HHsearch alignment for GI: 254780675 and conserved domain: cd01078

>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase. Methylene Tetrahydromethanopterin Dehydrogenase (H4MPT DH) NADP binding domain. NADP-dependent H4MPT DH catalyzes the dehydrogenation of methylene- H4MPT and methylene-tetrahydrofolate (H4F) with NADP+ as cofactor. H4F and H4MPT are both cofactors that carry the one-carbon units between the formyl and methyl oxidation level. H4F and H4MPT are structurally analogous to each other with respect to the pterin moiety, but each has distinct side chain. H4MPT is present only in anaerobic methanogenic archaea and aerobic methylotrophic proteobacteria. H4MPT seems to have evolved independently from H4F and functions as a distinct carrier in C1 metabolism. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclo
Probab=91.00  E-value=0.46  Score=26.49  Aligned_cols=30  Identities=33%  Similarity=0.562  Sum_probs=24.6

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             899989-857999999999879939999788
Q gi|254780675|r    7 IILIGS-GPAGYVAAIRAAQLGFKVAIVEYA   36 (481)
Q Consensus         7 vvIIG~-GpAG~~aA~~~a~~G~~V~liEk~   36 (481)
T Consensus        31 ~~V~G~tG~vG~~~A~~lA~~Ga~v~lv~R~   61 (194)
T cd01078          31 AVVLGGTGPVGQRAAVLLAREGARVVLVGRD   61 (194)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             9998588578999999999839979999587