HHsearch alignment of GI: 254780683 and MMDB domain: 1ci3_M_170-231

>1ci3_M (M:170-231) Protein (cytochrome F); electron transfer protein, complex subunit; HET: HEM; 1.90A {Phormidium laminosum}
Probab=91.16  E-value=0.39  Score=26.09  Aligned_cols=47  Identities=17%  Similarity=0.241  Sum_probs=32.9

Q ss_pred             EEEECCCCCCCCEEEEEECCCCEEEEEE--CCCCCCCCCCEEEECCEEEE
Q ss_conf             9996069865511999998998899841--15634411200220312489
Q gi|254780683|r    2 VIYVGNDLVELGNTILIRHDDSIVTVYS--HIDTPYVQKGQKVSRGHTIG   49 (84)
Q Consensus         2 Vv~~g~~~~~~G~~V~I~h~~g~~t~Y~--hl~~i~v~~G~~V~~G~~IG   49 (84)
                      |.+.... ..-...|+|+..+|-...|.  .-..+.|+.||.|++||.|-
T Consensus        11 V~~i~~~-~~~~~~I~i~~~~Ge~~~y~ip~g~~l~V~~Gd~V~~Gq~Lt   59 (62)
T 1ci3_M           11 ITAIAKA-DDGSAEVKIRTEDGTTIVDKIPAGPELIVSEGEEVAAGAALT   59 (62)
T ss_dssp             EEEEEEC-TTSCEEEEEECTTSCEEEEEECSSSCBCCCTTCEECTTCBSB
T ss_pred             EEEEEEC-CCCCEEEEEECCCCCEEEEECCCCCEEEECCCCEECCCCCCC
T ss_conf             9885775-889779999899998989966899804771799982898122