HHsearch results for GI: 254780683 and protein with PDBid: 2hsi_A

>2hsi_A Putative peptidase M23; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.90A {Pseudomonas aeruginosa PAO1}
Probab=99.95  E-value=5.5e-29  Score=172.43  Aligned_cols=83  Identities=29%  Similarity=0.590  Sum_probs=79.2

Q ss_pred             CEEEECCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCCEEEECCEEEEEECCCCCCCCCEEEEEEEECCEECCHHHHHH
Q ss_conf             59996069865511999998998899841156344112002203124899805788888569999978689805269875
Q gi|254780683|r    1 MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDPIKFLE   80 (84)
Q Consensus         1 VVv~~g~~~~~~G~~V~I~h~~g~~t~Y~hl~~i~v~~G~~V~~G~~IG~vg~tg~~~g~hLhfei~~~g~~vdP~~~l~   80 (84)
                      +|+++++ ...+|++|+|+|++|+.|+|+||+++.|++||.|++||+||++|+||+++|||||||||++|+++||+.||.
T Consensus       200 ~V~~~~~-~~~~G~~v~i~hg~g~~t~Y~hls~i~V~~G~~V~~G~~IG~vG~tg~~tGphLhfei~~~g~~vdP~~~l~  278 (282)
T 2hsi_A          200 KVILIGD-YFFNGKTVFVDHGQGFISMFCHLSKIDVKLGQQVPRGGVLGKVGATGRATGPHMHWNVSLNDARVDPAIFIG  278 (282)
T ss_dssp             EEEEEEE-ETTTEEEEEEEEETTEEEEEEEESEECSCTTCEECTTCEEEECCCTTTCSSCCEEEEEEETTEEECHHHHHT
T ss_pred             EEEECCC-CCCCCCEEEEECCCCEEEEECCCCCCCCCCCCEECCCCEEEEECCCCCCCCCEEEEEEEECCEEECHHHHHC
T ss_conf             7474135-687980999986997799963636035387999998997997458999998679999999999989599757


Q ss_pred             CCCC
Q ss_conf             0385
Q gi|254780683|r   81 EKIP   84 (84)
Q Consensus        81 ~k~p   84 (84)
                      +-.|
T Consensus       279 ~~~p  282 (282)
T 2hsi_A          279 AFQP  282 (282)
T ss_dssp             CCC-
T ss_pred             CCCC
T ss_conf             1598