HHsearch alignment of GI: 254780677 and MMDB domain: 1icx_A_

>1icx_A (A:) Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus}
Probab=99.15  E-value=4.5e-09  Score=77.95  Aligned_cols=140  Identities=11%  Similarity=0.022  Sum_probs=100.4

Q ss_pred             CEEEEEEECCCHHHHHH-HHHHHHHCHHHCCCCCEEEEEECCCCCCCEEEEEEEEECCCEEEEEEEEE-EECCCCCEEEE
Q ss_conf             24899983598799999-98757423101875205799972688884199999996231268999888-61576620896
Q gi|254780677|r    3 HFTADRIVNHSSQQMLS-LVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREFMTQ-VRINQKEHYIA   80 (152)
Q Consensus         3 ~~~~~~~i~~~~e~i~~-iV~Dve~YpeFlP~c~~~~v~~r~~~~~~~~~~a~l~v~~~~~~~~~~s~-~~~~~~~~~i~   80 (152)
                      .++.+..|++||+++|. ++.|+.+.|+|+|...++..+...+.+.+......+.-+..+..  ...+ ...|..++.+.
T Consensus         4 ~v~~~~~i~ap~e~vW~~l~~df~~~~~w~p~v~~~~~~~~g~g~~g~vr~~~~~~~~~~~~--~~ErL~~~D~~~~~~~   81 (155)
T 1icx_A            4 AFENEQSSTVAPAKLYKALTKDSDEIVPKVIEPIQSVEIVEGNGGPGTIKKIIAIHDGHTSF--VLHKLDAIDEANLTYN   81 (155)
T ss_dssp             EEEEEEEESSCHHHHHHHHTTTHHHHHHHHSTTEEEEEEEESSSSTTCEEEEEEESSSSEEE--EEEEEEEEEGGGTEEE
T ss_pred             CCCCCCCCCCCHHHHHHHHHCCCHHHCHHHCCCCEEEEEEECCCCCCEEEEEEEEECCCCEE--EEEECCCCCCCCCEEE
T ss_conf             00255555336599998762271010442446530589985589986555899983485157--8863143231351567


Q ss_pred             EECCCCC-----EEEEEEEEEEEECCCCCEEEEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             3124541-----021137999998799818999999985088789999999999999999999999999
Q gi|254780677|r   81 VKHIKNL-----FNFLENHWHFEEISESKCKVHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAH  144 (152)
Q Consensus        81 ~~~~~g~-----f~~~~g~W~f~~~~~~~t~V~~~l~fe~~~~~~~~~~~~~~~~~~~~~i~aF~~Ra~  144 (152)
                      ++.++|+     ++...+.+++.+.++++|.|....+|+.............+......|++++++...
T Consensus        82 Y~i~~g~~~~~~~~~~~~~~~v~~~~~~~t~v~W~~~f~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~  150 (155)
T 1icx_A           82 YSIIGGEGLDESLEKISYESKILPGPDGGSIGKINVKFHTKGDVLSETVRDQAKFKGLGLFKAIEGYVL  150 (155)
T ss_dssp             EEEEEETTSCTTEEEEEEEEEEEECGGGCEEEEEEEEEEESSSSCCHHHHTTHHHHHHHHHHHHHHHHH
T ss_pred             EEEECCCCHHHHHHHHCHHCCCCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHHCCCCHHHHHHHEEEE
T ss_conf             777536643567776020032023899983124889984266336687776663265105534102674