HHsearch alignment of GI: 254780683 and MMDB domain: 2gu1_A_206-361

>2gu1_A (A:206-361) Zinc peptidase; alpha/beta, beta barrel, structural genomics, PSI, protein structure initiative; 1.90A {Vibrio cholerae}
Probab=99.89  E-value=8.4e-24  Score=145.86  Aligned_cols=81  Identities=35%  Similarity=0.492  Sum_probs=76.7

Q ss_pred             CEEEECCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCEEEECCEEEEEECCCCCCCCCEEEEEEEECCEECCHHHHHH
Q ss_conf             59996069865511999998998899841156344112002203124899805788888569999978689805269875
Q gi|254780683|r    1 MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDPIKFLE   80 (84)
Q Consensus         1 VVv~~g~~~~~~G~~V~I~h~~g~~t~Y~hl~~i~v~~G~~V~~G~~IG~vg~tg~~~g~hLhfei~~~g~~vdP~~~l~   80 (84)
                      .|+++++. .++|++|+|+|++++.++|+||+++.|++||+|++||+||++|+++++.+||||||++++++++||+.||+
T Consensus        47 ~V~~~~~~-~~~g~~V~i~h~~g~~~~y~~l~~~~v~~G~~V~~G~~IG~~g~~g~~~~~hLHfei~~~g~~vdP~~~l~  125 (156)
T 2gu1_A           47 KVIVVRKH-PYAGNYLVIEHNSVYKTRYLHLDKILVKKGQLVKRGQKIALAGATGRLTGPHLHFEVLVRNRPVDAMKADL  125 (156)
T ss_dssp             EEEEEEEE-TTTEEEEEEECSSSEEEEEEEESEECCCTTCEECTTCEEEECCCCSSCSSCCEEEEEEETTEEECTTCSSC
T ss_pred             EEEEECCC-CCCCCEEEEECCCCEEEEEECCCCCEECCCCEECCCCEEEEECCCCCCCCCEEEEEEEECCEECCCCCCCC
T ss_conf             35761247-76564599974997478883343212188999997998997768899898568999998998858862468


Q ss_pred             CC
Q ss_conf             03
Q gi|254780683|r   81 EK   82 (84)
Q Consensus        81 ~k   82 (84)
                      ..
T Consensus       126 ~~  127 (156)
T 2gu1_A          126 PI  127 (156)
T ss_dssp             C-
T ss_pred             CC
T ss_conf             89