RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780671|ref|YP_003065084.1| putative cell division protein [Candidatus Liberibacter asiaticus str. psy62] (105 letters) >6ldh_A M4 APO-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); 2.00A {} (A:) Length = 330 Score = 26.9 bits (58), Expect = 1.1 Identities = 6/69 (8%), Positives = 24/69 (34%), Gaps = 3/69 (4%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERF---LSE 57 + + + + V+ + ++ D+G+ ++ E ++ + Sbjct: 261 IMKNLCRVHPVSTMVKDFYGIKDNVFLSLPCVLNDHGISNIVKMKLKPNEEQQLQKSATT 320 Query: 58 LKENRSRLE 66 L + + L+ Sbjct: 321 LWDIQKDLK 329 >2iak_A Bullous pemphigoid antigen 1, isoform 5; triple helical bundle, spectrin repeat, cell adhesion; 3.00A {Mus musculus} (A:) Length = 224 Score = 25.3 bits (54), Expect = 2.8 Identities = 7/49 (14%), Positives = 21/49 (42%) Query: 38 LKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKA 86 L + L+++L E E + +++ + ++ + DL ++ Sbjct: 9 LLKSSLLDQNLTEEEVNMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVES 57 >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} (B:) Length = 308 Score = 23.9 bits (50), Expect = 7.5 Identities = 8/49 (16%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Query: 25 VYFTNHAIVGDYGLKANKSLEKSLIERERFLS---ELKENRSRLERKVK 70 + A++G G++ L + E+ +F +K+ L +++ Sbjct: 259 IVAEVPAVIGKSGIERIIELPLTEDEKRKFDEAVQAVKKLVETLPPQLR 307 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.324 0.139 0.401 Gapped Lambda K H 0.267 0.0418 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 782,647 Number of extensions: 30339 Number of successful extensions: 136 Number of sequences better than 10.0: 1 Number of HSP's gapped: 134 Number of HSP's successfully gapped: 18 Length of query: 105 Length of database: 4,956,049 Length adjustment: 62 Effective length of query: 43 Effective length of database: 2,860,139 Effective search space: 122985977 Effective search space used: 122985977 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.8 bits)