>pfam00407 Bet_v_1 Pathogenesis-related protein Bet v I family. This family is named after Bet v 1, the major birch pollen allergen. This protein belongs to family 10 of plant pathogenesis-related proteins (PR-10), cytoplasmic proteins of 15-17 kd that are wide-spread among dicotyledonous plants. In recent years, a number of diverse plant proteins with low sequence similarity to Bet v 1 was identified. A classification by sequence similarity yielded several subfamilies related to PR-10: - Pathogenesis-related proteins PR-10: These proteins were identified as major tree pollen allergens in birch and related species (hazel, alder), as plant food allergens expressed in high levels in fruits, vegetables and seeds (apple, celery, hazelnut), and as pathogenesis-related proteins whose expression is induced by pathogen infection, wounding, or abiotic stress. Hyp-1, an enzyme involved in the synthesis of the bioactive naphthodianthrone hypericin in St. John's wort (Hypericum perforatum) also bel

Probab=97.64 E-value=0.0065 Score=39.02 Aligned_cols=114 Identities=12% Similarity=0.136 Sum_probs=79.3 Q ss_pred CEEEEEEECCCHHHHHHHHHH-HHHCHHHCCC-CCEEEEEECCCCCCCEEEEEEEEECCCEEEEEEEEEEE-CCCCCEEE Q ss_conf 248999835987999999875-7423101875-20579997268888419999999623126899988861-57662089 Q gi|254780677|r 3 HFTADRIVNHSSQQMLSLVSD-IERYPEFVPL-CKKVVIHERDNYGENEVLVASMTINYACMQREFMTQVR-INQKEHYI 79 (152) Q Consensus 3 ~~~~~~~i~~~~e~i~~iV~D-ve~YpeFlP~-c~~~~v~~r~~~~~~~~~~a~l~v~~~~~~~~~~s~~~-~~~~~~~i 79 (152) T Consensus 4 ~~e~Ev~~~~~a~k~~k~~~~~~~liPk~~P~~i~sve~~eGdgg~~GsIk--~~~f~~gg~~~~~Kerie~iD~~n~~~ 81 (150) T pfam00407 4 KLETEVEIKVSADKFYKAFKLEDHLIPKAIPHHIQGVEVHEGEWGTGGSIK--KWTYTEDGKPKVVKERIEADDEKNKTI 81 (150) T ss_pred EEEEEEECCCCHHHHHHHHHCCCCCCCCCCHHHCEEEEEECCCCCCCCEEE--EEEECCCCCEEEEEEEEEEECCCCCEE T ss_conf 799998716899999999833533154007445307999835889898799--999848995368999999883878599 Q ss_pred EEECCCCC----EEEEEEEEEEEECCCCCEEEEEEEEEEECCH Q ss_conf 63124541----0211379999987998189999999850887 Q gi|254780677|r 80 AVKHIKNL----FNFLENHWHFEEISESKCKVHFSIKYELKNR 118 (152) Q Consensus 80 ~~~~~~g~----f~~~~g~W~f~~~~~~~t~V~~~l~fe~~~~ 118 (152) T Consensus 82 ~y~viEGd~l~~~~~~~~~~~~~p~~~ggsi~k~t~eYe~~~~ 124 (150) T pfam00407 82 TYSVLEGDVLEDYKSFITTLQVIPKSNGGSIVKWTIEYEKIGD 124 (150) T ss_pred EEEEEECCCCCCEEEEEEEEEEEECCCCCEEEEEEEEEEECCC T ss_conf 9999923356780899999999877999789999999999999

HHsearch alignment for GI: 254780677 and conserved domain: pfam00407