Query gi|254780679|ref|YP_003065092.1| hypothetical protein CLIBASIA_02830 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 129 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 29 20:09:30 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780679.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR00934 2a38euk potassium up 52.5 17 0.00044 17.2 3.3 64 4-71 107-172 (1197) 2 KOG1852 consensus 51.3 7.5 0.00019 19.3 1.3 22 28-49 134-172 (223) 3 pfam05393 Hum_adeno_E3A Human 41.2 29 0.00073 15.9 3.3 22 6-35 37-58 (94) 4 pfam06041 DUF924 Bacterial pro 26.5 38 0.00096 15.2 1.6 46 19-64 44-89 (175) 5 pfam08082 PRO8NT PRO8NT (NUC06 26.3 32 0.00082 15.6 1.2 21 29-49 31-51 (152) 6 KOG2513 consensus 22.7 59 0.0015 14.0 4.8 36 9-44 285-322 (647) 7 pfam01692 Paramyxo_C Paramyxov 22.6 40 0.001 15.0 1.1 42 79-120 47-92 (204) 8 pfam04086 SRP-alpha_N Signal r 22.4 22 0.00057 16.5 -0.2 35 16-51 38-72 (235) 9 PRK11436 biofilm-dependent mod 22.2 41 0.0011 14.9 1.1 21 34-54 42-62 (71) 10 COG3803 Uncharacterized protei 20.5 66 0.0017 13.7 2.8 36 16-51 51-86 (182) No 1 >TIGR00934 2a38euk potassium uptake protein, Trk family; InterPro: IPR004773 The proteins of the Trk family are derived from Gram-negative and Gram-positive bacteria, yeast and Triticum aestivum (Wheat). The proteins of Escherichia coli K12 TrkH and TrkG as well as several yeast proteins have been functionally characterised. The E. coli TrkH and TrkG proteins are complexed to two peripheral membrane proteins, TrkA, an NAD-binding protein, and TrkE, an ATP-binding protein. This complex forms the potassium uptake system. This family is specific for the eukaryotic Trk system.; GO: 0015079 potassium ion transmembrane transporter activity, 0006813 potassium ion transport, 0016021 integral to membrane. Probab=52.52 E-value=17 Score=17.22 Aligned_cols=64 Identities=17% Similarity=0.347 Sum_probs=23.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHH-HHHH-HHHHHHHCCCCC Q ss_conf 2299999999999999964999999996203401679999999986221203-4666-542221035686 Q gi|254780679|r 4 LNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTA-SFHR-ASLQKKDIGATP 71 (129) Q Consensus 4 lnwfdlltimllciiftctfksilhlicslkyfprniykifsniyqqkhnta-sfhr-aslqkkdigatp 71 (129) |+-|.+.-+-++|.|=|=-|-+-.---.-|-+|-| -|.+|-++-..-- ...| .+++.+|+-+.+ T Consensus 107 ls~~QqivLy~~~~l~~PI~~h~~laFvRlYWFER----yFd~Ird~sk~~~G~lr~~~~~~~~~~~~~~ 172 (1197) T TIGR00934 107 LSLYQQIVLYILTLLTTPIFIHSSLAFVRLYWFER----YFDGIRDSSKQRFGKLRRTKTLLQRELEDRE 172 (1197) T ss_pred HHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 45799999999997312033343233246677888----8545888876435778889999877643211 No 2 >KOG1852 consensus Probab=51.32 E-value=7.5 Score=19.33 Aligned_cols=22 Identities=55% Similarity=0.997 Sum_probs=16.7 Q ss_pred HHHHHHHHHH-----------------HHHHHHHHHHHH Q ss_conf 9996203401-----------------679999999986 Q gi|254780679|r 28 HLICSLKYFP-----------------RNIYKIFSNIYQ 49 (129) Q Consensus 28 hlicslkyfp-----------------rniykifsniyq 49 (129) -|.-|-|||| |.+|.|||..|- T Consensus 134 cllnsnkyfpsrvsikessv~klgsvcrrvyrifsha~f 172 (223) T KOG1852 134 CLLNSNKYFPSRVSIKESSVAKLGSVCRRVYRIFSHAYF 172 (223) T ss_pred CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 103477757753201165588888999999999878888 No 3 >pfam05393 Hum_adeno_E3A Human adenovirus early E3A glycoprotein. This family consists of several early glycoproteins from human adenoviruses. Probab=41.15 E-value=29 Score=15.90 Aligned_cols=22 Identities=50% Similarity=1.290 Sum_probs=15.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999649999999962034 Q gi|254780679|r 6 WFDLLTIMLLCIIFTCTFKSILHLICSLKY 35 (129) Q Consensus 6 wfdlltimllciiftctfksilhlicslky 35 (129) ||. ...|..|.| |.-|||.||- T Consensus 37 wfs-ialmfvcli-------imwlicclkr 58 (94) T pfam05393 37 WFS-IALMFVCLI-------IMWLICCLKR 58 (94) T ss_pred HHH-HHHHHHHHH-------HHHHHHHHHC T ss_conf 999-999999999-------9999998650 No 4 >pfam06041 DUF924 Bacterial protein of unknown function (DUF924). This family consists of several hypothetical bacterial proteins of unknown function. Probab=26.49 E-value=38 Score=15.18 Aligned_cols=46 Identities=24% Similarity=0.358 Sum_probs=30.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHH Q ss_conf 9964999999996203401679999999986221203466654222 Q gi|254780679|r 19 FTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRASLQK 64 (129) Q Consensus 19 ftctfksilhlicslkyfprniykifsniyqqkhntasfhraslqk 64 (129) ...+-.+.|-||--|.-||||||.--..-|.+..-.-..-+..+.+ T Consensus 44 W~~~p~g~LAlIILlDQFpRNifRgt~~AFa~D~~Al~la~~ai~~ 89 (175) T pfam06041 44 WRETPEGRLALIILLDQFPRNIFRGTPRAFATDPLALALAQEALAR 89 (175) T ss_pred HHHCCHHHHHHHHHHHHHHHHHCCCCHHHHHCCHHHHHHHHHHHHC T ss_conf 3509031127999987500654169988872759999999999974 No 5 >pfam08082 PRO8NT PRO8NT (NUC069), PrP8 N-terminal domain. The PRO8NT domain is found at the N-terminus of pre-mRNA splicing factors of PRO8 family. The NLS or nuclear localisation signal for these spliceosome proteins begins at the start and runs for 60 residues. N-terminal to this domain is a highly variable proline-rich region. Probab=26.29 E-value=32 Score=15.58 Aligned_cols=21 Identities=29% Similarity=0.629 Sum_probs=17.8 Q ss_pred HHHHHHHHHHHHHHHHHHHHH Q ss_conf 996203401679999999986 Q gi|254780679|r 29 LICSLKYFPRNIYKIFSNIYQ 49 (129) Q Consensus 29 licslkyfprniykifsniyq 49 (129) .+.+|||.|..+||+..|+-+ T Consensus 31 ~lgaLkY~PhAv~KLLEnmPm 51 (152) T pfam08082 31 YLGALKYMPHALLKLLENMPM 51 (152) T ss_pred HHHHHHHHHHHHHHHHHCCCC T ss_conf 876775426899999871898 No 6 >KOG2513 consensus Probab=22.71 E-value=59 Score=14.01 Aligned_cols=36 Identities=33% Similarity=0.576 Sum_probs=26.9 Q ss_pred HHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHH Q ss_conf 99999999999964999999--9962034016799999 Q gi|254780679|r 9 LLTIMLLCIIFTCTFKSILH--LICSLKYFPRNIYKIF 44 (129) Q Consensus 9 lltimllciiftctfksilh--licslkyfprniykif 44 (129) ++-.|+.|..+.-...|+.. ++|-|.|.|.-+|-++ T Consensus 285 ~l~f~l~~f~ie~~~~s~~~~~~~sils~lP~iv~~~l 322 (647) T KOG2513 285 LLSFMLYCFQIEVWVLSDYGGPLISILSYLPTIVYAVL 322 (647) T ss_pred HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH T ss_conf 99999999999999998717852789999899999999 No 7 >pfam01692 Paramyxo_C Paramyxovirus non-structural protein c. This family consist of the C proteins (C', C, Y1, Y2) found in paramyxovirus; human parainfluenza, and sendai virus. The C proteins effect viral RNA synthesis having both a positive and negative effect during the course of infection. Paramyxovirus have a negative strand ssRNA genome of 15.3kb form which six mRNAs are transcribed, five of these are monocistronic. The P/C mRNA is polycistronic and has two overlapping open reading frames P and C, C encodes the nested C proteins C', C, Y1 and Y2. Probab=22.59 E-value=40 Score=15.03 Aligned_cols=42 Identities=31% Similarity=0.493 Sum_probs=27.9 Q ss_pred EEEECCCCCCC----CCCCCHHHHCCHHHCCCHHHCCCCCCCCCCC Q ss_conf 02412678542----7643404211701155301016887532246 Q gi|254780679|r 79 QLISTNTNKDK----KPRINLREKKQPQRKPITKQKKNPIPLASRS 120 (129) Q Consensus 79 qlistntnkdk----kprinlrekkqpqrkpitkqkknpiplasrs 120 (129) ...|+.+.+|. +|.+|..++.|-||+-|..|-..--.|.... T Consensus 47 s~~sst~~kdsa~~~~psvn~k~kqqkr~~KivDQ~~~i~sLG~~t 92 (204) T pfam01692 47 SMVSSTTPKDSAHHAKPSVNTKTKQQKRRPKIIDQVRRVESLGEQT 92 (204) T ss_pred CCCCCCCCCCCCCCCCCCCCCCHHHHHHCCHHHHHHHHHCCCCCCC T ss_conf 4346667765456789865657476653128999887101012100 No 8 >pfam04086 SRP-alpha_N Signal recognition particle, alpha subunit, N-terminal. SRP is a complex of six distinct polypeptides and a 7S RNA that is essential for transferring nascent polypeptide chains that are destined for export from the cell to the translocation apparatus of the endoplasmic reticulum (ER) membrane. SRP binds hydrophobic signal sequences as they emerge from the ribosome, and arrests translation. Probab=22.43 E-value=22 Score=16.52 Aligned_cols=35 Identities=29% Similarity=0.590 Sum_probs=23.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999996499999999620340167999999998622 Q gi|254780679|r 16 CIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQK 51 (129) Q Consensus 16 ciiftctfksilhlicslkyfprniykifsniyqqk 51 (129) -+||.+.|.+||||-..=+ |-.+|-.+|.+.|... T Consensus 38 ~LvFVvvyQ~il~L~yvD~-ll~dv~~~F~d~Y~~~ 72 (235) T pfam04086 38 GLVFVVVYQKILHLSYIDK-LLDDIRTIFRDLYKNQ 72 (235) T ss_pred CEEEEEEEHHHHHHHHHHH-HHHHHHHHHHHHHHHH T ss_conf 7899996254431578999-9999999999997688 No 9 >PRK11436 biofilm-dependent modulation protein; Provisional Probab=22.17 E-value=41 Score=14.94 Aligned_cols=21 Identities=38% Similarity=0.476 Sum_probs=14.9 Q ss_pred HHHHHHHHHHHHHHHHHHHCH Q ss_conf 340167999999998622120 Q gi|254780679|r 34 KYFPRNIYKIFSNIYQQKHNT 54 (129) Q Consensus 34 kyfprniykifsniyqqkhnt 54 (129) |+....--.|.|.||||.-|- T Consensus 42 kwvea~dndilsdiyqqtiny 62 (71) T PRK11436 42 KWVEASDNDILSDIYQQTINY 62 (71) T ss_pred HHHHHHCCCHHHHHHHHHHHH T ss_conf 999860230889999987786 No 10 >COG3803 Uncharacterized protein conserved in bacteria [Function unknown] Probab=20.49 E-value=66 Score=13.74 Aligned_cols=36 Identities=31% Similarity=0.390 Sum_probs=27.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999996499999999620340167999999998622 Q gi|254780679|r 16 CIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQK 51 (129) Q Consensus 16 ciiftctfksilhlicslkyfprniykifsniyqqk 51 (129) +--.+-+-.+-|-||--|.-||||+|.--...|... T Consensus 51 ~~~W~~~pe~~LAl~iLlDQfPRN~fRGTpr~yatD 86 (182) T COG3803 51 LDAWTETPEGALALIILLDQFPRNMFRGTPRAYATD 86 (182) T ss_pred HHHHHHCHHHHHHHHHHHHHCHHHHHCCCCHHHCCC T ss_conf 778886878888999999775287757993443057 Done!