HHsearch alignment for GI: 254780683 and conserved domain: pfam01551

>pfam01551 Peptidase_M23 Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins, for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.
Probab=99.88  E-value=6.1e-23  Score=141.66  Aligned_cols=74  Identities=36%  Similarity=0.714  Sum_probs=70.5

Q ss_pred             CEEEECCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCEEEECCEEEEEECCCCCCCCCEEEEEEEECCEECCH
Q ss_conf             599960698655119999989988998411563441120022031248998057888885699999786898052
Q gi|254780683|r    1 MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDP   75 (84)
Q Consensus         1 VVv~~g~~~~~~G~~V~I~h~~g~~t~Y~hl~~i~v~~G~~V~~G~~IG~vg~tg~~~g~hLhfei~~~g~~vdP   75 (84)
T Consensus        23 ~V~~~~~~-~~~G~~v~i~h~~g~~~~Y~hl~~~~V~~G~~V~~G~~IG~~G~sg~~~~~hLHfei~~~~~~vdP   96 (96)
T pfam01551        23 VVVFAGYL-GGYGNLVIIDHGNGYETLYAHLSKILVKVGQRVKAGQVIGTVGSTGRSTGPHLHFEIRKNGKPVDP   96 (96)
T ss_pred             EEEEEEEC-CCCCEEEEEEECCCCEEEECCCEEEEECCCCCHHHCCEEEEECCCCCCCCEEEEEEEEECCEECCC
T ss_conf             99998983-998859999938987699836446779589890139999986789998980899999999999877