>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes. Thiamine pyrophosphate (TPP) family, pyrimidine (PYR) binding domain; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor. TPP binds in the cleft formed by a PYR domain and a PP domain. The PYR domain, binds the aminopyrimidine ring of TPP, the PP domain binds the diphosphate residue. A polar interaction between the conserved glutamate of the PYR domain and the N1' of the TPP aminopyrimidine ring is shared by most TPP-dependent enzymes, and participates in the activation of TPP. The PYR and PP domains have a common fold, but do not share strong sequence conservation. The PP domain is not included in this group. Most TPP-dependent enzymes have the PYR and PP domains on the same subunit although these domains can be alternatively arranged in the primary structure. In the case of 2-oxoisovalerate dehydrogenase (2OXO), sulfopyruvate deca

Probab=97.15 E-value=0.0041 Score=41.39 Aligned_cols=141 Identities=25% Similarity=0.282 Sum_probs=86.4 Q ss_pred HHHHHHCCCCCEEEEECCCCCCCCCCCCCCCHHHHC--CCCCEECCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH Q ss_conf 554431136506999324344588665323647540--811101166662789989999887188644566666789999 Q gi|254780673|r 149 AIAEEMRRDKDVFIMGEEVAEYQGAYKVTQGLLQEF--GCERVIDTPITEHGFAGIGIGASFAGLKPIVEFMTFNFAMQA 226 (467) Q Consensus 149 a~~e~m~~d~~~~~~gedv~~~~g~f~~t~gl~~~f--g~~R~~d~pi~E~~~~G~a~G~A~~G~~Piv~~~~~~f~~~a 226 (467) T Consensus 2 Ala~~L~~~GV~~vFg--i--pG~~---~~~l~dal~~~~~~~~v~~~hE~~A~~mAdgyar~~g~~v~~~t~GpG~~n~ 74 (154) T cd06586 2 AFAEVLTAWGVRHVFG--Y--PGDE---ISSLLDALREGDKRIIDTVIHELGAAGAAAGYARAGGPPVVIVTSGTGLLNA 74 (154) T ss_pred HHHHHHHHCCCCEEEE--C--CCCC---HHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHCCCEEEECCCCHHHHH T ss_conf 7899999879998998--6--8703---7999999986399579912858899999999999749948996379579989 Q ss_pred HHHHHHHHHHHHHHCCCCCCCCEEEEEE-CC-CCCCCCHHHHHHHHHHHHHHCCCEEEEEECCHHCCCHHHH----HHHC Q ss_conf 9999987886742117767888799830-24-4576444433216887632203138665221000105556----5413 Q gi|254780673|r 227 IDQIINSAAKTRYMSGGQITTSIVFRGP-NG-AAARVAAQHSQCYAAWYSHVPGLKVVIPYTASDAKGLLKA----AIRD 300 (467) Q Consensus 227 ~dqi~n~~ak~~~~~gg~~~~p~v~r~p-~G-~~~~~g~~Hs~~~~~~~~~iPgl~V~~P~~~~d~~~ll~~----ai~~ 300 (467) T Consensus 75 ~~gl~~-A~--------~~~~Pvl~i~g~~~~~~~~~~~~q~~d~~~~~~~~tk~~~~v-~~~~~~~~~l~~A~~~a~~~ 144 (154) T cd06586 75 INGLAD-AA--------AEHLPVVFLIGARGISAQAKQTFQSMFDLGMYRSIPEANISS-PSPAELPAGIDHAIRTAYAS 144 (154) T ss_pred HHHHHH-HH--------HCCCCEEEEECCCCHHHCCCCCCCCHHHHHHHHHHHHEEEEC-CCHHHHHHHHHHHHHHHHCC T ss_conf 999999-98--------756988999668887662789883113999999998648994-99999999999999998549 Q ss_pred CCCEEE Q ss_conf 783476 Q gi|254780673|r 301 PNPVIF 306 (467) Q Consensus 301 ~~Pvi~ 306 (467) T Consensus 145 pGPv~l 150 (154) T cd06586 145 QGPVVV 150 (154) T ss_pred CCCEEE T ss_conf 987898

HHsearch alignment for GI: 254780673 and conserved domain: cd06586