RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780682|ref|YP_003065095.1| hypothetical protein CLIBASIA_02845 [Candidatus Liberibacter asiaticus str. psy62] (199 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 40.7 bits (95), Expect = 2e-04 Identities = 34/195 (17%), Positives = 53/195 (27%), Gaps = 91/195 (46%) Query: 27 ESF-----WYIRTLFPYL---SHQIHKALMSISSGIILILSPTDCTANTANILIPS---- 74 ESF I LF ++ ++ + S+ I+ D N N +PS Sbjct: 290 ESFFVSVRKAITVLF-FIGVRCYEAY-PNTSLPPSIL-----EDSLEN--NEGVPSPMLS 340 Query: 75 -R--------KIIDYHRLLEQKKNHNLQYSLINIPSQNKQESPKNANNNILDHIALLKER 125 ++ K N +L P KQ + I+L Sbjct: 341 ISNLTQEQVQDYVN-------KTNSHL-------P-AGKQ---------V--EISL---- 370 Query: 126 LRTDINTFDNTNLETKIPLPNNLKPNVCVKEKKLIPPRKNINNLKDTNHRL-KIKNNQEI 184 +N NL V PP+ +L N L K K + Sbjct: 371 ----VNG------------AKNL---VVSG-----PPQ----SLYGLNLTLRKAKAPSGL 402 Query: 185 --KNIHHKKNKPRLH 197 I + K + Sbjct: 403 DQSRIPFSERKLKFS 417 Score = 28.8 bits (64), Expect = 0.91 Identities = 22/106 (20%), Positives = 37/106 (34%), Gaps = 17/106 (16%) Query: 70 ILIPSRKIIDYHRLLEQKKNHNLQYSLINIPSQNKQESPKNANNNILDHIALLKER---- 125 +L+P+ +L EQ L + ++ +P L +++ L E Sbjct: 20 LLVPTASFFIASQLQEQFNKI-LPEPTEGFAADDEPTTPAELVGKFLGYVSSLVEPSKVG 78 Query: 126 -----LRTDINTFDNTNLETK-I-----PLPNNLKPNVCVKEKKLI 160 L + F+N LE I L + VK K+LI Sbjct: 79 QFDQVLNLCLTEFENCYLEGNDIHALAAKLLQENDTTL-VKTKELI 123 >2o3o_A YYCI protein; two-component system, signaling protein; 2.89A {Bacillus subtilis} Length = 254 Score = 27.2 bits (60), Expect = 2.8 Identities = 6/34 (17%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Query: 154 VKEKKLIPPRKNINNLKDTNHRLKIKNNQEIKNI 187 ++++ LI + L N ++K +K+ Sbjct: 169 IQKESLITEMDAVELLYYQN---QLKEYSTVKSC 199 >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Length = 356 Score = 26.9 bits (59), Expect = 3.1 Identities = 14/102 (13%), Positives = 34/102 (33%), Gaps = 6/102 (5%) Query: 41 HQIHKALMSISSGIILILSPTDCTANTA-NILIPSRKIIDYHRLLEQKKNHNLQYSLINI 99 ++ K + + G++L+ PT +T ++ YH +L + + Sbjct: 112 GEVFKRVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIEDPIEFVHESKKC 171 Query: 100 PSQNKQESPKNANNNILDHIALLKERLRTDINTFDNTNLETK 141 ++ + + L L+ LR D + + Sbjct: 172 LVNQRE-----VHRDTLGFSEALRSALREDPDIILVGEMRDL 208 >2zog_A Cytosolic non-specific dipeptidase; metallopeptidase, protein-inhibitor complex, CNDP2, CNDP dipeptidase 2, bestatin, L-carnosine, carnosinase, Zn; HET: BES; 1.70A {Mus musculus} PDB: 2zof_A* Length = 479 Score = 26.7 bits (57), Expect = 4.1 Identities = 8/57 (14%), Positives = 18/57 (31%) Query: 96 LINIPSQNKQESPKNANNNILDHIALLKERLRTDINTFDNTNLETKIPLPNNLKPNV 152 + I S + + +++ A +RL + D + L P + Sbjct: 29 WVAIQSVSAWPEKRGEIRRMMEVAAADVQRLGGSVELVDIGKQKLPDGSEIPLPPIL 85 >1ksi_A Copper amine oxidase; PEA seedling, oxidoreductase; HET: TPQ NAG; 2.20A {Pisum sativum} SCOP: b.30.2.1 d.17.2.1 d.17.2.1 PDB: 1w2z_A* Length = 642 Score = 26.1 bits (57), Expect = 5.2 Identities = 16/87 (18%), Positives = 31/87 (35%), Gaps = 7/87 (8%) Query: 110 NANNNILDHIALLKERLRTDI----NTFDNTNLET-KIPLPNNLKPNVCVKEKKLIPPRK 164 N+ DH + L DI N+F+ T+L+T +I ++ + + E + Sbjct: 431 NSIGIYHDHFYIY--YLDFDIDGTHNSFEKTSLKTVRIKDGSSKRKSYWTTETQTAKTES 488 Query: 165 NINNLKDTNHRLKIKNNQEIKNIHHKK 191 + + N IK + Sbjct: 489 DAKITIGLAPAELVVVNPNIKTAVGNE 515 >2ntx_A EMB|CAB41934.1, prone8; dimer, guanine nucleotide exchange factor, signaling protein; HET: MSE; 2.20A {Arabidopsis thaliana} PDB: 2nty_A* 2wbl_A Length = 365 Score = 25.1 bits (55), Expect = 10.0 Identities = 5/16 (31%), Positives = 11/16 (68%) Query: 41 HQIHKALMSISSGIIL 56 Q+ KA M+I++ ++ Sbjct: 187 TQVQKAAMAINAQVLS 202 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.318 0.134 0.390 Gapped Lambda K H 0.267 0.0520 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,646,195 Number of extensions: 71692 Number of successful extensions: 182 Number of sequences better than 10.0: 1 Number of HSP's gapped: 178 Number of HSP's successfully gapped: 33 Length of query: 199 Length of database: 5,693,230 Length adjustment: 88 Effective length of query: 111 Effective length of database: 3,559,758 Effective search space: 395133138 Effective search space used: 395133138 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.1 bits)