ VAN+ILIK NQIG+++ETL++IE A+   Y
Sbjct: 303 TEKLGKKVQLVGDDLFVTNVKRLQMGLDKGVANSILIKVNQIGTLTETLDSIELAKTHNY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +++SHRSGETED TIAD+ VATN GQIKTGS +RSDRIAKYNQL+RIEE LG +A + G
Sbjct: 363 TAVVSHRSGETEDSTIADIVVATNAGQIKTGSASRSDRIAKYNQLLRIEEELGSRAIYLG 422

Query: 418 R 418
           +
Sbjct: 423 K 423


>gi|328949543|ref|YP_004366878.1| Enolase [Marinithermus hydrothermalis DSM 14884]
 gi|328449867|gb|AEB10768.1| Enolase [Marinithermus hydrothermalis DSM 14884]
          Length = 422

 Score =  514 bits (1325), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 252/415 (60%), Positives = 316/415 (76%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I ++ AREV+DSRG+PT+E +V LE G+ GRAMVPSGASTG HEA ELRD   RY GKGV
Sbjct: 4   IVEVKAREVLDSRGNPTVEAEVVLEGGARGRAMVPSGASTGAHEAIELRDGGPRYLGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
           +KA+A VN+ I   ++G DA DQ  +D  M++LDGTPNK+ LGANAIL VSLA ++AAA 
Sbjct: 64  VKAVANVNERIAPEIVGLDALDQEGVDCAMLELDGTPNKANLGANAILAVSLATARAAAD 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
              LPLY+YLGG    +LPVPLMN++NGG HADN +DFQEFM+ P GA   REA+R G E
Sbjct: 124 AVGLPLYRYLGGAQGTVLPVPLMNVINGGKHADNRVDFQEFMLAPAGAPTFREALRYGVE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           VFH LK  LK+KGY+TNVGDEGGF+P+LK+ + A++++  +IEKAG+  GK++ +ALD A
Sbjct: 184 VFHHLKSVLKAKGYNTNVGDEGGFAPDLKSNEEAVEVLLEAIEKAGFTPGKEVSLALDPA 243

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
            +  ++  +Y L+GE   L   EM  + A  V++YPI SIEDG++EDDW GWK LT ++G
Sbjct: 244 TTELYRDGRYHLEGEGRVLTSEEMVEFWAAWVERYPIVSIEDGLAEDDWAGWKHLTERVG 303

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              QLVGDDLFVTNP RL +GI + VANAILIK NQIG++SETL  +  AQ   Y ++IS
Sbjct: 304 DRVQLVGDDLFVTNPARLKEGIEQGVANAILIKVNQIGTLSETLEAVRLAQRHRYRAVIS 363

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           HRSGETED  IADLAVA N GQIKTGS +RSDR+AKYNQL+RIEE+LG  A+F G
Sbjct: 364 HRSGETEDAFIADLAVAVNAGQIKTGSASRSDRLAKYNQLLRIEEALGAAARFVG 418


>gi|320012699|gb|ADW07549.1| enolase [Streptomyces flavogriseus ATCC 33331]
          Length = 437

 Score =  514 bits (1324), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/420 (59%), Positives = 316/420 (75%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I  + AR +IDSRG+PT+EVDV L DGS GRA VPSGASTG  EA ELRD +  R+ G+G
Sbjct: 15  IETVTARRIIDSRGNPTVEVDVVLADGSLGRAAVPSGASTGAREAVELRDGDTGRWHGQG 74

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V +A+A VN EI  A+ G D  DQ  +D  +I LDGT  KSRLGANAILGVSLA +KAAA
Sbjct: 75  VDRAVAHVNGEIAAAVRGRDGADQTGLDAALIALDGTTTKSRLGANAILGVSLAAAKAAA 134

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPL+++LGG  A +LP+P+MNI+NGG HADN LDFQEFMI PVGA+   EA+RMG+
Sbjct: 135 AAHRLPLHRHLGGGEADLLPLPMMNIVNGGAHADNPLDFQEFMIAPVGADTFAEAVRMGS 194

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTL+++L++ G+ST VGDEGGF+P L+TA+ ALD +  +IE+ GY  G D+ +A+D 
Sbjct: 195 EVFHTLRRDLRAAGHSTGVGDEGGFAPALRTAEEALDFVMTAIERTGYRPGTDIGLAMDP 254

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F++   Y+  GE L   P+E A YLA+L+D YP+ SIED M+EDD  GW+ LT ++
Sbjct: 255 ASSEFYRDGVYVYAGEGLRRTPSEQADYLAHLLDAYPVVSIEDPMAEDDLDGWRELTARV 314

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQLVGDD+F T+   L +GI   V NA+L+K NQIG+++E L  +  A  AG+ +++
Sbjct: 315 GDRCQLVGDDVFCTDATLLREGIRTGVGNAVLVKVNQIGTLTEALGAVSLAHEAGWTAVM 374

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVAT CGQIKTGSL+RSDR AKYNQLIRIEE LG  A+FAGRS L
Sbjct: 375 SHRSGETEDTTIADLAVATGCGQIKTGSLSRSDRTAKYNQLIRIEEELGDSARFAGRSAL 434


>gi|319650511|ref|ZP_08004651.1| enolase [Bacillus sp. 2_A_57_CT2]
 gi|317397692|gb|EFV78390.1| enolase [Bacillus sp. 2_A_57_CT2]
          Length = 431

 Score =  514 bits (1324), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 256/420 (60%), Positives = 321/420 (76%), Gaps = 4/420 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
           FI  + AREV+DSRG+PT+EV+V  E G  GRA+VPSGASTG HEA ELRD +K RY GK
Sbjct: 3   FIEQVYAREVLDSRGNPTVEVEVLTESGFFGRAIVPSGASTGEHEAVELRDGDKSRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV KA+  VN+ I  A++G D  DQ+ ID+ MI LDGT NK +LGANAILGVS+A + AA
Sbjct: 63  GVQKAVDNVNNLIADAVIGLDVTDQVGIDRTMIALDGTENKGKLGANAILGVSMACAHAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A++  LPLY+YLGG +A  LP P+MNI+NGG HADN +DFQEFMIMPVGA   +EAIRMG
Sbjct: 123 AESVGLPLYRYLGGFNAKQLPTPMMNIINGGSHADNNVDFQEFMIMPVGAPTFKEAIRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFH+LKK L  KG +T VGDEGGF+PNL +   AL++I  +I  AGY AGKD+ +A+D
Sbjct: 183 AEVFHSLKKVLSGKGLNTAVGDEGGFAPNLGSNREALEVIIEAITNAGYEAGKDIYLAMD 242

Query: 241 CAASAFFKKE--KYILKGENLE-LQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
            A+S FF KE  KY L GE    L   +M ++   LV+++PI SIEDG+ E+DW G K+L
Sbjct: 243 VASSEFFNKETAKYDLAGEGRTGLTSEDMVNFYEELVNEFPIISIEDGLDENDWEGHKLL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T++IG   QLVGDDLFVTN ++L +GI + V N+ILIK NQIG+++ET   IE A+ AGY
Sbjct: 303 TDRIGGKVQLVGDDLFVTNTKKLAQGIEQGVGNSILIKVNQIGTLTETFEAIEMAKRAGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +++SHRSGETED TIAD+AVATN GQIKTGS++R+DRIAKYNQL+RIE+ LG  A + G
Sbjct: 363 TAVVSHRSGETEDATIADIAVATNAGQIKTGSMSRTDRIAKYNQLLRIEDELGDLAVYDG 422


>gi|124004586|ref|ZP_01689431.1| phosphopyruvate hydratase [Microscilla marina ATCC 23134]
 gi|123990158|gb|EAY29672.1| phosphopyruvate hydratase [Microscilla marina ATCC 23134]
          Length = 424

 Score =  514 bits (1324), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 317/421 (75%), Gaps = 3/421 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYF-GKG 61
           I+ I AR+++DSRG+PT+EVD+  E+G  GRA VPSGASTG HEA ELRD    YF GKG
Sbjct: 4   IDAIHARQILDSRGNPTVEVDIITEEGVLGRAAVPSGASTGKHEAVELRDGNANYFLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ I   L+G +  DQ LIDKIM++LD T NK +LGANAILGVSLA SKAAA
Sbjct: 64  VQKAVHNVNETIARELIGIEVFDQPLIDKIMLELDDTHNKGQLGANAILGVSLAASKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
              + PLYKY+GG +A  LPVP+MNILNGG HADNA+DFQEFMIMP  A     A++MG 
Sbjct: 124 NLLDQPLYKYIGGVNATTLPVPMMNILNGGSHADNAIDFQEFMIMPTNAPTFSRALQMGT 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK LK KG++TNVGDEGGF+PN+++ + A+ ++  +IEKAGY  G+D+ IA+D 
Sbjct: 184 EVFHHLKKVLKDKGFATNVGDEGGFAPNIQSNEDAIKIVLEAIEKAGYRPGEDMWIAMDA 243

Query: 242 AASAFFKKEK--YILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           A+S F+ +E   Y L   + +L  ++M +Y  + V +YPI SIEDGM EDDW GW++LT 
Sbjct: 244 ASSEFYDEETGLYHLSSTSDKLTSDQMVAYWKDWVQKYPIRSIEDGMHEDDWKGWELLTQ 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
            IG   QLVGDDLFVTN ERL +GI+ +VAN+ILIK NQIG+++ET+N I+ A    Y S
Sbjct: 304 TIGDKTQLVGDDLFVTNVERLQQGIDTKVANSILIKVNQIGTLTETINAIQLATRNSYTS 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ++SHRSGETED TIADLAVA N GQIKTGS +RSDR+AKYNQL+RIEE LG  A + G +
Sbjct: 364 VMSHRSGETEDTTIADLAVAMNTGQIKTGSASRSDRMAKYNQLLRIEEQLGDTAYYPGNN 423

Query: 420 I 420
            
Sbjct: 424 F 424


>gi|319937744|ref|ZP_08012147.1| enolase [Coprobacillus sp. 29_1]
 gi|319807179|gb|EFW03793.1| enolase [Coprobacillus sp. 29_1]
          Length = 430

 Score =  514 bits (1324), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 252/417 (60%), Positives = 313/417 (75%), Gaps = 2/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRD-QEKRYFGKG 61
           I+ I AREV+DSRG+PT+EV+V  E G+ GRA+VPSGASTG+HEA ELRD  + RY G G
Sbjct: 4   ISRIYAREVLDSRGNPTVEVEVSSEYGAFGRAIVPSGASTGVHEAVELRDGDQNRYLGLG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ I   ++G D   Q  ID+ MI LDGT NK +LGANAILGVSLAV++ AA
Sbjct: 64  VSKAVDNVNEIIAKEIVGRDVTAQREIDEAMIALDGTANKGKLGANAILGVSLAVARCAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            + N+PLYKY+GG +AH+LP P+MNI+NGG HADN +DFQEFMIMPV A + +E IRMGA
Sbjct: 124 DSLNVPLYKYIGGANAHVLPTPMMNIINGGAHADNNVDFQEFMIMPVSAGSFKETIRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK LK+KG +T VGDEGGF+PNL + + A+  I  +IEKAGY  G D+ +A+D 
Sbjct: 184 EIFHALKKVLKAKGLNTAVGDEGGFAPNLASNEEAIQTILEAIEKAGYQPGTDVKLAMDV 243

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           A+S F+K   Y L GE N      E+  +   L ++YPI SIEDG+ +DDW GW  LT K
Sbjct: 244 ASSEFYKDGMYTLPGENNKSFTSKELVDFYVELCEKYPIISIEDGLDQDDWEGWDYLTEK 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDD FVTN +RL +GI   VAN+ILIK NQIG+++ETL  IE AQ A Y ++
Sbjct: 304 LGGKVQLVGDDFFVTNTKRLQQGIERGVANSILIKVNQIGTLTETLEAIEMAQKANYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           ISHRSGETED TIAD+AVATN GQIKTGS +R+DRIAKYNQL+RIE+ L  Q +FAG
Sbjct: 364 ISHRSGETEDTTIADIAVATNAGQIKTGSASRTDRIAKYNQLLRIEDELSAQGQFAG 420


>gi|329568718|gb|EGG50518.1| phosphopyruvate hydratase [Enterococcus faecalis TX1467]
          Length = 432

 Score =  514 bits (1324), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 254/420 (60%), Positives = 323/420 (76%), Gaps = 6/420 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI AREV+DSRG+PTIEV+V  E G+ GR MVPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   ITDIYAREVLDSRGNPTIEVEVYTESGAFGRGMVPSGASTGEYEAVELRDGDKARYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ I  A++G D RDQ+ IDK MIDLDGTPNK +LGANAILGVS+AV++AAA
Sbjct: 64  VTKAVDNVNNIIAEAIIGYDVRDQMAIDKAMIDLDGTPNKGKLGANAILGVSIAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY YLGG +  +LP P+MNI+NGG HADN++DFQEFMIMPVGA   +EA+RMGA
Sbjct: 124 DYLEVPLYHYLGGFNTKVLPTPMMNIINGGSHADNSIDFQEFMIMPVGAPTFKEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH L   LK +G +T+VGDEGGF+PNL + +   ++I  +IEKAGY  GKD+++A+D 
Sbjct: 184 EVFHALASILKGRGLATSVGDEGGFAPNLGSNEEGFEVIIEAIEKAGYVPGKDVVLAMDA 243

Query: 242 AASAFFKKEK--YIL--KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           A+S F+ KEK  Y+L   GE  E    EM ++   LV +YPI SIEDG+ E++W G+K L
Sbjct: 244 ASSEFYDKEKGVYVLADSGEG-EKTTEEMIAFYEELVSKYPIISIEDGLDENNWDGFKKL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T  +G   QLVGDDLFVTN  +L +GI + +AN+ILIK +QIG+++ET   IE A+ AGY
Sbjct: 303 TEVLGDKVQLVGDDLFVTNTTKLAEGIEKGIANSILIKVSQIGTLTETFEAIEMAKEAGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +++SHRSGETED TI+D+AVATN GQIKTGSL+R+DRIAKYNQL+RIE+ LG  A++ G
Sbjct: 363 TAVVSHRSGETEDSTISDIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGDVAEYKG 422


>gi|225010545|ref|ZP_03701016.1| Phosphopyruvate hydratase [Flavobacteria bacterium MS024-3C]
 gi|225005374|gb|EEG43325.1| Phosphopyruvate hydratase [Flavobacteria bacterium MS024-3C]
          Length = 430

 Score =  514 bits (1324), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 255/418 (61%), Positives = 318/418 (76%), Gaps = 4/418 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKG 61
            I  + AR+++DSRG+PT+EVDV  E+G  GRA VPSGASTG HEA ELRD    Y GKG
Sbjct: 3   MIISVHARQILDSRGNPTVEVDVETENGVVGRAAVPSGASTGEHEAVELRDGGSAYMGKG 62

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKAI  VN  +  ALLG    +Q LID+IMIDLDGTPNKS+LGANAILGVSLAV+KAAA
Sbjct: 63  VLKAIENVNTHLSDALLGVSVFEQNLIDQIMIDLDGTPNKSKLGANAILGVSLAVAKAAA 122

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           +   +PL++Y+GG SA+ LPVP+MNI+NGG H+D  + FQEFM+MPV AE+   A++MG 
Sbjct: 123 EELGMPLFRYVGGVSANTLPVPMMNIINGGSHSDAPIAFQEFMVMPVKAESFSHAMQMGT 182

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK L  +G ST VGDEGGF+P L   + ALD IA ++  AGY  G +++IALDC
Sbjct: 183 EIFHHLKKVLHDRGLSTAVGDEGGFAPTLDGTEDALDTIAKAVSNAGYTLGDNVMIALDC 242

Query: 242 AASAFFKKEKY---ILKGENLELQPN-EMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           AA+ F+   KY     +G N  ++ + E A YLA+L  +YPI SIEDGM E+DW GWK L
Sbjct: 243 AAAEFYVNGKYDYSKFEGPNGAVRSSEEQAQYLADLAAKYPIISIEDGMDENDWAGWKSL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T K+G + QLVGDDLFVTN ERL +GI+E +AN+ILIK NQIG+++ET+  +  A+ AGY
Sbjct: 303 TEKVGDSVQLVGDDLFVTNVERLSRGISEGIANSILIKVNQIGTLTETIAAVNMAKNAGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
            S++SHRSGETED+TIADLAVA N GQIKTGS +RSDR+AKYNQL+RIEE LG+ A F
Sbjct: 363 TSVMSHRSGETEDNTIADLAVALNTGQIKTGSASRSDRMAKYNQLLRIEEMLGETAYF 420


>gi|213963560|ref|ZP_03391813.1| phosphopyruvate hydratase [Capnocytophaga sputigena Capno]
 gi|213953840|gb|EEB65169.1| phosphopyruvate hydratase [Capnocytophaga sputigena Capno]
          Length = 430

 Score =  514 bits (1324), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 257/412 (62%), Positives = 318/412 (77%), Gaps = 4/412 (0%)

Query: 8   AREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGVLKAIA 67
           AR+++DSRG+PT+EVDV  E+G  GRA VPSGASTG +EA ELRD  K Y GKGVLKA+A
Sbjct: 9   ARQILDSRGNPTVEVDVETENGFLGRAAVPSGASTGEYEAVELRDGGKDYMGKGVLKAVA 68

Query: 68  FVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTSNLP 127
            VND I   ++G D  +Q LID+ MI LDGTPNKS+LGANAILGVSLAV++AAA+   LP
Sbjct: 69  NVNDIIAEEIVGMDVFEQNLIDQTMIALDGTPNKSKLGANAILGVSLAVARAAAEELGLP 128

Query: 128 LYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVFHTL 187
           LY+Y+GG SAH LPVP+MNI+N G H+D  + FQEFMIMPV A++   AI+MGAEVFH L
Sbjct: 129 LYRYVGGVSAHTLPVPMMNIINAGAHSDAPIAFQEFMIMPVNAKDFSHAIQMGAEVFHNL 188

Query: 188 KKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAASAFF 247
           KK L  KG  T VGDEGGF+PN K  + ALD I  ++ KAGY  G+D+ IALDCA+S F+
Sbjct: 189 KKVLHDKGLGTAVGDEGGFAPNFKDIEDALDSIKEAVNKAGYKWGEDIKIALDCASSEFY 248

Query: 248 KKEKY---ILKGENLELQPN-EMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGS 303
           K  KY   I +G   +++ + E A YLA LV +YPI SIEDGM ++DW GWK+LT+KIG+
Sbjct: 249 KDGKYDYTIFEGAKGKVRTSAEQADYLAELVAKYPIISIEDGMDQNDWDGWKLLTDKIGN 308

Query: 304 NCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISH 363
             QLVGDDLFVTN   L +GI + +AN+ILIK NQIG++SET+  ++ A  AGY +++SH
Sbjct: 309 RVQLVGDDLFVTNVSILERGIAKGIANSILIKVNQIGTLSETIAAVDMANRAGYTAVMSH 368

Query: 364 RSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           RSGETED+TIADLAVA N GQIKTGS +RSDR+AKYNQL+RIEESLG  A +
Sbjct: 369 RSGETEDNTIADLAVALNTGQIKTGSASRSDRMAKYNQLLRIEESLGSVAYY 420


>gi|332686378|ref|YP_004456152.1| enolase [Melissococcus plutonius ATCC 35311]
 gi|332370387|dbj|BAK21343.1| enolase [Melissococcus plutonius ATCC 35311]
          Length = 432

 Score =  514 bits (1324), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 254/420 (60%), Positives = 323/420 (76%), Gaps = 6/420 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI AREV+DSRG+PT+EV+V  E G+ GR +VPSGASTG +EA ELRD +K RY GKG
Sbjct: 4   ITDIYAREVLDSRGNPTVEVEVYTESGAFGRGIVPSGASTGEYEAVELRDGDKSRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA+  VN+ +  A++G D RDQ+ IDK MI LDGTPNK++LGANAILGVS+AV++AAA
Sbjct: 64  VTKAVDNVNNILADAIIGYDVRDQMAIDKAMIKLDGTPNKAKLGANAILGVSIAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               +PLY YLGG +  +LP P+MNI+NGG HADN++DFQEFMIMPVGA   +EA+R GA
Sbjct: 124 DYLEVPLYHYLGGFNTKVLPTPMMNIINGGSHADNSIDFQEFMIMPVGAPTFKEALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH L   LK +G +T+VGDEGGF+PNL + +   ++I  +IEKAGY  GKD+L+A+D 
Sbjct: 184 EIFHALASILKGRGLATSVGDEGGFAPNLASNEEGFEVIIEAIEKAGYVPGKDVLLAMDA 243

Query: 242 AASAFFKKEK--YIL--KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           A+S F+ KEK  Y+L   GE  E   +EM  +   LV +YPI SIEDG+ E+DW G+K L
Sbjct: 244 ASSEFYDKEKGVYVLADSGEG-EKTTDEMIKFYEELVSKYPIISIEDGLDENDWDGFKKL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T+ +G   QL+GDDLFVTN E+L KGI   +AN+ILIK NQIG+++ET   IE A+ AGY
Sbjct: 303 TDALGDKVQLIGDDLFVTNTEKLSKGIERGIANSILIKVNQIGTLTETFEAIEMAKEAGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +I+SHRSGETED TIAD+AVATN GQIKTGSL+R+DRIAKYNQL+RIE+ LG+ A + G
Sbjct: 363 TAIVSHRSGETEDSTIADIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGEVAGYKG 422


>gi|222056181|ref|YP_002538543.1| phosphopyruvate hydratase [Geobacter sp. FRC-32]
 gi|254783252|sp|B9M3M1|ENO_GEOSF RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|221565470|gb|ACM21442.1| Phosphopyruvate hydratase [Geobacter sp. FRC-32]
          Length = 430

 Score =  514 bits (1324), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 256/424 (60%), Positives = 327/424 (77%), Gaps = 8/424 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ ARE++DSRG+PT+EV+V LE G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   ITDVYAREILDSRGNPTLEVEVFLESGAMGRAAVPSGASTGEREALELRDGDKGRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+A VND I   ++G +A DQ+ ID+ M++LDGT  KS+LGANAILGVSLAV+KAAA
Sbjct: 64  VLKAVANVNDIIAEEVIGMEATDQVGIDRKMLELDGTEFKSKLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               L LY+Y+GG +A  LP+P+MNI+NGG HADN +D QEFMIMP GA+N  EA+RMGA
Sbjct: 124 DEVGLSLYQYIGGANAKELPLPMMNIINGGAHADNNVDIQEFMIMPAGAKNFAEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LK  LK KGY+T VGDEGGF+PNLK+ + AL++I  +I+KAG+  G+D+L+ALD 
Sbjct: 184 EIFHALKSVLKGKGYNTAVGDEGGFAPNLKSNEEALEVIIEAIQKAGFKPGEDVLLALDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYL----ANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           A+S  F    Y L  EN E QP + A  L     NLV++YPI SIEDGM+E+DW GWK +
Sbjct: 244 ASSELFSDGVYTL--EN-EAQPKKTADQLIDFYENLVNKYPIISIEDGMAENDWEGWKKM 300

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T ++G   Q+VGDDLFVTNP+ L +GI++ +AN+ILIK NQIG+++ETL+ IE A+ AGY
Sbjct: 301 TERLGKRIQIVGDDLFVTNPKILKEGIDKGIANSILIKLNQIGTLTETLDAIEMAKRAGY 360

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            ++ISHRSGETED T+ADL+VA N GQIKTGSL R+DR+ KYNQL+RIE+ L   A F G
Sbjct: 361 TTVISHRSGETEDTTLADLSVAVNAGQIKTGSLCRTDRVCKYNQLLRIEDELDAVALFRG 420

Query: 418 RSIL 421
           + + 
Sbjct: 421 KEVF 424


>gi|253575493|ref|ZP_04852830.1| phosphopyruvate hydratase [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251845140|gb|EES73151.1| phosphopyruvate hydratase [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 430

 Score =  514 bits (1324), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 254/416 (61%), Positives = 323/416 (77%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I+D+ AREV+DSRG+PT+EV+V LE G+ GRA+VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   ISDVYAREVLDSRGNPTVEVEVYLESGAMGRAIVPSGASTGAHEAVELRDDDKTRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+  VN+ I   ++G DA DQ+ IDK+MI+LDGTPNK +LGANAIL VS+AV++AAA
Sbjct: 64  VLNAVKNVNEIIAPEVIGMDALDQVGIDKLMIELDGTPNKGKLGANAILAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
              +LPLY YLGG +A  LPVP+MNI+NGG HADN +D QEFMI+PVGA + REA+R GA
Sbjct: 124 DALDLPLYAYLGGFNAKQLPVPMMNIVNGGAHADNNVDVQEFMILPVGAPSFREALRTGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LK  LK+KG +T VGDEGGF+PN  + + AL  I  +I KAGY  GKD+ + +D 
Sbjct: 184 EIFHNLKSVLKAKGLNTAVGDEGGFAPNFSSNEDALSSIMEAITKAGYTPGKDVFLGMDV 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A++ F+K  KY L+GE       E    LA+ V++YPI +IEDG +EDDW GWK+LT K+
Sbjct: 244 ASTEFYKDGKYHLEGEGKSFTSAEFVDLLASWVEKYPIITIEDGCAEDDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  QLVGDDLFVTN ERL+KGI E + N+ILIK NQIG+++ET + IE A+ AGY +++
Sbjct: 304 GSKIQLVGDDLFVTNTERLYKGIKEGIGNSILIKVNQIGTLTETFDAIEMAKRAGYTAVV 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGE+ED TIAD+AVATN GQIKTG+ +R+DRIAKYNQL+RIE+ L   A++ G
Sbjct: 364 SHRSGESEDSTIADIAVATNAGQIKTGAPSRTDRIAKYNQLLRIEDQLADLAQYNG 419


>gi|53719880|ref|YP_108866.1| phosphopyruvate hydratase [Burkholderia pseudomallei K96243]
 gi|53723784|ref|YP_103309.1| phosphopyruvate hydratase [Burkholderia mallei ATCC 23344]
 gi|67642981|ref|ZP_00441731.1| phosphopyruvate hydratase [Burkholderia mallei GB8 horse 4]
 gi|76811447|ref|YP_334097.1| phosphopyruvate hydratase [Burkholderia pseudomallei 1710b]
 gi|121599921|ref|YP_993505.1| phosphopyruvate hydratase [Burkholderia mallei SAVP1]
 gi|124383576|ref|YP_001029066.1| phosphopyruvate hydratase [Burkholderia mallei NCTC 10229]
 gi|126440215|ref|YP_001059603.1| phosphopyruvate hydratase [Burkholderia pseudomallei 668]
 gi|126450209|ref|YP_001081013.1| phosphopyruvate hydratase [Burkholderia mallei NCTC 10247]
 gi|126453285|ref|YP_001066884.1| phosphopyruvate hydratase [Burkholderia pseudomallei 1106a]
 gi|134277025|ref|ZP_01763740.1| phosphopyruvate hydratase [Burkholderia pseudomallei 305]
 gi|167001759|ref|ZP_02267551.1| phosphopyruvate hydratase [Burkholderia mallei PRL-20]
 gi|167720325|ref|ZP_02403561.1| phosphopyruvate hydratase [Burkholderia pseudomallei DM98]
 gi|167739319|ref|ZP_02412093.1| phosphopyruvate hydratase [Burkholderia pseudomallei 14]
 gi|167816535|ref|ZP_02448215.1| phosphopyruvate hydratase [Burkholderia pseudomallei 91]
 gi|167846447|ref|ZP_02471955.1| phosphopyruvate hydratase [Burkholderia pseudomallei B7210]
 gi|167903409|ref|ZP_02490614.1| phosphopyruvate hydratase [Burkholderia pseudomallei NCTC 13177]
 gi|167911662|ref|ZP_02498753.1| phosphopyruvate hydratase [Burkholderia pseudomallei 112]
 gi|167919661|ref|ZP_02506752.1| phosphopyruvate hydratase [Burkholderia pseudomallei BCC215]
 gi|217421007|ref|ZP_03452512.1| phosphopyruvate hydratase [Burkholderia pseudomallei 576]
 gi|226198975|ref|ZP_03794538.1| phosphopyruvate hydratase [Burkholderia pseudomallei Pakistan 9]
 gi|237812996|ref|YP_002897447.1| phosphopyruvate hydratase [Burkholderia pseudomallei MSHR346]
 gi|242316642|ref|ZP_04815658.1| phosphopyruvate hydratase [Burkholderia pseudomallei 1106b]
 gi|254178027|ref|ZP_04884682.1| enolase [Burkholderia mallei ATCC 10399]
 gi|254184386|ref|ZP_04890976.1| phosphopyruvate hydratase [Burkholderia pseudomallei 1655]
 gi|254191419|ref|ZP_04897923.1| phosphopyruvate hydratase [Burkholderia pseudomallei Pasteur 52237]
 gi|254195695|ref|ZP_04902121.1| phosphopyruvate hydratase [Burkholderia pseudomallei S13]
 gi|254200264|ref|ZP_04906630.1| phosphopyruvate hydratase [Burkholderia mallei FMH]
 gi|254209342|ref|ZP_04915688.1| phosphopyruvate hydratase [Burkholderia mallei JHU]
 gi|254259202|ref|ZP_04950256.1| phosphopyruvate hydratase [Burkholderia pseudomallei 1710a]
 gi|254297051|ref|ZP_04964504.1| phosphopyruvate hydratase [Burkholderia pseudomallei 406e]
 gi|254357988|ref|ZP_04974261.1| phosphopyruvate hydratase [Burkholderia mallei 2002721280]
 gi|59797504|sp|Q62J10|ENO_BURMA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|59797510|sp|Q63SQ0|ENO_BURPS RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|119369302|sp|Q3JQQ6|ENO_BURP1 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|166232175|sp|A3ML77|ENO_BURM7 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|166232176|sp|A2SAU7|ENO_BURM9 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|166232177|sp|A1V5K2|ENO_BURMS RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|166232178|sp|A3NX13|ENO_BURP0 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|166232179|sp|A3NB82|ENO_BURP6 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|52210294|emb|CAH36273.1| enolase [Burkholderia pseudomallei K96243]
 gi|52427207|gb|AAU47800.1| enolase [Burkholderia mallei ATCC 23344]
 gi|76580900|gb|ABA50375.1| phosphopyruvate hydratase [Burkholderia pseudomallei 1710b]
 gi|121228731|gb|ABM51249.1| enolase [Burkholderia mallei SAVP1]
 gi|124291596|gb|ABN00865.1| phosphopyruvate hydratase [Burkholderia mallei NCTC 10229]
 gi|126219708|gb|ABN83214.1| phosphopyruvate hydratase [Burkholderia pseudomallei 668]
 gi|126226927|gb|ABN90467.1| phosphopyruvate hydratase [Burkholderia pseudomallei 1106a]
 gi|126243079|gb|ABO06172.1| phosphopyruvate hydratase [Burkholderia mallei NCTC 10247]
 gi|134250675|gb|EBA50754.1| phosphopyruvate hydratase [Burkholderia pseudomallei 305]
 gi|147749860|gb|EDK56934.1| phosphopyruvate hydratase [Burkholderia mallei FMH]
 gi|147750115|gb|EDK57186.1| phosphopyruvate hydratase [Burkholderia mallei JHU]
 gi|148027115|gb|EDK85136.1| phosphopyruvate hydratase [Burkholderia mallei 2002721280]
 gi|157807059|gb|EDO84229.1| phosphopyruvate hydratase [Burkholderia pseudomallei 406e]
 gi|157939091|gb|EDO94761.1| phosphopyruvate hydratase [Burkholderia pseudomallei Pasteur 52237]
 gi|160699066|gb|EDP89036.1| enolase [Burkholderia mallei ATCC 10399]
 gi|169652440|gb|EDS85133.1| phosphopyruvate hydratase [Burkholderia pseudomallei S13]
 gi|184214917|gb|EDU11960.1| phosphopyruvate hydratase [Burkholderia pseudomallei 1655]
 gi|217396419|gb|EEC36436.1| phosphopyruvate hydratase [Burkholderia pseudomallei 576]
 gi|225929075|gb|EEH25099.1| phosphopyruvate hydratase [Burkholderia pseudomallei Pakistan 9]
 gi|237504451|gb|ACQ96769.1| phosphopyruvate hydratase [Burkholderia pseudomallei MSHR346]
 gi|238524213|gb|EEP87647.1| phosphopyruvate hydratase [Burkholderia mallei GB8 horse 4]
 gi|242139881|gb|EES26283.1| phosphopyruvate hydratase [Burkholderia pseudomallei 1106b]
 gi|243062453|gb|EES44639.1| phosphopyruvate hydratase [Burkholderia mallei PRL-20]
 gi|254217891|gb|EET07275.1| phosphopyruvate hydratase [Burkholderia pseudomallei 1710a]
          Length = 427

 Score =  514 bits (1324), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 259/418 (61%), Positives = 315/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILGDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E   YLA L D++PI SIEDGM E DW GWK+LT ++
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFTDYLATLADKFPIVSIEDGMHEGDWDGWKLLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ A Y ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRARYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|225620799|ref|YP_002722057.1| phosphopyruvate hydratase [Brachyspira hyodysenteriae WA1]
 gi|225215619|gb|ACN84353.1| Phosphopyruvate hydratase [Brachyspira hyodysenteriae WA1]
          Length = 431

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 320/421 (76%), Gaps = 4/421 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
            I++I+ARE++DSRG+PT+EVDV L+ G  GRA VPSGASTG HEA ELRD +K RY GK
Sbjct: 3   LIDNIVAREILDSRGNPTVEVDVWLDSGVMGRAAVPSGASTGEHEAVELRDGDKSRYLGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV KA+  VN+ I   L+  DA DQ+ ID+ MI+LDGT NK +LGANAILGVSLAV+KAA
Sbjct: 63  GVQKAVENVNEIICNELIDMDALDQVEIDRTMIELDGTENKGKLGANAILGVSLAVAKAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A+   +PLY+Y+GG +A  LPVP+ NILNGG H+   +DFQE+M+MPVGA   +E IR  
Sbjct: 123 AEELGMPLYRYIGGTNAKTLPVPMANILNGGAHSSAPIDFQEYMVMPVGAPTFKEGIRYV 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           AEVFH LK  L  +G ST VGDEGGF+P LK  +  L +I  +IEKAGY  G D++IA+D
Sbjct: 183 AEVFHNLKAILHDRGLSTTVGDEGGFAPTLKDNEEPLQVIMQAIEKAGYKPGDDIMIAMD 242

Query: 241 CAASAFFKKE--KYIL-KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
            A+S F+ K+  KY+  K +N EL P EM  + A+L  +YPI SIEDG++EDDW GW +L
Sbjct: 243 PASSEFYNKDKKKYVFHKSDNRELTPAEMVDFYADLCSKYPIISIEDGVAEDDWEGWALL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T K+G   QLVGDDLFVTN +RL  G+++ VAN+ILIK NQIGS++ETL++IE A+   Y
Sbjct: 303 TQKLGKKVQLVGDDLFVTNVKRLQMGLDKNVANSILIKVNQIGSLTETLDSIELAKTHNY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +++SHRSGETED TIAD+ VATN GQIKTGS +RSDRIAKYNQL+RIEE LG +A + G
Sbjct: 363 TAVVSHRSGETEDATIADIVVATNAGQIKTGSASRSDRIAKYNQLLRIEEELGNRAVYLG 422

Query: 418 R 418
           +
Sbjct: 423 K 423


>gi|301630589|ref|XP_002944399.1| PREDICTED: enolase-like [Xenopus (Silurana) tropicalis]
          Length = 599

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 257/419 (61%), Positives = 325/419 (77%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 175 IVDIVGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKGRYLGKG 234

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A+LG DA +Q  +DK +IDLDGT NKSRLGANA+L VS+AV++AAA
Sbjct: 235 VLKAVEHINTEISEAVLGLDASEQAFLDKTLIDLDGTENKSRLGANAMLAVSMAVARAAA 294

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG +   LPVP+MN++NGG HA+N LD QEFMI+PVGA + REA+R GA
Sbjct: 295 EEAGLPLYRYFGGMNGCQLPVPMMNVINGGAHANNTLDLQEFMIIPVGAPSFREALRWGA 354

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+F  LKK +  KG ST VGDEGGF+P++K  ++A+ LI  +I+KAGY+AG+ +++ LDC
Sbjct: 355 EIFQALKKIIHDKGMSTAVGDEGGFAPSVKNHEAAILLILEAIDKAGYSAGEQIVLGLDC 414

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AAS F K  KY+L+GE  ++L   +    LA  VD+YPI SIEDGM+E DW GWK+LT +
Sbjct: 415 AASEFHKDGKYVLEGEGGIQLTARQWTDMLATWVDKYPILSIEDGMAEGDWDGWKLLTER 474

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTN + L +GI++ +ANAILIK NQIG+++ET   IE A+ AGY ++
Sbjct: 475 LGQKVQLVGDDLFVTNTKILKEGIDKHIANAILIKINQIGTLTETFAAIEMAKRAGYTAV 534

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ISHRSGETED TIAD+AV  N GQIKTGSL+RSDRIAKYNQL+RIEE LG  A++ GR+
Sbjct: 535 ISHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRIAKYNQLLRIEEDLGDVAEYPGRA 593


>gi|325291295|ref|YP_004267476.1| enolase [Syntrophobotulus glycolicus DSM 8271]
 gi|324966696|gb|ADY57475.1| enolase [Syntrophobotulus glycolicus DSM 8271]
          Length = 424

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 243/421 (57%), Positives = 325/421 (77%), Gaps = 1/421 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGK 60
           FI+ + ARE++DSRG+PT+EVDV L+DG+ GRA VPSGASTG  EA ELRD +K RY GK
Sbjct: 3   FIDQVFAREILDSRGNPTVEVDVVLDDGTLGRAAVPSGASTGAFEAVELRDGDKSRYNGK 62

Query: 61  GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA 120
           GV++A+  V + I   + G +A DQ  ID+++ ++DGT NK +LGANAILG+SLA ++AA
Sbjct: 63  GVIQAVNHVKNIIAPKIEGLNAFDQPGIDRVLCEIDGTENKGKLGANAILGISLATARAA 122

Query: 121 AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG 180
           A++  LP Y+Y+GG +A  LPVP+MNILNGG HADN +D QEFM+MPVGA N  EA+RMG
Sbjct: 123 AESLGLPFYQYIGGVNAKELPVPMMNILNGGQHADNNVDIQEFMVMPVGAGNFSEALRMG 182

Query: 181 AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD 240
           +E++H+LK  LK KG +T +GDEGGF+PNL +   AL +I ++IEKAGY  G+ +++A+D
Sbjct: 183 SEIYHSLKSVLKGKGLATGIGDEGGFAPNLGSNAEALMVIVDAIEKAGYKPGEQVVLAID 242

Query: 241 CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
            A +  +K   Y+++GE L     +M  YLA L +Q+PI+SIEDG++EDDW GW  LT +
Sbjct: 243 AATTEMYKNGVYVMEGEGLTKTSEQMIDYLAGLAEQFPIFSIEDGLAEDDWEGWAKLTQR 302

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +G   QLVGDDLFVTNP RL +GI ++ AN+ILIK NQIG+++ETL+ IE A+ AGY ++
Sbjct: 303 LGGKVQLVGDDLFVTNPSRLARGILDQSANSILIKLNQIGTLTETLDAIEMAKRAGYTTV 362

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI 420
           ISHRSGETED T+A LAVA N GQIKTG+ AR+DR+AKYN+L+RIEE LG+ A + GR I
Sbjct: 363 ISHRSGETEDVTLAHLAVAVNAGQIKTGAPARTDRLAKYNELLRIEEELGQTAIYKGRKI 422

Query: 421 L 421
           +
Sbjct: 423 I 423


>gi|325479387|gb|EGC82483.1| phosphopyruvate hydratase [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 431

 Score =  513 bits (1322), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 255/420 (60%), Positives = 320/420 (76%), Gaps = 4/420 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYF-GK 60
            I D+ AR+++DSRG+PT+EV+V  EDG  GRA VPSGASTG  EA ELRD +K YF GK
Sbjct: 3   LITDVYARQILDSRGNPTVEVEVYTEDGGFGRASVPSGASTGEWEAVELRDGDKNYFLGK 62

Query: 61  GVLKAIAFVNDEIRTAL-LGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKA 119
            VLKA+  VN+ I   L    D  DQ+ +D  MI+LDGT NK +LGANAILGVSLAV+KA
Sbjct: 63  SVLKAVENVNEIIAEELEFTYDVTDQIGVDNAMIELDGTENKGKLGANAILGVSLAVAKA 122

Query: 120 AAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRM 179
           AA    +PLY Y+GG +A +LP P+MNILNGG HADN++D QEFMI P+GAE+   A+++
Sbjct: 123 AANELGVPLYNYIGGTNAKLLPTPMMNILNGGEHADNSVDIQEFMIFPLGAESFAHALQI 182

Query: 180 GAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIAL 239
           GAEVFH+LK  L SKGY+T VGDEGGF+PNLK+ + AL++I  +I+ AGY  GKD+ IA+
Sbjct: 183 GAEVFHSLKSVLSSKGYNTAVGDEGGFAPNLKSNEEALEIICEAIKAAGYEPGKDVYIAM 242

Query: 240 DCAASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           DCA+S F+ KE  KY L+GE      +EM  +L  LV +YPI SIEDG+ E+DW GW  L
Sbjct: 243 DCASSEFYNKEDGKYHLEGEGTVKTEDEMIDWLEELVGKYPIISIEDGLDENDWEGWAKL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T ++G   QLVGDDLFVTN ++L KGI+E VAN+ILIK NQIGS++ETLN IE A+ AGY
Sbjct: 303 TERLGKKVQLVGDDLFVTNTKKLEKGISEGVANSILIKVNQIGSLTETLNAIEMAKEAGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +++SHRSGETED TI+DL VA N GQIKTG+ +R+DR+AKYNQL+RIE+ LG  AKF G
Sbjct: 363 TAVVSHRSGETEDVTISDLVVAVNAGQIKTGAPSRTDRVAKYNQLLRIEDELGDDAKFKG 422


>gi|21225899|ref|NP_631678.1| phosphopyruvate hydratase [Streptomyces coelicolor A3(2)]
 gi|23814099|sp|Q9F3P9|ENO2_STRCO RecName: Full=Enolase 2; AltName: Full=2-phospho-D-glycerate
           hydro-lyase 2; AltName: Full=2-phosphoglycerate
           dehydratase 2
 gi|11323224|emb|CAC16971.1| enolase [Streptomyces coelicolor A3(2)]
          Length = 434

 Score =  513 bits (1322), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 250/420 (59%), Positives = 316/420 (75%), Gaps = 1/420 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKG 61
           I  + AR +IDSRG+PT+EVDV LEDGS GRA VPSGASTG  EA ELRD++  R+ GKG
Sbjct: 12  IETVTARRIIDSRGNPTVEVDVVLEDGSLGRAAVPSGASTGAREAVELRDEDPTRWHGKG 71

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V +A+A VN EI  ++ G DA DQ  +D  +I LDGT  KSRLGANA+LGVSLA +KAAA
Sbjct: 72  VDRAVAHVNGEIAASVRGRDAADQAGLDAALIALDGTAAKSRLGANALLGVSLAAAKAAA 131

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
                PLY+YLGG  AH+LP+P+MNI+NGG HADN LDFQEFMI+PVGA+   EA+RMG+
Sbjct: 132 AARRQPLYRYLGGADAHLLPLPMMNIVNGGAHADNPLDFQEFMIVPVGADTFAEAVRMGS 191

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFHTL+++L + G+ST VGDEGGF+P L+TA+ ALD +  +IE+ GY AG D+ + +D 
Sbjct: 192 EVFHTLRRDLLAAGHSTGVGDEGGFAPALRTAEEALDFVVAAIERTGYRAGPDIGLVMDP 251

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S FF+   Y   GE +   P E A +LA L+D YP+ SIED M+EDD  GW+ LT+++
Sbjct: 252 ASSEFFRDGGYDYAGEGVRRSPAEHADHLAGLIDAYPVVSIEDPMAEDDLDGWRELTDRV 311

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G  CQL GDD+F T+   + +GI   V N++L+K NQIG+++E L T+  A  AG+  ++
Sbjct: 312 GDRCQLTGDDVFCTDEALVREGIRTGVGNSVLVKVNQIGTLTEALATVATAHEAGWTVVM 371

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSIL 421
           SHRSGETED TIADLAVAT CGQIKTGSL+RSDR AKYN+LIRIEE LG  A+FAGRS L
Sbjct: 372 SHRSGETEDTTIADLAVATGCGQIKTGSLSRSDRTAKYNRLIRIEEELGASARFAGRSAL 431


>gi|169824486|ref|YP_001692097.1| enolase [Finegoldia magna ATCC 29328]
 gi|303233697|ref|ZP_07320351.1| phosphopyruvate hydratase [Finegoldia magna BVS033A4]
 gi|238687745|sp|B0S1G7|ENO_FINM2 RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|167831291|dbj|BAG08207.1| enolase [Finegoldia magna ATCC 29328]
 gi|302495131|gb|EFL54883.1| phosphopyruvate hydratase [Finegoldia magna BVS033A4]
          Length = 428

 Score =  513 bits (1322), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 255/416 (61%), Positives = 318/416 (76%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQ-EKRYFGKG 61
           I D+ AREV+DSRG+PT+EV+V  E G+ G A+VPSGASTG+HEA ELRD  EKR+ GKG
Sbjct: 4   IIDVYAREVLDSRGNPTVEVEVYTEAGAMGSAIVPSGASTGVHEAVELRDNDEKRFLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V  A+  VN EI   L+G D  DQ+ ID  +I+LDGT NKSRLGANAILGVSLAV+KAAA
Sbjct: 64  VETAVDNVNLEIADELVGWDVFDQVGIDNYLIELDGTENKSRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +   L++Y+GG +   LPVP+MNILNGG HADN +D QEFMIMPVG EN +E++R+G 
Sbjct: 124 DENGQRLFEYIGGVNGKTLPVPMMNILNGGQHADNNVDIQEFMIMPVGGENFKESLRIGT 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LK  LKS+  +T VGDEGGF+PNL++ + AL  I  +I+KAGY  GKD++IA+D 
Sbjct: 184 EVFHNLKNVLKSRKLNTAVGDEGGFAPNLESNEEALQTIVEAIKKAGYEPGKDVMIAIDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F++  KY + G+N     +EM  Y  NLV++YPI SIEDG++EDDW GWK LT ++
Sbjct: 244 AASEFYEDGKYNMAGDNAVRTSDEMIEYYKNLVEKYPIISIEDGLAEDDWDGWKKLTQEL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           GS  QLVGDDLFVTN +RL KGI   V N+ILIK NQIG+++ETL+ IE A+  GY ++I
Sbjct: 304 GSKIQLVGDDLFVTNVKRLQKGIEMGVCNSILIKLNQIGTLTETLDAIELAKRHGYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIAD+AVATN GQIKTGS +R+DRI KYNQL+RIE+ L   A + G
Sbjct: 364 SHRSGETEDTTIADVAVATNAGQIKTGSTSRTDRICKYNQLLRIEDMLESTAVYDG 419


>gi|153005029|ref|YP_001379354.1| phosphopyruvate hydratase [Anaeromyxobacter sp. Fw109-5]
 gi|166232167|sp|A7HCC4|ENO_ANADF RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|152028602|gb|ABS26370.1| Phosphopyruvate hydratase [Anaeromyxobacter sp. Fw109-5]
          Length = 429

 Score =  513 bits (1322), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 320/419 (76%), Gaps = 3/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I ++ ARE++DSRG+PTIEV+V +  G  GRA VPSGASTG HEA ELRD +K RY GKG
Sbjct: 4   IINVTAREILDSRGNPTIEVEVAVGTGDVGRAAVPSGASTGEHEALELRDGDKGRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KAIA V DEI  A++G DA DQ ++D+ MI+LDGT  KS+LGANAILGVSLA +KAAA
Sbjct: 64  VRKAIANVMDEIAPAVVGLDAGDQAVLDQRMIELDGTATKSKLGANAILGVSLAAAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           Q   LPLY+Y+GG  A  LPVPLMNILNGG HAD+ +D QEFM++P+GA +  EA+R GA
Sbjct: 124 QAHGLPLYRYVGGAGARTLPVPLMNILNGGAHADSNVDIQEFMVVPLGAPSFAEALRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LK  LK KG  T VGDEGG++PNL + + AL LI  +IE+AG  AG D+ +ALDC
Sbjct: 184 EVFHALKAVLKKKGAGTGVGDEGGYAPNLASNEEALALIMKAIEQAGLKAGDDVGLALDC 243

Query: 242 AASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTN 299
           AAS FF+K   KY L+GE        +  + A+L  +YPI SIEDG +EDDW  WK+LT 
Sbjct: 244 AASEFFEKSSGKYDLEGEGKAFDGKGLVDFYASLAAKYPIVSIEDGCAEDDWATWKLLTE 303

Query: 300 KIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPS 359
           ++GS  QLVGDDLFVTN  RL +GI E VAN+IL+K NQIGS++ETL  +  A  AGY S
Sbjct: 304 RLGSKLQLVGDDLFVTNVTRLSRGIAEGVANSILVKVNQIGSLTETLEAVRMAHRAGYTS 363

Query: 360 IISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           ++SHRSGETED TIADL+VA +CGQIKTGS +R+DR+AKYNQL+RIEE LGK A++AGR
Sbjct: 364 VMSHRSGETEDTTIADLSVACDCGQIKTGSASRTDRVAKYNQLLRIEEELGKAARYAGR 422


>gi|308389406|gb|ADO31726.1| enolase [Neisseria meningitidis alpha710]
 gi|325136209|gb|EGC58817.1| phosphopyruvate hydratase [Neisseria meningitidis M0579]
 gi|325202001|gb|ADY97455.1| phosphopyruvate hydratase [Neisseria meningitidis M01-240149]
 gi|325208247|gb|ADZ03699.1| phosphopyruvate hydratase [Neisseria meningitidis NZ-05/33]
          Length = 428

 Score =  513 bits (1322), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 257/418 (61%), Positives = 320/418 (76%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI ARE++DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  VN++I  AL+G DA +Q  ID+IMI+LDGT NK  LGANA L VS+AV++AAA
Sbjct: 64  VLKAVDHVNNQIAQALIGIDASEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+YLGG     LPVP+MN++NGG HA+N+L+ QEFMIMPVGA++ REA+R GA
Sbjct: 124 EDAGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LKK   SKG+ T VGDEGGF+PNL +   AL L+  + E AGY AG+D+L ALDC
Sbjct: 184 EIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYKAGEDVLFALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  KY L+ E       E A YL  LV+++PI SIEDGM E+DW GWK+LT K+
Sbjct: 244 ASSEFYKDGKYHLEAEGRSYTNAEFAEYLEGLVNEFPIISIEDGMDENDWEGWKLLTEKL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI + VANA+L+K NQIG++SETL  ++ A+   Y S++
Sbjct: 304 GGKVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYASVM 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIADLAVATNC QIKTGSL+RSDR+AKYNQL+RIEE L + A +  ++
Sbjct: 364 SHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAADYPSKA 421


>gi|322420986|ref|YP_004200209.1| enolase [Geobacter sp. M18]
 gi|320127373|gb|ADW14933.1| enolase [Geobacter sp. M18]
          Length = 429

 Score =  513 bits (1322), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 257/424 (60%), Positives = 321/424 (75%), Gaps = 8/424 (1%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ ARE++DSRG+PT+EV+V L+ G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   ITDVYAREILDSRGNPTLEVEVFLDSGAMGRAAVPSGASTGEREALELRDGDKGRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V KA++ VND I   + G DA DQ+ IDK M+ LDGT  KSRLGANAILGVSLAV+KAAA
Sbjct: 64  VEKAVSNVNDIIADEITGMDATDQVGIDKKMLALDGTEFKSRLGANAILGVSLAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
               LPLY+Y+GG +A  LP+P+MNI+NGG HADN +D QEFMIMP GA+  +EA+RMGA
Sbjct: 124 DEVGLPLYQYIGGSNAKELPLPMMNIINGGAHADNNVDIQEFMIMPAGAKTFKEALRMGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LK  LK KGY+T VGDEGGF+PNLK+ + AL++I  +I KAGY  G+D+L+ALD 
Sbjct: 184 EIFHALKSVLKGKGYNTAVGDEGGFAPNLKSNEEALEVIMEAIVKAGYKPGEDVLLALDV 243

Query: 242 AASAFFKKEKYILKGENLELQP----NEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           A+S  F+   Y L+ E    QP     E+  +  NLV++YPI SIEDGM+E+DW GWK L
Sbjct: 244 ASSELFENGVYTLQNEP---QPKKSAKELIDFYENLVNKYPIVSIEDGMAENDWDGWKQL 300

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T ++G   Q+VGDDLFVTNP  L +GI + +AN+ILIK NQIG+++ETL+ IE A+ AGY
Sbjct: 301 TERLGKRIQIVGDDLFVTNPSILKEGIKKGIANSILIKLNQIGTLTETLDAIEMAKRAGY 360

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
             +ISHRSGETED T+ADLAVA N GQIKTGSL R+DR+AKYNQL+RIE+ L   A F G
Sbjct: 361 TCVISHRSGETEDTTLADLAVAVNAGQIKTGSLCRTDRVAKYNQLLRIEDELDDVAIFRG 420

Query: 418 RSIL 421
             + 
Sbjct: 421 HEVF 424


>gi|317130206|ref|YP_004096488.1| enolase [Bacillus cellulosilyticus DSM 2522]
 gi|315475154|gb|ADU31757.1| enolase [Bacillus cellulosilyticus DSM 2522]
          Length = 428

 Score =  513 bits (1322), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 247/418 (59%), Positives = 322/418 (77%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKG 61
            I+D+ AR+V+DSRG+PT+EV+V LEDG  GRA+VPSGASTG +EA ELRD    + GKG
Sbjct: 3   IISDVYARQVLDSRGNPTVEVEVYLEDGGFGRALVPSGASTGEYEAVELRDGGDAWMGKG 62

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           V +A+A VND I   L+G DA DQ+ ID++MIDLDGT NK +LGANAILGVS+AV+ AAA
Sbjct: 63  VTQAVANVNDVIAPELVGFDALDQVGIDELMIDLDGTENKGKLGANAILGVSMAVAHAAA 122

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
            +  +PLY YLGG +A  LP P+MNI+NGG HADN +D QEFM+MPVGAE  ++A++MGA
Sbjct: 123 DSLGVPLYVYLGGFNAKTLPTPMMNIINGGEHADNNVDIQEFMVMPVGAETFQQALQMGA 182

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           E+FH LK  LK KGY+T VGDEGGF+PNL + + AL  I  +IEKAGY  G+++L+A+D 
Sbjct: 183 EIFHNLKSVLKGKGYNTAVGDEGGFAPNLGSNEEALSTIIEAIEKAGYKPGEEVLLAMDV 242

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS  ++  KY LKGE +     EM  +  +L  +YPI SIEDG+ E+DW G+K+LT ++
Sbjct: 243 AASEIYEDGKYNLKGEGVVKTSAEMVDFYEDLCSKYPIVSIEDGLDENDWEGFKLLTERL 302

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN  +L +GI + + N+ILIK NQIG+++ET + IE A+ AGY ++I
Sbjct: 303 GGKVQLVGDDLFVTNTNKLSQGIEQGIGNSILIKVNQIGTLTETFDAIEMAKRAGYTAVI 362

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AVATN GQIKTG+ +R+DR+AKYNQL+RIE+ L    ++AG+S
Sbjct: 363 SHRSGETEDATIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDELQFIGRYAGKS 420


>gi|254491689|ref|ZP_05104868.1| phosphopyruvate hydratase [Methylophaga thiooxidans DMS010]
 gi|224463167|gb|EEF79437.1| phosphopyruvate hydratase [Methylophaga thiooxydans DMS010]
          Length = 426

 Score =  513 bits (1322), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 253/416 (60%), Positives = 321/416 (77%), Gaps = 1/416 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I D+ ARE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IIDVRAREILDSRGNPTVEADVVLESGAIGRAAVPSGASTGEREAVELRDGDKQRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VL A+A VN E+R A+LG +A DQ  +D  +I  DGT NKSRLGANA+L +S+A ++AAA
Sbjct: 64  VLNAVAAVNGELREAVLGMEATDQRALDNKLIATDGTENKSRLGANALLAISMATARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
             +  PLYK+L      ++PVP+MNI+NGG HADN++D QEFMIMPVGA NI EA+R GA
Sbjct: 124 ADAKKPLYKFLATDGDTVMPVPMMNIINGGSHADNSVDLQEFMIMPVGAANISEAVRYGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L S+G +T VGDEGGF+P+L + ++A+D+I  +I+ AGY  GKD+++ALD 
Sbjct: 184 EVFHELKKVLNSRGLNTAVGDEGGFAPDLPSNEAAIDVILEAIKNAGYEPGKDIMLALDA 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           A+S F+K  +Y+L  EN  L   E A  LA+ V+++PI SIEDGM E+DW GWK+LT+KI
Sbjct: 244 ASSEFYKDGQYVLASENRSLSSAEFADLLADWVERFPIISIEDGMDENDWDGWKLLTDKI 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTNP+ L +GI++ V N+ILIK NQIG++SETL+ I  A+  GY +++
Sbjct: 304 GDKVQLVGDDLFVTNPKILQQGIDKGVGNSILIKVNQIGTLSETLDAINLAKANGYTAVV 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           SHRSGETED TIADLAVATN GQIKTGSL+RSDR+AKYNQL+RIE  LG  A + G
Sbjct: 364 SHRSGETEDTTIADLAVATNAGQIKTGSLSRSDRVAKYNQLLRIEAELGNAASYPG 419


>gi|309388872|gb|ADO76752.1| enolase [Halanaerobium praevalens DSM 2228]
          Length = 429

 Score =  513 bits (1321), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 253/416 (60%), Positives = 326/416 (78%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I ++ ARE++DSRG+PT+EV+V LEDG+ GRA VPSGASTG +EA ELRD   RY GKGV
Sbjct: 6   IVEVFAREILDSRGNPTVEVEVVLEDGTFGRAAVPSGASTGQYEAVELRDGGDRYLGKGV 65

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
           L A+  VN+ I   +LG D R+Q+ ID +M +LDGT NK +LGANAILGVS+AV+KAAA 
Sbjct: 66  LDAVENVNEVIAPEILGFDVREQIDIDNLMRELDGTKNKGKLGANAILGVSMAVAKAAAN 125

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
            +   LY Y+GG +A  LPVP+MNILNGG HADN +D QEFMIMPVGA + REA++MGAE
Sbjct: 126 ATGSHLYNYIGGMNAKTLPVPMMNILNGGEHADNNVDLQEFMIMPVGAVSFREAMQMGAE 185

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           V+H LKK L++KG  T VGDEGGF+P+L + + AL +I  +IEKAGY AG+D  IALD A
Sbjct: 186 VYHNLKKVLQAKGLGTGVGDEGGFAPDLGSNEEALQVIVEAIEKAGYEAGEDFYIALDPA 245

Query: 243 ASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIG 302
           A+ F+K  KY+L GE +E    EM  + A+L+D+YPI SIEDG++EDDW G+  +T ++G
Sbjct: 246 ATEFYKDGKYVLAGEGVEKTSAEMIDFYADLIDKYPIISIEDGLAEDDWEGFAEMTKRLG 305

Query: 303 SNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIIS 362
              Q+VGDDL+VTN ERL +GI E+ +N+ILIK NQIGS++ETL+TI+ A  AG+ +++S
Sbjct: 306 DRLQIVGDDLYVTNVERLSRGIEEKSSNSILIKVNQIGSLTETLDTIKMATRAGFTAVVS 365

Query: 363 HRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGR 418
           HRSGETED TIADL VA N GQIKTG+ ARS+R+AKYNQL+RIEE+LG  A++AG+
Sbjct: 366 HRSGETEDVTIADLVVAMNTGQIKTGAPARSERVAKYNQLLRIEENLGDAAQYAGK 421


>gi|120437144|ref|YP_862830.1| enolase [Gramella forsetii KT0803]
 gi|134034115|sp|A0M568|ENO_GRAFK RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate
           hydro-lyase; AltName: Full=2-phosphoglycerate
           dehydratase
 gi|117579294|emb|CAL67763.1| enolase [Gramella forsetii KT0803]
          Length = 429

 Score =  513 bits (1321), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 258/417 (61%), Positives = 315/417 (75%), Gaps = 4/417 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGKGV 62
           I DI AR++ DSRG+PT+EVDV  E+G  GRA VPSGASTG HEA ELRD  K + GKGV
Sbjct: 4   ILDIHARQIFDSRGNPTVEVDVYTENGIMGRAAVPSGASTGEHEAVELRDGGKDFMGKGV 63

Query: 63  LKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQ 122
            KA+  VN EI   LLG    +Q LID+ MIDLDGTPNKS+LGANAILGVSLAV+KAAA 
Sbjct: 64  QKAVDNVNGEIADHLLGFSVFEQNLIDQTMIDLDGTPNKSKLGANAILGVSLAVAKAAAN 123

Query: 123 TSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAE 182
             N+PLY+Y+GG SA+ LPVP+MNI+NGG H+D  + FQEFMIMPV A++   A++MG E
Sbjct: 124 ELNMPLYRYVGGVSANTLPVPMMNIINGGSHSDAPIAFQEFMIMPVMADSFSHALKMGTE 183

Query: 183 VFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCA 242
           +FH LK  L  +G ST VGDEGGF+P L   + ALD I  +IEKAGY  GK+++IALDCA
Sbjct: 184 IFHNLKNVLHDRGLSTAVGDEGGFAPTLDGTEDALDTILKAIEKAGYKPGKEVMIALDCA 243

Query: 243 ASAFFKKEKY---ILKGENLELQPN-EMASYLANLVDQYPIYSIEDGMSEDDWHGWKILT 298
           A+ FF   KY     +G+  +++ + E A YLA L  +YPI SIEDGM E+DW GWK +T
Sbjct: 244 AAEFFVDGKYDYTKFEGDKGKVRTSEEQADYLAELASKYPIISIEDGMDENDWEGWKAVT 303

Query: 299 NKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYP 358
           +KIG   QLVGDDLFVTN ERL +GI E +AN+ILIK NQIG+++ET+  +  A  AGY 
Sbjct: 304 DKIGDKVQLVGDDLFVTNVERLGRGIKESIANSILIKVNQIGTLTETIAAVNMAHNAGYT 363

Query: 359 SIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKF 415
           S++SHRSGETED+TIADLAVA N GQIKTGS +RSDR+AKYNQL+RIEE LG  A +
Sbjct: 364 SVMSHRSGETEDNTIADLAVALNTGQIKTGSASRSDRMAKYNQLLRIEEELGDVAFY 420


>gi|167895025|ref|ZP_02482427.1| phosphopyruvate hydratase [Burkholderia pseudomallei 7894]
          Length = 427

 Score =  513 bits (1321), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 258/418 (61%), Positives = 315/418 (75%), Gaps = 1/418 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DII RE++DSRG+PT+E DV LE G+ GRA VPSGASTG  EA ELRD E  RY GKG
Sbjct: 4   IVDIIGREILDSRGNPTVECDVLLESGTMGRAAVPSGASTGSREAIELRDGEAGRYGGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A++G DA +Q  +DK +++LDGT NKSRLGANA+L VS+AV+KAAA
Sbjct: 64  VLKAVEHINTEISEAIMGLDASEQAFLDKTLLELDGTDNKSRLGANAMLAVSMAVAKAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG  A  LPVP+MNI+NGG HA+N+LD QEFMI+PV     REA+R GA
Sbjct: 124 EEAGLPLYRYFGGSGAMQLPVPMMNIVNGGAHANNSLDIQEFMIVPVSQPTFREALRCGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LKK L  +G ST VGDEGGF+PN  + D  L  I  +IEKAGY AG+D+L+ALDC
Sbjct: 184 EVFHALKKILGDRGMSTAVGDEGGFAPNFGSNDECLSTILQAIEKAGYRAGEDVLLALDC 243

Query: 242 AASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKI 301
           AAS F+   KY L GE L+L   E   YLA L D++PI SIEDGM E DW GW++LT ++
Sbjct: 244 AASEFYHDGKYQLAGEGLQLSSAEFTDYLATLADKFPIVSIEDGMHEGDWDGWRLLTERL 303

Query: 302 GSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSII 361
           G   QLVGDDLFVTN   L +GI + +AN+ILIK NQIG+++ET   IE A+ A Y ++I
Sbjct: 304 GKKVQLVGDDLFVTNTRILKEGIEKGIANSILIKINQIGTLTETFAAIEMAKRARYTAVI 363

Query: 362 SHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           SHRSGETED TIAD+AV  N GQIKTGSL+RSDRI+KYNQL+RIEE LG  A + G+S
Sbjct: 364 SHRSGETEDSTIADIAVGLNAGQIKTGSLSRSDRISKYNQLLRIEEDLGDIASYPGKS 421


>gi|257066261|ref|YP_003152517.1| enolase [Anaerococcus prevotii DSM 20548]
 gi|256798141|gb|ACV28796.1| enolase [Anaerococcus prevotii DSM 20548]
          Length = 431

 Score =  513 bits (1321), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 255/420 (60%), Positives = 318/420 (75%), Gaps = 4/420 (0%)

Query: 2   FINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYF-GK 60
            I D+ AR+++DSRG+PT+EV+V  EDG  GRA VPSGASTG  EA ELRD +K Y+ GK
Sbjct: 3   LITDVYARQILDSRGNPTVEVEVYTEDGGFGRASVPSGASTGEWEAVELRDGDKNYYLGK 62

Query: 61  GVLKAIAFVNDEIRTAL-LGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKA 119
            VLKA+  VN+ I   L    D  DQ+ ID  MI+LDGT NK +LGANAILGVSLAV+KA
Sbjct: 63  SVLKAVENVNEIIAVELEFTYDVTDQIGIDNAMIELDGTENKGKLGANAILGVSLAVAKA 122

Query: 120 AAQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRM 179
           AA    +PLY Y+GG +A +LP P+MNILNGG HADN++D QEFMI P+GAE+   A++M
Sbjct: 123 AANELGVPLYNYIGGTNAKLLPTPMMNILNGGEHADNSVDIQEFMIFPLGAESFAHALQM 182

Query: 180 GAEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIAL 239
           G EVFH+LK  L SKGY+T VGDEGGF+PNLK+ + AL++I  +I+ AGY  GKD+ IA+
Sbjct: 183 GTEVFHSLKSVLSSKGYNTAVGDEGGFAPNLKSNEEALEIICEAIKAAGYEPGKDVYIAM 242

Query: 240 DCAASAFFKKE--KYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKIL 297
           DCA+S F+ KE  KY L GE      +EM  +L  LV++YPI SIEDG+ E+DW GW  L
Sbjct: 243 DCASSEFYNKEDGKYHLDGEGTVKTEDEMIDWLEELVEKYPIISIEDGLDENDWEGWAKL 302

Query: 298 TNKIGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGY 357
           T ++G+  QLVGDDLFVTN ++L KGI E VAN+ILIK NQIGS++ETLN IE A+ AGY
Sbjct: 303 TERLGNKVQLVGDDLFVTNTKKLEKGIKEGVANSILIKVNQIGSLTETLNAIEMAKEAGY 362

Query: 358 PSIISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
            +++SHRSGETED TIADL VA N GQIKTG+ +R+DR+AKYNQL+RIE+ L   AKF G
Sbjct: 363 TAVVSHRSGETEDVTIADLVVAVNAGQIKTGAPSRTDRVAKYNQLLRIEDELADDAKFKG 422


>gi|312129388|ref|YP_003996728.1| enolase [Leadbetterella byssophila DSM 17132]
 gi|311905934|gb|ADQ16375.1| enolase [Leadbetterella byssophila DSM 17132]
          Length = 425

 Score =  513 bits (1320), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 259/414 (62%), Positives = 319/414 (77%), Gaps = 4/414 (0%)

Query: 8   AREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQE-KRYFGKGVLKAI 66
           AR+++DSRG+PT+EVDV  ++G  GRA VPSGASTGIHEA ELRD++  +Y GKGVLKA+
Sbjct: 9   ARQILDSRGNPTVEVDVVTDNGFLGRAAVPSGASTGIHEAVELRDEDNSKYLGKGVLKAV 68

Query: 67  AFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAAQTSNL 126
             VN EI   +LG D  +Q  IDK +IDLDGTPNK  LGANAILGVSLAV+KAAAQ + L
Sbjct: 69  QNVNQEIAPEILGEDVFEQNTIDKALIDLDGTPNKGNLGANAILGVSLAVAKAAAQEAGL 128

Query: 127 PLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGAEVFHT 186
           PLY+YLGG +A+ LPVP+MNILNGG HADN++DFQEFM+MP  A+   +++RMG E+FH 
Sbjct: 129 PLYRYLGGVNANTLPVPMMNILNGGSHADNSIDFQEFMVMPAKADTFSDSLRMGTEIFHN 188

Query: 187 LKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDCAASAF 246
           LKK LKSKGYSTNVGDEGGF+PN+ + + A+++I  SIEKAGY  G+D+ IA+D A+S F
Sbjct: 189 LKKVLKSKGYSTNVGDEGGFAPNIGSNEEAIEIILTSIEKAGYTPGQDVFIAMDAASSEF 248

Query: 247 F--KKEKYIL-KGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNKIGS 303
           +  K   Y   K    +L   EMA+Y A  V +YPI SIEDGM+EDDW GW  LT   G 
Sbjct: 249 YDAKTGLYTFKKSSGKQLTSEEMAAYWAEWVSKYPIRSIEDGMAEDDWAGWAELTRLTGD 308

Query: 304 NCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSIISH 363
             QLVGDDLFVTN +RL +GI++ +ANAIL+K NQIGS++ET++ +  A    Y S++SH
Sbjct: 309 KIQLVGDDLFVTNVKRLKEGIDKNIANAILVKVNQIGSLTETIDAVNLAHRNKYKSVMSH 368

Query: 364 RSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAG 417
           RSGETED TIADLAVA NCGQIKTGS +RSDR+AKYNQL+RIEE LG  A F G
Sbjct: 369 RSGETEDATIADLAVALNCGQIKTGSASRSDRMAKYNQLLRIEEELGDSAYFPG 422


>gi|264677264|ref|YP_003277170.1| enolase [Comamonas testosteroni CNB-2]
 gi|262207776|gb|ACY31874.1| enolase [Comamonas testosteroni CNB-2]
          Length = 428

 Score =  513 bits (1320), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 256/419 (61%), Positives = 318/419 (75%), Gaps = 2/419 (0%)

Query: 3   INDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEK-RYFGKG 61
           I DI+ REV+DSRG+PT+E DV LE G  GRA VPSGASTG  EA ELRD +K RY GKG
Sbjct: 4   IVDIVGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKSRYLGKG 63

Query: 62  VLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAAA 121
           VLKA+  +N EI  A+LG DA +Q  +DK +IDLDGT NKSRLGANA+L VS+AV++AAA
Sbjct: 64  VLKAVEHINTEISEAVLGLDASEQAFLDKTLIDLDGTDNKSRLGANAMLAVSMAVARAAA 123

Query: 122 QTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMGA 181
           + + LPLY+Y GG     LPVP+MN++NGG HA+N+LD QEFMI+PVGA   REA+R GA
Sbjct: 124 EEAGLPLYRYFGGMGGVQLPVPMMNVINGGAHANNSLDLQEFMIIPVGAPTFREAVRWGA 183

Query: 182 EVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALDC 241
           EVFH LK  +  KG ST VGDEGGF+P+++  ++A+ LI  +IEKAGY  G+ + + LDC
Sbjct: 184 EVFHALKAIIHHKGMSTAVGDEGGFAPSVENHEAAIQLIIEAIEKAGYKPGEQIALGLDC 243

Query: 242 AASAFFKKEKYILKGE-NLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK 300
           AAS F+K   Y+L GE N+ L   +    LA   D+YPI SIEDGM E DW GWKILT +
Sbjct: 244 AASEFYKDGMYVLAGEGNMTLTSTQWTDMLAGWCDKYPIISIEDGMHEGDWDGWKILTER 303

Query: 301 IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI 360
           +GS  QLVGDDLFVTN + L +GI + +AN+ILIK NQIG+++ET   IE A+ AGY ++
Sbjct: 304 LGSKVQLVGDDLFVTNTKILKEGIEKRIANSILIKINQIGTLTETFAAIEMAKRAGYTAV 363

Query: 361 ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRS 419
           ISHRSGETED TIAD+AV  N GQIKTGS++RSDRIAKYNQL+RIEE LG  A++ GR+
Sbjct: 364 ISHRSGETEDSTIADIAVGLNAGQIKTGSMSRSDRIAKYNQLLRIEEDLGDVAEYPGRA 422


>gi|302335158|ref|YP_003800365.1| enolase [Olsenella uli DSM 7084]
 gi|301318998|gb|ADK67485.1| enolase [Olsenella uli DSM 7084]
          Length = 429

 Score =  513 bits (132