RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780679|ref|YP_003065092.1| hypothetical protein
CLIBASIA_02830 [Candidatus Liberibacter asiaticus str. psy62]
         (129 letters)



>gnl|CDD|182605 PRK10636, PRK10636, putative ABC transporter ATP-binding protein;
           Provisional.
          Length = 638

 Score = 31.7 bits (72), Expect = 0.063
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 62  LQKKDIGATPTKKGNSSQLISTNTNKDKKPR-INLREKKQPQRKPITKQKK 111
           +QK++       K N++   S    KD+K R   LR + QP RK I + +K
Sbjct: 522 VQKQENQTDEAPKENNAN--SAQARKDQKRREAELRTQTQPLRKEIARLEK 570


>gnl|CDD|182751 PRK10811, rne, ribonuclease E; Reviewed.
          Length = 1068

 Score = 31.2 bits (71), Expect = 0.086
 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%)

Query: 97  EKKQPQRKPITKQKKNPIPLASRSNPMQNNN-DR 129
           E+ +PQ +P  K +  P     R  P QNN  DR
Sbjct: 584 EETKPQEQPAPKAEAKPERQQDRRKPRQNNRRDR 617


>gnl|CDD|177754 PLN00151, PLN00151, potassium transporter; Provisional.
          Length = 852

 Score = 30.9 bits (70), Expect = 0.098
 Identities = 8/26 (30%), Positives = 18/26 (69%), Gaps = 4/26 (15%)

Query: 4   LNWFDLLTIMLLCIIFTCTFKSILHL 29
           +NWF    ++++C++  C+F+SI  +
Sbjct: 474 INWF----LLVMCLVVVCSFRSITDI 495


>gnl|CDD|150922 pfam10326, 7TM_GPCR_Str, Serpentine type 7TM GPCR chemoreceptor
           Str.  Chemoreception is mediated in Caenorhabditis
           elegans by members of the seven-transmembrane
           G-protein-coupled receptor class (7TM GPCRs) of proteins
           which are of the serpentine type. Str is a member of the
           Str superfamily of chemoreceptors. Almost a quarter
           (22.5%) of str and srj family genes and pseudogenes in
           C. elegans appear to have been newly formed by gene
           duplications since the species split. Chemoperception is
           one of the central senses of soil nematodes like C.
           elegans which are otherwise 'blind' and 'deaf'.
          Length = 307

 Score = 29.4 bits (67), Expect = 0.27
 Identities = 11/62 (17%), Positives = 24/62 (38%), Gaps = 11/62 (17%)

Query: 3   YLNWFDLLTIMLLCIIFTCTFKSILHLICSLKYFPRNIYKIFSNIYQQKHNTASFHRASL 62
           +L W   + +++L  I   +F  I  + C          K++  + +     +   R  L
Sbjct: 189 HLRWKSFIGLLILTFIMGISFSII--IYCG--------IKMYFKMKKLLSLGSEKTR-KL 237

Query: 63  QK 64
           Q+
Sbjct: 238 QR 239


>gnl|CDD|151926 pfam11489, DUF3210, Protein of unknown function (DUF3210).  This is
           a family of proteins conserved in yeasts. The function
           is not known. The Schizosaccharomyces pombe member is
           the uncharacterized serine-rich protein C18E5.07 and the
           Saccharomyces cerevisiae member is the uncharacterized
           protein YIR003W.
          Length = 672

 Score = 27.2 bits (60), Expect = 1.4
 Identities = 11/40 (27%), Positives = 19/40 (47%)

Query: 76  NSSQLISTNTNKDKKPRINLREKKQPQRKPITKQKKNPIP 115
            + + + +++    KP I  R K+     P  K+K  PIP
Sbjct: 498 ETPEEVKSSSPGVTKPAIPSRPKEGSPTSPTEKRKPPPIP 537


>gnl|CDD|152138 pfam11702, DUF3295, Protein of unknown function (DUF3295).  This
           family is conserved in fungi but the function is not
           known.
          Length = 507

 Score = 26.8 bits (59), Expect = 1.5
 Identities = 14/53 (26%), Positives = 21/53 (39%), Gaps = 6/53 (11%)

Query: 67  IGATPTKKGNSSQLISTNT------NKDKKPRINLREKKQPQRKPITKQKKNP 113
           + +T   +G S   IS++       NK   P  +      PQ KP   +KK  
Sbjct: 157 VKSTSVVRGFSPSHISSSYRSTAQLNKAPSPTKSAEPTAAPQAKPELPKKKQA 209


>gnl|CDD|182486 PRK10473, PRK10473, multidrug efflux system protein MdtL;
           Provisional.
          Length = 392

 Score = 25.4 bits (56), Expect = 4.0
 Identities = 7/22 (31%), Positives = 10/22 (45%)

Query: 2   SYLNWFDLLTIMLLCIIFTCTF 23
           S  +   L  I L+C  F+  F
Sbjct: 289 SPSHAVSLFGITLICAGFSVGF 310


>gnl|CDD|162346 TIGR01414, autotrans_barl, outer membrane autotransporter barrel
          domain.  A number of Gram-negative bacterial proteins,
          mostly found in pathogens and associated with
          virulence, contain a conserved C-terminal domain that
          integrates into the outer membrane and enables the
          N-terminal region to be delivered across the membrane.
          This C-terminal autotransporter domain is about 400
          amino acids in length and includes the aromatic amino
          acid-rich OMP signal, typically ending with a Phe or
          Trp residue, at the extreme C-terminus.
          Length = 429

 Score = 24.6 bits (54), Expect = 6.6
 Identities = 6/23 (26%), Positives = 10/23 (43%)

Query: 66 DIGATPTKKGNSSQLISTNTNKD 88
          +IG    + G+   L+  N   D
Sbjct: 52 NIGGEGAQTGDGITLVEVNGGSD 74


>gnl|CDD|177753 PLN00149, PLN00149, potassium transporter; Provisional.
          Length = 779

 Score = 24.8 bits (54), Expect = 7.1
 Identities = 10/26 (38%), Positives = 14/26 (53%), Gaps = 4/26 (15%)

Query: 4   LNWFDLLTIMLLCIIFTCTFKSILHL 29
           +NW    T+MLLC+  T  F+    L
Sbjct: 401 INW----TLMLLCLAVTVGFRDTKRL 422


>gnl|CDD|162097 TIGR00898, 2A0119, cation transport protein. 
          Length = 505

 Score = 24.6 bits (54), Expect = 8.4
 Identities = 5/18 (27%), Positives = 8/18 (44%)

Query: 6   WFDLLTIMLLCIIFTCTF 23
                T+ L+ + FT  F
Sbjct: 324 NLRKTTLCLMMLWFTTAF 341


>gnl|CDD|177538 PHA03136, PHA03136, thymidine kinase; Provisional.
          Length = 378

 Score = 24.3 bits (52), Expect = 8.8
 Identities = 16/78 (20%), Positives = 22/78 (28%), Gaps = 17/78 (21%)

Query: 38  RNIYKIFSNIYQQKHNTASFHRASLQKKDIGATPTKKGNSSQLISTNTNKDKKPRINLRE 97
            NIY  F N             A  + KD  ++               + DKK  +   +
Sbjct: 228 HNIYICFMNTITYAKQAPIMWDADKKDKDALSSAI------------FDDDKKECLEAAD 275

Query: 98  KKQPQRKPITKQKKNPIP 115
                   I   KKNP  
Sbjct: 276 S-----PEIVGGKKNPSI 288


>gnl|CDD|179540 PRK03113, PRK03113, putative disulfide oxidoreductase; Provisional.
          Length = 139

 Score = 24.3 bits (53), Expect = 8.9
 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 5/29 (17%)

Query: 3   YLNWFDLLTIMLLC-----IIFTCTFKSI 26
           Y+NWF  +TI  L       I  C+F  I
Sbjct: 108 YINWFGFVTIPFLALIAFITIAVCSFIVI 136


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.320    0.132    0.393 

Gapped
Lambda     K      H
   0.267   0.0617    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 1,914,344
Number of extensions: 98133
Number of successful extensions: 219
Number of sequences better than 10.0: 1
Number of HSP's gapped: 218
Number of HSP's successfully gapped: 30
Length of query: 129
Length of database: 5,994,473
Length adjustm