BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780671|ref|YP_003065084.1| putative cell division protein [Candidatus Liberibacter asiaticus str. psy62] (105 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780671|ref|YP_003065084.1| putative cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 105 Score = 211 bits (538), Expect = 2e-57, Method: Compositional matrix adjust. Identities = 105/105 (100%), Positives = 105/105 (100%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE Sbjct: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF Sbjct: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 >gi|254780450|ref|YP_003064863.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Score = 25.8 bits (55), Expect = 0.18, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Query: 39 KANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLN 91 K KSLE SL+ R + E E RL ++L S+GS E L+ YS N Sbjct: 66 KRTKSLE-SLLSRNQ---EASEALYRLINSLRLKSEGSEEFRLMQSLNNYSQN 114 >gi|254781225|ref|YP_003065638.1| P4 family phage/plasmid primase [Candidatus Liberibacter asiaticus str. psy62] Length = 789 Score = 22.7 bits (47), Expect = 1.5, Method: Compositional matrix adjust. Identities = 14/37 (37%), Positives = 19/37 (51%) Query: 39 KANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 KAN SL + + R +SE EN K+K M+ G Sbjct: 548 KANPSLIRLMGSRIVIISETNENDEINAAKIKQMTGG 584 >gi|254780772|ref|YP_003065185.1| surface antigen (D15) [Candidatus Liberibacter asiaticus str. psy62] Length = 781 Score = 21.9 bits (45), Expect = 2.7, Method: Composition-based stats. Identities = 24/100 (24%), Positives = 40/100 (40%), Gaps = 8/100 (8%) Query: 10 HFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLE---KSLIERERFLSELKENRSRLE 66 H + + I + V+ H + L +E K+ I RF+ + +RLE Sbjct: 154 HNIKQAYASIGYLNVMVKVQHHSISPTTLNITYVIEEGVKAKINSIRFVGNKNYSHARLE 213 Query: 67 RKVKLMSDG--SLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R + + + G S K + K R S + + I FY D Sbjct: 214 RVISIRTSGYFSFGKTDVYSKERMSFD---EEAIRAFYHD 250 >gi|254780524|ref|YP_003064937.1| flagellar hook-associated protein FlgK [Candidatus Liberibacter asiaticus str. psy62] Length = 480 Score = 20.8 bits (42), Expect = 6.7, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Query: 40 ANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEK 85 A+K +E + RFLSEL ++ K D D LD++ Sbjct: 152 ADKEIELEISNLRRFLSELTVVNDAIKFKTASKHDA---HDFLDQR 194 >gi|254780595|ref|YP_003065008.1| nucleoside-diphosphate-sugar epimerase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 289 Score = 20.4 bits (41), Expect = 7.9, Method: Compositional matrix adjust. Identities = 10/32 (31%), Positives = 15/32 (46%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGL 38 KKN F I + CV++ H + G + L Sbjct: 179 KKNQVFNRIRVEDVARCVIFLMTHHLGGIFNL 210 >gi|254780512|ref|YP_003064925.1| flagellar biosynthesis protein FlhA [Candidatus Liberibacter asiaticus str. psy62] Length = 692 Score = 20.0 bits (40), Expect = 9.9, Method: Composition-based stats. Identities = 8/35 (22%), Positives = 18/35 (51%) Query: 10 HFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSL 44 H F F ++ C+++ ++ D GL ++ +L Sbjct: 18 HDFAFSFCIVLIICILFLPIPTVLLDVGLASSIAL 52 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.139 0.401 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,803 Number of Sequences: 1233 Number of extensions: 2525 Number of successful extensions: 12 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 10 length of query: 105 length of database: 328,796 effective HSP length: 62 effective length of query: 43 effective length of database: 252,350 effective search space: 10851050 effective search space used: 10851050 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 32 (16.9 bits)