HHsearch alignment for GI: 254780683 and conserved domain: COG4942

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning].
Probab=99.93  E-value=2.5e-27  Score=164.81  Aligned_cols=80  Identities=28%  Similarity=0.502  Sum_probs=76.9

Q ss_pred             CEEEECCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCEEEECCEEEEEECCCCCCCCCEEEEEEEECCEECCHHHHHH
Q ss_conf             59996069865511999998998899841156344112002203124899805788888569999978689805269875
Q gi|254780683|r    1 MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDPIKFLE   80 (84)
Q Consensus         1 VVv~~g~~~~~~G~~V~I~h~~g~~t~Y~hl~~i~v~~G~~V~~G~~IG~vg~tg~~~g~hLhfei~~~g~~vdP~~~l~   80 (84)
T Consensus       341 ~VvyA~~-l~GYG~vvIldhG~gy~slyg~~~~i~v~~G~~V~AGepIa~~G~sgg~~~p~LYfEiR~~G~pvnP~pW~~  419 (420)
T COG4942         341 RVVYADW-LRGYGLVVILDHGGGYHSLYGGNQSILVNPGQFVKAGEPIALVGSSGGQGRPALYFEIRRQGQPVNPQPWLR  419 (420)
T ss_pred             EEEECHH-HCCCCEEEEEECCCCCEEEECCCCEEEECCCCEEECCCCHHHCCCCCCCCCCCHHHHHHHCCCCCCCHHHHC
T ss_conf             6995433-256756999974885378861664221068977556971532267789998410021460597479512220


Q ss_pred             C
Q ss_conf             0
Q gi|254780683|r   81 E   81 (84)
Q Consensus        81 ~   81 (84)
T Consensus       420 ~  420 (420)
T COG4942         420 R  420 (420)
T ss_pred             C
T ss_conf             9