BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780682|ref|YP_003065095.1| hypothetical protein CLIBASIA_02845 [Candidatus Liberibacter asiaticus str. psy62] (199 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780682|ref|YP_003065095.1| hypothetical protein CLIBASIA_02845 [Candidatus Liberibacter asiaticus str. psy62] Length = 199 Score = 392 bits (1006), Expect = e-111, Method: Compositional matrix adjust. Identities = 199/199 (100%), Positives = 199/199 (100%) Query: 1 MRSTILFLIKHKLKLHKNIMSKGKINESFWYIRTLFPYLSHQIHKALMSISSGIILILSP 60 MRSTILFLIKHKLKLHKNIMSKGKINESFWYIRTLFPYLSHQIHKALMSISSGIILILSP Sbjct: 1 MRSTILFLIKHKLKLHKNIMSKGKINESFWYIRTLFPYLSHQIHKALMSISSGIILILSP 60 Query: 61 TDCTANTANILIPSRKIIDYHRLLEQKKNHNLQYSLINIPSQNKQESPKNANNNILDHIA 120 TDCTANTANILIPSRKIIDYHRLLEQKKNHNLQYSLINIPSQNKQESPKNANNNILDHIA Sbjct: 61 TDCTANTANILIPSRKIIDYHRLLEQKKNHNLQYSLINIPSQNKQESPKNANNNILDHIA 120 Query: 121 LLKERLRTDINTFDNTNLETKIPLPNNLKPNVCVKEKKLIPPRKNINNLKDTNHRLKIKN 180 LLKERLRTDINTFDNTNLETKIPLPNNLKPNVCVKEKKLIPPRKNINNLKDTNHRLKIKN Sbjct: 121 LLKERLRTDINTFDNTNLETKIPLPNNLKPNVCVKEKKLIPPRKNINNLKDTNHRLKIKN 180 Query: 181 NQEIKNIHHKKNKPRLHCQ 199 NQEIKNIHHKKNKPRLHCQ Sbjct: 181 NQEIKNIHHKKNKPRLHCQ 199 >gi|254780663|ref|YP_003065076.1| carbonate dehydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 207 Score = 27.7 bits (60), Expect = 0.16, Method: Compositional matrix adjust. Identities = 12/20 (60%), Positives = 13/20 (65%) Query: 42 QIHKALMSISSGIILILSPT 61 QIH A ISSG + IL PT Sbjct: 179 QIHGAWFDISSGKLWILDPT 198 >537021.9.peg.816_1 Length = 97 Score = 25.0 bits (53), Expect = 1.0, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 17/30 (56%) Query: 6 LFLIKHKLKLHKNIMSKGKINESFWYIRTL 35 LFL KH + + + S+G I+ YIR + Sbjct: 1 LFLDKHNILIADEVQSRGTIDHVPVYIREI 30 >gi|254780823|ref|YP_003065236.1| double-strand break repair protein AddB [Candidatus Liberibacter asiaticus str. psy62] Length = 1040 Score = 24.6 bits (52), Expect = 1.1, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Query: 85 EQKKNHNLQYSLINIPSQNKQESPKNANNNILDHIALLKERLR--TDINTFDNTNLET 140 E+K +++ +NIP++ ES D I LLK TD T DN ET Sbjct: 871 EEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKET 928 >gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Score = 23.5 bits (49), Expect = 2.9, Method: Compositional matrix adjust. Identities = 17/64 (26%), Positives = 31/64 (48%) Query: 119 IALLKERLRTDINTFDNTNLETKIPLPNNLKPNVCVKEKKLIPPRKNINNLKDTNHRLKI 178 + + R R I F N ++E K P P +KP + ++ I + I+N H+ + Sbjct: 6 FGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRK 65 Query: 179 KNNQ 182 +NN+ Sbjct: 66 ENNK 69 >gi|254780980|ref|YP_003065393.1| hypothetical protein CLIBASIA_04405 [Candidatus Liberibacter asiaticus str. psy62] Length = 121 Score = 22.7 bits (47), Expect = 5.0, Method: Compositional matrix adjust. Identities = 11/32 (34%), Positives = 16/32 (50%) Query: 131 NTFDNTNLETKIPLPNNLKPNVCVKEKKLIPP 162 N F + + E K N+K VC +K +PP Sbjct: 88 NAFWDLSDEDKNAFTGNVKQEVCKVKKITVPP 119 >gi|254780232|ref|YP_003064645.1| inorganic pyrophosphatase [Candidatus Liberibacter asiaticus str. psy62] Length = 177 Score = 22.3 bits (46), Expect = 5.7, Method: Compositional matrix adjust. Identities = 11/42 (26%), Positives = 21/42 (50%) Query: 148 LKPNVCVKEKKLIPPRKNINNLKDTNHRLKIKNNQEIKNIHH 189 ++ + + EK L P KNI +L D+ + N ++ + H Sbjct: 97 MEDDGGIDEKILAVPSKNITSLYDSIQSYEDVPNAYLQKVEH 138 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.134 0.390 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 142,759 Number of Sequences: 1233 Number of extensions: 6270 Number of successful extensions: 28 Number of sequences better than 100.0: 14 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 17 length of query: 199 length of database: 328,796 effective HSP length: 70 effective length of query: 129 effective length of database: 242,486 effective search space: 31280694 effective search space used: 31280694 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 36 (18.5 bits)