BLAST/PSIBLAST alignment of GI: 254780683 and GI: 86357457 at iteration 1
>gi|86357457|ref|YP_469349.1| lipoprotein precursor protein [Rhizobium etli CFN 42] Length = 529
>gi|86281559|gb|ABC90622.1| lipoprotein precursor protein [Rhizobium etli CFN 42] Length = 529
 Score =  103 bits (257), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 450 VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVARGQKIQRGQTVAVSGMSGDVKQP 509

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 510 QVHFEVRKDASPVNPMTFLE 529