RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780678|ref|YP_003065091.1| hypothetical protein CLIBASIA_02825 [Candidatus Liberibacter asiaticus str. psy62] (108 letters) >gnl|CDD|39090 KOG3887, KOG3887, KOG3887, Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport]. Length = 347 Score = 27.6 bits (61), Expect = 0.68 Identities = 18/71 (25%), Positives = 27/71 (38%), Gaps = 8/71 (11%) Query: 15 LEPDKRKKNT-----HRKRGKHNDRKILFNHIPFPLRTAIL--ALRITLTSISFSPIKLY 67 E D K R+ GK + +K++F+ + P T L +IT IS S I Sbjct: 20 AEADSGMKPRILLMGLRRSGKSSIQKVVFHKMS-PNETLFLESTSKITRDHISNSFINFQ 78 Query: 68 TRALSFKYCVF 78 + F Sbjct: 79 VWDFPGQMDFF 89 >gnl|CDD|36139 KOG0921, KOG0921, KOG0921, Dosage compensation complex, subunit MLE [Transcription]. Length = 1282 Score = 27.6 bits (60), Expect = 0.81 Identities = 11/40 (27%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Query: 25 HRKRGKHNDRKILFNHIPFPLRTAILALRITLTSISFSPI 64 H + RK +F +P + IL+ I TSI+ + Sbjct: 681 HSQLTSQEQRK-VFEPVPEGVTKIILSTNIAETSITIDDV 719 >gnl|CDD|99963 cd03788, GT1_TPS, Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.. Length = 460 Score = 26.7 bits (60), Expect = 1.3 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 3/20 (15%) Query: 26 RKRGKHNDRKI-LFNHIPFP 44 R+RG +I F HIPFP Sbjct: 150 RERGPDA--RIGFFLHIPFP 167 >gnl|CDD|36796 KOG1583, KOG1583, KOG1583, UDP-N-acetylglucosamine transporter [Carbohydrate transport and metabolism]. Length = 330 Score = 25.2 bits (55), Expect = 4.2 Identities = 8/26 (30%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Query: 21 KKNTHRKRGKHNDRKILFNH-IPFPL 45 ++ T++K GKH + + H + PL Sbjct: 183 QETTYQKYGKHWKEALFYTHFLSLPL 208 >gnl|CDD|144428 pfam00829, Ribosomal_L21p, Ribosomal prokaryotic L21 protein. Length = 96 Score = 24.8 bits (55), Expect = 5.6 Identities = 6/11 (54%), Positives = 9/11 (81%) Query: 19 KRKKNTHRKRG 29 KR+KN +K+G Sbjct: 78 KRRKNYRKKQG 88 >gnl|CDD|163638 cd07395, MPP_CSTP1, Homo sapiens CSTP1 and related proteins, metallophosphatase domain. CSTP1 (complete S-transactivated protein 1) is an uncharacterized Homo sapiens protein with a metallophosphatase domain, that is transactivated by the complete S protein of hepatitis B virus. CSTP1 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 262 Score = 24.6 bits (54), Expect = 7.1 Identities = 8/31 (25%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Query: 18 DKRKKNTHRKRGKHNDRKILFNHIPFPLRTA 48 +++ + KH I+F HIP+ L Sbjct: 154 EEQLEIAKESDCKH---VIVFQHIPWFLEDP 181 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.327 0.142 0.427 Gapped Lambda K H 0.267 0.0699 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,342,124 Number of extensions: 62914 Number of successful extensions: 168 Number of sequences better than 10.0: 1 Number of HSP's gapped: 168 Number of HSP's successfully gapped: 15 Length of query: 108 Length of database: 6,263,737 Length adjustment: 75 Effective length of query: 33 Effective length of database: 4,643,062 Effective search space: 153221046 Effective search space used: 153221046 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (23.5 bits)