RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780682|ref|YP_003065095.1| hypothetical protein CLIBASIA_02845 [Candidatus Liberibacter asiaticus str. psy62] (199 letters) >gnl|CDD|163702 cd08071, MPN_DUF2466, Mov34/MPN/PAD-1 family. Mov34 DUF2466 (also known as DNA repair protein RadC) domain of unknown function contains the signature JAB1/MPN/Mov34 metalloenzyme (JAMM) motif, EXnHS/THX7SXXD, which is involved in zinc ion coordination and provides the active site for isopeptidase activity. However, to date, the name RadC has been misleading and no function has been determined. Length = 113 Score = 26.6 bits (60), Expect = 5.1 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 9/54 (16%) Query: 5 ILFL-IKHKLKLHKNIMSKGKINESFWYIRTLFPYLSHQIHKALMSISSGIILI 57 +L L K++L + +S G +N S + R +F +AL ++ IIL Sbjct: 21 VLLLDTKNRL-IAVETISVGTLNSSLVHPREIF-------KEALRHNAAAIILA 66 >gnl|CDD|100017 cd02188, gamma_tubulin, Gamma-tubulin is a ubiquitous phylogenetically conserved member of tubulin superfamily. Gamma is a low abundance protein present within the cells in both various types of microtubule-organizing centers and cytoplasmic protein complexes. Gamma-tubulin recruits the alpha/beta-tubulin dimers that form the minus ends of microtubules and is thought to be involved in microtubule nucleation and capping.. Length = 431 Score = 25.7 bits (57), Expect = 8.2 Identities = 10/25 (40%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Query: 113 NNILDHIALLKERLRTDINTFDNTN 137 N L+ IA +RL TFD N Sbjct: 205 NTALNRIAT--DRLHIQNPTFDQIN 227 >gnl|CDD|37454 KOG2243, KOG2243, KOG2243, Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms]. Length = 5019 Score = 25.4 bits (55), Expect = 9.7 Identities = 10/20 (50%), Positives = 17/20 (85%) Query: 77 IIDYHRLLEQKKNHNLQYSL 96 ++++ +L EQ+KN+NLQ SL Sbjct: 924 LVEFSKLPEQEKNYNLQMSL 943 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.134 0.390 Gapped Lambda K H 0.267 0.0580 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,356,237 Number of extensions: 116936 Number of successful extensions: 316 Number of sequences better than 10.0: 1 Number of HSP's gapped: 315 Number of HSP's successfully gapped: 18 Length of query: 199 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 110 Effective length of database: 4,340,536 Effective search space: 477458960 Effective search space used: 477458960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.3 bits)