RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780677|ref|YP_003065090.1| hypothetical protein CLIBASIA_02820 [Candidatus Liberibacter asiaticus str. psy62] (152 letters) >gnl|CDD|176855 cd07813, COQ10p_like, Coenzyme Q-binding protein COQ10p and similar proteins. Coenzyme Q-binding protein COQ10p and similar proteins. COQ10p is a hydrophobic protein located in the inner membrane of mitochondria that binds coenzyme Q (CoQ), also called ubiquinone, which is an essential electron carrier of the respiratory chain. Deletion of the gene encoding COQ10p (COQ10 or YOL008W) in Saccharomyces cerevisiae results in respiratory defect because of the inability to oxidize NADH and succinate. COQ10p may function in the delivery of CoQ (Q6 in budding yeast) to its proper location for electron transport. The human homolog, called Q-binding protein COQ10 homolog A (COQ10A), is able to fully complement for the absence of COQ10p in fission yeast. Human COQ10A also has a splice variant COQ10B. COQ10p belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. Length = 138 Score = 150 bits (382), Expect = 1e-37 Identities = 46/143 (32%), Positives = 80/143 (55%), Gaps = 5/143 (3%) Query: 4 FTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQ 63 ++ R+V +S++QM LV+D+ERYPEF+P C + ERD + L A +T+ + ++ Sbjct: 1 YSKSRLVPYSAEQMFDLVADVERYPEFLPWCTASRVLERDE----DELEAELTVGFGGIR 56 Query: 64 REFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLFDMM 123 F ++V + I + + F LE W F+ + E+ CKV F +++E K+RL + + Sbjct: 57 ESFTSRVTL-VPPESIEAELVDGPFKHLEGEWRFKPLGENACKVEFDLEFEFKSRLLEAL 115 Query: 124 LKAIFDPSFLSFAKAFEERAHKI 146 +FD AFE+RA ++ Sbjct: 116 AGLVFDEVAKKMVDAFEKRAKQL 138 >gnl|CDD|32694 COG2867, COG2867, Oligoketide cyclase/lipid transport protein [Lipid metabolism]. Length = 146 Score = 129 bits (327), Expect = 2e-31 Identities = 47/150 (31%), Positives = 77/150 (51%), Gaps = 4/150 (2%) Query: 1 MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYA 60 M +V +S+ QM LV+D+E YPEF+P C + ER+ L+A + + + Sbjct: 1 MPQIERTALVPYSASQMFDLVNDVESYPEFLPWCSASRVLERNERE----LIAELDVGFK 56 Query: 61 CMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLF 120 ++ F T+V + I +K I F +L+ W F +SE CKV F + +E K+RL Sbjct: 57 GIRETFTTRVTLKPTARSIDMKLIDGPFKYLKGGWQFTPLSEDACKVEFFLDFEFKSRLL 116 Query: 121 DMMLKAIFDPSFLSFAKAFEERAHKIYHLP 150 ++ +F +AFE+RA ++Y L Sbjct: 117 GALIGPVFKRLASKMVEAFEKRAKEVYGLA 146 >gnl|CDD|38387 KOG3177, KOG3177, KOG3177, Oligoketide cyclase/lipid transport protein [Lipid transport and metabolism]. Length = 227 Score = 88.1 bits (218), Expect = 8e-19 Identities = 42/151 (27%), Positives = 68/151 (45%), Gaps = 5/151 (3%) Query: 4 FTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQ 63 ++ R++ +S +M S+VS++ Y EFVP CKK + R + L A + + + + Sbjct: 70 YSERRLIGYSPSEMYSVVSNVSEYHEFVPWCKKSDVTSRR---PSGPLKADLEVGFKPLD 126 Query: 64 REFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEIS--ESKCKVHFSIKYELKNRLFD 121 + + V + V LFN L W F+ C + FS+ +E K+ L Sbjct: 127 ERYTSNVTCVKPHLTKTVCADGRLFNHLITIWSFKPGPNIPRTCTLDFSVSFEFKSLLHS 186 Query: 122 MMLKAIFDPSFLSFAKAFEERAHKIYHLPSL 152 + FD AFE+RA K+Y SL Sbjct: 187 QVATIFFDEVVKQMVNAFEQRARKLYGPESL 217 >gnl|CDD|146152 pfam03364, Polyketide_cyc, Polyketide cyclase / dehydrase and lipid transport. This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis. The family also includes proteins which are involved in the binding/transport of lipids. Length = 125 Score = 86.0 bits (213), Expect = 4e-18 Identities = 37/132 (28%), Positives = 63/132 (47%), Gaps = 8/132 (6%) Query: 10 VNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREFMTQ 69 V ++Q+ +LV+D+ERYPEF+P CK V + +RD +A + + ++R F + Sbjct: 1 VPAPAEQVWALVTDVERYPEFLPWCKSVEVLDRDG------SLADWRVAFGGLRRSFTAR 54 Query: 70 VRINQKEHYIAVKHIKNLFNFLENHWHFEEI-SESKCKVHFSIKYELKNRLFDMMLKAIF 128 V Q I + + F LE W FE ++ KV + +E + L +L +F Sbjct: 55 VT-LQPPERIEMVLVDGDFKRLEGSWRFEPGGPGTRVKVTLELDFEFASPLPGALLGFVF 113 Query: 129 DPSFLSFAKAFE 140 + +AF Sbjct: 114 RRVLRTLLEAFR 125 >gnl|CDD|176854 cd07812, SRPBCC, START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket; they bind diverse ligands. Included in this superfamily are the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, and the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), as well as the SRPBCC domains of phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of this superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins. Length = 141 Score = 46.9 bits (111), Expect = 2e-06 Identities = 21/144 (14%), Positives = 48/144 (33%), Gaps = 7/144 (4%) Query: 4 FTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQ 63 A + + + L+SD ER+PE+ P ++V + G V + Sbjct: 1 VEASIEIPAPPEAVWDLLSDPERWPEWSPGLERVEVLGGGEGGVGARFVGGRK---GGRR 57 Query: 64 REFMTQVRINQKEHYIAVKHIKNLFNF-LENHWHFEEISESKCKVHFSIKYELKN---RL 119 ++V + W E + +V ++++Y+ ++ Sbjct: 58 LTLTSEVTEVDPPRPGRFRVTGGGGGVDGTGEWRLEPEGDGGTRVTYTVEYDPPGPLLKV 117 Query: 120 FDMMLKAIFDPSFLSFAKAFEERA 143 F ++L + +A + R Sbjct: 118 FALLLAGALKRELAALLRALKARL 141 >gnl|CDD|176861 cd07819, SRPBCC_2, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins. Length = 140 Score = 37.2 bits (87), Expect = 0.002 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 10 VNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENE---VLVASMTIN--YAC 61 + ++ +++D+E YPE+ P K V + RDN G E + V + I YA Sbjct: 10 IEAPPAAVMDVLADVEAYPEWSPKVKSVEVLLRDNDGRPEMVRIGVGAYGIKDTYAL 66 >gnl|CDD|176885 cd08876, START_1, Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family. Functionally uncharacterized subgroup of the START domain family. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. For some mammalian members of the START family (STARDs), it is known which lipids bind in this pocket; these include cholesterol (STARD1, -3, -4, and -5), 25-hydroxycholesterol (STARD5), phosphatidylcholine (STARD2, -7, and -10), phosphatidylethanolamine (STARD10) and ceramides (STARD11). Mammalian STARDs participate in the control of various cellular processes, including lipid trafficking between intracellular compartments, lipid metabolism, and modulation of signaling events. Mutation or altered expression of STARDs is linked to diseases such as cancer, genetic disorders, and autoimmune disease. Length = 195 Score = 30.7 bits (70), Expect = 0.18 Identities = 21/106 (19%), Positives = 40/106 (37%), Gaps = 16/106 (15%) Query: 18 LSLVSDIERYPEFVPLCKKVVIHERDNYGENEV-LVASMTINYACMQREFMTQVRINQK- 75 L+L+ D E YP+++P CK+ + +R + E V V + R+ + + Q Sbjct: 57 LALLRDTESYPQWMPNCKESRVLKRTDDNERSVYTVIDLPWPVK--DRDMVLRSTTEQDA 114 Query: 76 EHYIAVKHIKNLFNFL------------ENHWHFEEISESKCKVHF 109 + ++ L E W F + K +V + Sbjct: 115 DDGSVTITLEAAPEALPEQKGYVRIKTVEGQWTFTPLGNGKTRVTY 160 >gnl|CDD|30968 COG0623, FabI, Enoyl-[acyl-carrier-protein]. Length = 259 Score = 30.5 bits (69), Expect = 0.22 Identities = 17/67 (25%), Positives = 26/67 (38%), Gaps = 10/67 (14%) Query: 82 KHIKNLFNFLENHW-HFEEISESKCKVHFSIKYELKNRLFDMMLKA------IFDPSFLS 134 + I LF ++ W + + S + F+ K ELK D + I SF + Sbjct: 69 ESIDALFATIKKKWGKLDGLVHS---IAFAPKEELKGDYLDTSREGFLIAMDISAYSFTA 125 Query: 135 FAKAFEE 141 AKA Sbjct: 126 LAKAARP 132 >gnl|CDD|176870 cd08861, OtcD1_ARO-CYC_like, N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains. This family includes the N- and C- terminal aromatase/cyclase (ARO/CYC) domains of Streptomyces rimosus OtcD1 and related domains. It belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. ARO/CYC domains participate in the diversification of aromatic polyketides by promoting polyketide cyclization. They occur in two architectural forms, didomain and monodomain. Didomain aromatase/cyclases (ARO/CYCs), contain two ARO/CYC domains, and are associated with C7-C12 first ring cyclized polyketides. Streptomyces rimosus OtcD1 is a didomain ARO/CYC. The polyketide Oxytetracycline (OTC) is a broad spectrum antibiotic made by Streptomyces rimosus. The gene encoding OtcD1 is part of oxytetracycline (OTC) gene cluster. Disruption of this gene results in the production of novel polyketides having shorter chain lengths (by up to 10 carbons) than OTC. Monodomain ARO/CYCs have a single ARO/CYC domain, and are often associated with C9-C14 first ring cyclizations, these latter domains belong to a different subfamily in the SRPBCC superfamily. Length = 142 Score = 30.4 bits (69), Expect = 0.22 Identities = 22/97 (22%), Positives = 36/97 (37%), Gaps = 14/97 (14%) Query: 19 SLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASM---TINYACMQREFMTQVRI-NQ 74 L++D ER+PEF+P V E D G E L M + + T R+ + Sbjct: 16 DLLADAERWPEFLP-TVHVERLELD--GGVERL--RMWATAFDGSVHT---WTSRRVLDP 67 Query: 75 KEHYIAVKHIKN--LFNFLENHWHFEEISESKCKVHF 109 + I + + + W FE + +V Sbjct: 68 EGRRIVFRQEEPPPPVASMSGEWRFEPLGGGGTRVTL 104 >gnl|CDD|176851 cd00177, START, Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins. This family includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, and related domains, such as the START domain of the Arabidopsis homeobox protein GLABRA 2. The mammalian STARDs are grouped into 8 subfamilies. This family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. For some members of this family, specific lipids that bind in this pocket are known; these include cholesterol (STARD1/STARD3/ STARD4/STARD5), 25-hydroxycholesterol (STARD5), phosphatidylcholine (STARD2/ STARD7/STARD10), phosphatidylethanolamine (STARD10) and ceramides (STARD11). The START domain is found either alone or in association with other domains. Mammalian STARDs participate in the control of various cellular processes including lipid trafficking between intracellular compartments, lipid metabolism, and modulation of signaling events. Mutation or altered expression of STARDs is linked to diseases such as cancer, genetic disorders, and autoimmune disease. The Arabidopsis homeobox protein GLABRA 2 suppresses root hair formation in hairless epidermal root cells. Length = 193 Score = 29.2 bits (66), Expect = 0.52 Identities = 10/81 (12%), Positives = 34/81 (41%), Gaps = 4/81 (4%) Query: 9 IVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYACMQREF-- 66 ++ S +Q+ L+ DI+ ++ ++ + E + +++ + R+F Sbjct: 46 VIPASPEQVFELLMDIDLRKKWDKNFEEFEVIEEID-EHTDIIYYKTKPPWPVSPRDFVY 104 Query: 67 -MTQVRINQKEHYIAVKHIKN 86 + +++ + I K + + Sbjct: 105 LRRRRKLDDGTYVIVSKSVDH 125 >gnl|CDD|37603 KOG2392, KOG2392, KOG2392, Serpin [Defense mechanisms]. Length = 380 Score = 27.3 bits (60), Expect = 1.6 Identities = 10/41 (24%), Positives = 14/41 (34%) Query: 106 KVHFSIKYELKNRLFDMMLKAIFDPSFLSFAKAFEERAHKI 146 K Y+LK L + + IF S + E I Sbjct: 276 KFKIEFDYDLKEVLKQLGITDIFSESKADLSGLSESSNLYI 316 >gnl|CDD|176858 cd07816, Bet_v1-like, Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins. This family includes the ligand binding domain of Bet v 1 (the major pollen allergen of white birch, Betula verrucosa) and related proteins. In addition to birch Bet v 1, this family includes other plant intracellular pathogenesis-related class 10 (PR-10) proteins, norcoclaurine synthases (NCSs), cytokinin binding proteins (CSBPs), major latex proteins (MLPs), and ripening-related proteins. It belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Members of this family binds a diverse range of ligands. Bet v 1 can bind brassinosteroids, cytokinins, flavonoids and fatty acids. Hyp-1, a PR-10 from Hypericum perforatum/St. John's wort, catalyzes the condensation of two molecules of emodin to the bioactive naphthodianthrone hypericin. NCSs catalyze the condensation of dopamine and 4-hydroxyphenylacetaldehyde to (S)-norcoclaurine, the first committed step in the biosynthesis of benzylisoquinoline alkaloids such as morphine. The role of MLPs is unclear; however, they are associated with fruit and flower development and in pathogen defense responses. A number of PR-10 proteins in this subgroup, including Bet v 1, have in vitro RNase activity, the biological significance of which is unclear. Bet v 1 family proteins have a conserved glycine-rich P (phosphate-binding)-loop proximal to the entrance of the ligand-binding pocket. However, its conformation differs from that of the canonical P-loop structure found in nucleotide-binding proteins. Several PR-10 members including Bet v1 are allergenic. Cross-reactivity of Bet v 1 with homologs from plant foods results in birch-fruit syndrome. Length = 148 Score = 26.4 bits (59), Expect = 3.5 Identities = 7/25 (28%), Positives = 11/25 (44%) Query: 93 NHWHFEEISESKCKVHFSIKYELKN 117 F + C V ++I+YE K Sbjct: 97 VEIKFVPKGDGGCVVKWTIEYEKKG 121 >gnl|CDD|176695 cd08347, PcpA_C_like, C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins. The C-terminal domain of Sphingobium chlorophenolicum (formerly Sphingomonas chlorophenolica) 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins. PcpA is a key enzyme in the pentachlorophenol (PCP) degradation pathway, catalyzing the conversion of 2,6-dichloro-p-hydroquinone to 2-chloromaleylacetate. This domain belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. Length = 157 Score = 26.0 bits (58), Expect = 4.2 Identities = 7/32 (21%), Positives = 13/32 (40%) Query: 78 YIAVKHIKNLFNFLENHWHFEEISESKCKVHF 109 + V+ + FL + F E+ E +V Sbjct: 6 TLTVRDPEATAAFLTDVLGFREVGEEGDRVRL 37 >gnl|CDD|29134 cd02059, ovalbumin_like, The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily. Ovalbumin, the major protein component of avian egg white, is a non-inhibitory member of SERine Proteinase INhibitorS (serpins). In contrast, SCCA1 inhibits cysteine proteinases such as cathepsin S, K, L, and papain, a so called cross-class serpin.. Length = 389 Score = 24.9 bits (54), Expect = 8.6 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Query: 98 EEISESKCKVHF-----SIKYELKNRLFDMMLKAIFDPS 131 E + E K +V+ KY LK+ L M + IF S Sbjct: 272 ENMRERKVEVYLPRFKLEEKYNLKSVLKAMGMTDIFSES 310 >gnl|CDD|37748 KOG2537, KOG2537, KOG2537, Phosphoglucomutase/phosphomannomutase [Carbohydrate transport and metabolism]. Length = 539 Score = 24.9 bits (54), Expect = 9.2 Identities = 11/52 (21%), Positives = 21/52 (40%) Query: 6 ADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTI 57 A ++VN SSQ + ++ I V+ RD + L+ ++ Sbjct: 95 ATQLVNASSQALERELAKILEKEALGTTVSAHVVVGRDTRPSSPRLLNAVRD 146 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.326 0.136 0.409 Gapped Lambda K H 0.267 0.0607 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,911,483 Number of extensions: 94532 Number of successful extensions: 335 Number of sequences better than 10.0: 1 Number of HSP's gapped: 327 Number of HSP's successfully gapped: 23 Length of query: 152 Length of database: 6,263,737 Length adjustment: 85 Effective length of query: 67 Effective length of database: 4,426,972 Effective search space: 296607124 Effective search space used: 296607124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (24.5 bits)