BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780677|ref|YP_003065090.1| hypothetical protein CLIBASIA_02820 [Candidatus Liberibacter asiaticus str. psy62] (152 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780677|ref|YP_003065090.1| hypothetical protein CLIBASIA_02820 [Candidatus Liberibacter asiaticus str. psy62] Length = 152 Score = 315 bits (808), Expect = 2e-88, Method: Compositional matrix adjust. Identities = 152/152 (100%), Positives = 152/152 (100%) Query: 1 MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYA 60 MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYA Sbjct: 1 MYHFTADRIVNHSSQQMLSLVSDIERYPEFVPLCKKVVIHERDNYGENEVLVASMTINYA 60 Query: 61 CMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLF 120 CMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLF Sbjct: 61 CMQREFMTQVRINQKEHYIAVKHIKNLFNFLENHWHFEEISESKCKVHFSIKYELKNRLF 120 Query: 121 DMMLKAIFDPSFLSFAKAFEERAHKIYHLPSL 152 DMMLKAIFDPSFLSFAKAFEERAHKIYHLPSL Sbjct: 121 DMMLKAIFDPSFLSFAKAFEERAHKIYHLPSL 152 >gi|255764461|ref|YP_003064629.2| methionyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 511 Score = 23.1 bits (48), Expect = 2.6, Method: Composition-based stats. Identities = 7/21 (33%), Positives = 18/21 (85%) Query: 7 DRIVNHSSQQMLSLVSDIERY 27 +++++ + Q++SLVS+++RY Sbjct: 407 NQLIHRALAQVISLVSEVDRY 427 >gi|254780527|ref|YP_003064940.1| hypothetical protein CLIBASIA_02070 [Candidatus Liberibacter asiaticus str. psy62] Length = 397 Score = 22.7 bits (47), Expect = 2.9, Method: Compositional matrix adjust. Identities = 13/43 (30%), Positives = 18/43 (41%) Query: 45 YGENEVLVASMTINYACMQREFMTQVRINQKEHYIAVKHIKNL 87 Y ++ L A M+ Q+ FM I + HY IK L Sbjct: 221 YQSSDSLDALMSTESVLNQKSFMRVTMIPESVHYTDTGSIKAL 263 >gi|254781193|ref|YP_003065606.1| putative DNA polymerase from bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62] Length = 675 Score = 22.7 bits (47), Expect = 2.9, Method: Composition-based stats. Identities = 7/17 (41%), Positives = 12/17 (70%) Query: 90 FLENHWHFEEISESKCK 106 FLE H E+++E+ C+ Sbjct: 244 FLETGLHLEDLTETTCQ 260 >gi|254780395|ref|YP_003064808.1| organic solvent tolerance protein [Candidatus Liberibacter asiaticus str. psy62] Length = 762 Score = 21.9 bits (45), Expect = 5.7, Method: Composition-based stats. Identities = 10/29 (34%), Positives = 15/29 (51%) Query: 71 RINQKEHYIAVKHIKNLFNFLENHWHFEE 99 RIN + Y+ KN F+ H+H +E Sbjct: 344 RININQIYLTGTGEKNSFDMRALHYHIQE 372 >gi|254780455|ref|YP_003064868.1| nicotinate phosphoribosyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 418 Score = 21.2 bits (43), Expect = 9.1, Method: Compositional matrix adjust. Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 125 KAIFDPSFLSFAKAFEERAHKIYH 148 K +F+P FLS+ F+ + + H Sbjct: 89 KQLFEPKFLSWLSDFQLPEYDLSH 112 >gi|254780874|ref|YP_003065287.1| peptide chain release factor 1 [Candidatus Liberibacter asiaticus str. psy62] Length = 357 Score = 21.2 bits (43), Expect = 9.2, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 17/30 (56%) Query: 114 ELKNRLFDMMLKAIFDPSFLSFAKAFEERA 143 +LKNR ++ L+ PS ++ K EE A Sbjct: 11 DLKNRFAEIELRMSESPSVDAYIKLTEEYA 40 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.326 0.136 0.409 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,511 Number of Sequences: 1233 Number of extensions: 3490 Number of successful extensions: 17 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 8 length of query: 152 length of database: 328,796 effective HSP length: 67 effective length of query: 85 effective length of database: 246,185 effective search space: 20925725 effective search space used: 20925725 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 34 (17.7 bits)