BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780678|ref|YP_003065091.1| hypothetical protein CLIBASIA_02825 [Candidatus Liberibacter asiaticus str. psy62] (108 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780678|ref|YP_003065091.1| hypothetical protein CLIBASIA_02825 [Candidatus Liberibacter asiaticus str. psy62] Length = 108 Score = 216 bits (550), Expect = 9e-59, Method: Compositional matrix adjust. Identities = 108/108 (100%), Positives = 108/108 (100%) Query: 1 MISAPPLLITNKKLLEPDKRKKNTHRKRGKHNDRKILFNHIPFPLRTAILALRITLTSIS 60 MISAPPLLITNKKLLEPDKRKKNTHRKRGKHNDRKILFNHIPFPLRTAILALRITLTSIS Sbjct: 1 MISAPPLLITNKKLLEPDKRKKNTHRKRGKHNDRKILFNHIPFPLRTAILALRITLTSIS 60 Query: 61 FSPIKLYTRALSFKYCVFKGILFNHSKKHPFIFPRLQNIPSGRTQYAL 108 FSPIKLYTRALSFKYCVFKGILFNHSKKHPFIFPRLQNIPSGRTQYAL Sbjct: 61 FSPIKLYTRALSFKYCVFKGILFNHSKKHPFIFPRLQNIPSGRTQYAL 108 >gi|254781115|ref|YP_003065528.1| poly(A) polymerase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 416 Score = 22.3 bits (46), Expect = 2.0, Method: Compositional matrix adjust. Identities = 13/52 (25%), Positives = 20/52 (38%) Query: 57 TSISFSPIKLYTRALSFKYCVFKGILFNHSKKHPFIFPRLQNIPSGRTQYAL 108 TSIS+ IK+ R F + L + +F R S R + + Sbjct: 73 TSISYGTIKIICRKKYFDITTLRSDLITDGRYAKVVFTRDWKADSLRRDFTI 124 >gi|254780502|ref|YP_003064915.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 954 Score = 21.9 bits (45), Expect = 3.3, Method: Composition-based stats. Identities = 13/48 (27%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Query: 43 FPLRTAILALRITLTSISFSPIKLYTRALSFKYCVFKGILFNHSKKHP 90 F +R A + L + T ++ Y SF + LFN +HP Sbjct: 320 FFMRVA-MGLALKETEKEKRAVEFYNLLSSFHFMCSTPTLFNSGTRHP 366 >gi|254780395|ref|YP_003064808.1| organic solvent tolerance protein [Candidatus Liberibacter asiaticus str. psy62] Length = 762 Score = 21.6 bits (44), Expect = 4.2, Method: Compositional matrix adjust. Identities = 8/11 (72%), Positives = 10/11 (90%) Query: 11 NKKLLEPDKRK 21 N KL+EPDKR+ Sbjct: 102 NIKLIEPDKRQ 112 >gi|254780223|ref|YP_003064636.1| ABC transporter permease [Candidatus Liberibacter asiaticus str. psy62] Length = 360 Score = 21.2 bits (43), Expect = 5.2, Method: Composition-based stats. Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 8/46 (17%) Query: 39 NHIPFPLRTAILALRITLTSISFSPIKLYTRALSFKYCVFKGILFN 84 +H+ + TAI+A+ ISF+ + +Y + KG +FN Sbjct: 240 SHVALGVITAIMAMIPGGAPISFTAVSIYL--------LIKGNIFN 277 >gi|254781204|ref|YP_003065617.1| hypothetical protein CLIBASIA_05555 [Candidatus Liberibacter asiaticus str. psy62] Length = 707 Score = 20.4 bits (41), Expect = 9.3, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 15/29 (51%) Query: 3 SAPPLLITNKKLLEPDKRKKNTHRKRGKH 31 S P L +KLL K K NT++ G H Sbjct: 183 SLPIDLRLKQKLLSEAKEKLNTNQIIGAH 211 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.327 0.142 0.427 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,110 Number of Sequences: 1233 Number of extensions: 2564 Number of successful extensions: 9 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 8 length of query: 108 length of database: 328,796 effective HSP length: 62 effective length of query: 46 effective length of database: 252,350 effective search space: 11608100 effective search space used: 11608100 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 32 (16.9 bits)