HHsearch alignment for GI: 254780683 and conserved domain: PRK11649

>PRK11649 hypothetical protein; Provisional.
Probab=99.96  E-value=6.9e-29  Score=173.07  Aligned_cols=77  Identities=35%  Similarity=0.580  Sum_probs=74.4

Q ss_pred             CEEEECCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCEEEECCEEEEEECCCCCCCCCEEEEEEEECCEECCHHHH
Q ss_conf             599960698655119999989988998411563441120022031248998057888885699999786898052698
Q gi|254780683|r    1 MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDPIKF   78 (84)
Q Consensus         1 VVv~~g~~~~~~G~~V~I~h~~g~~t~Y~hl~~i~v~~G~~V~~G~~IG~vg~tg~~~g~hLhfei~~~g~~vdP~~~   78 (84)
T Consensus       312 ~V~~ag~~-~~yG~~V~I~H~~~~~T~Y~HLs~~~V~~Gq~V~~Gq~Ig~vGsTG~sTGPHLHyEv~~ng~~vnPl~v  388 (418)
T PRK11649        312 EVVVAKRS-GAAGNYVAIRHGRQYTTRYMHLRKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEVWINQQAVNPLTA  388 (418)
T ss_pred             EEEEEEEC-CCCCCEEEEECCCCEEEEEECCCCCCCCCCCEECCCCEEEEECCCCCCCCCEEEEEEEECCEECCCCCC
T ss_conf             99997881-899977999819930999617684777994999989989802688378897338999999979599534