BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780683|ref|YP_003065096.1| lipoprotein [Candidatus
Liberibacter asiaticus str. psy62]
         (84 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780683|ref|YP_003065096.1| lipoprotein [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040360|gb|ACT57156.1| lipoprotein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 84

 Score =  173 bits (439), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%)

Query: 1  MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
          MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP
Sbjct: 1  MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60

Query: 61 QVHFELRKNAIAMDPIKFLEEKIP 84
          QVHFELRKNAIAMDPIKFLEEKIP
Sbjct: 61 QVHFELRKNAIAMDPIKFLEEKIP 84


>gi|315122207|ref|YP_004062696.1| Peptidase M23 [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495609|gb|ADR52208.1| Peptidase M23 [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 344

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/81 (72%), Positives = 72/81 (88%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIYVGNDL+ELG+ ILIRHD+ +VTVYSHI+TPYVQKGQKVSRGHTIG+S  S + +  
Sbjct: 255 IVIYVGNDLIELGDMILIRHDNEMVTVYSHINTPYVQKGQKVSRGHTIGISRISDDKKIS 314

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           +VHFELR+NAIA+DPI FLE+
Sbjct: 315 KVHFELRQNAIAVDPIAFLEK 335


>gi|218460656|ref|ZP_03500747.1| lipoprotein precursor protein [Rhizobium etli Kim 5]
          Length = 161

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 82  VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVARGQKIQRGQTVAVSGMSGDVKQP 141

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 142 QVHFEVRKDASPVNPMTFLE 161


>gi|218677890|ref|ZP_03525787.1| putative peptidase [Rhizobium etli CIAT 894]
          Length = 160

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 81  VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVTRGQKIQRGQTVAVSGMSGDVKQP 140

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 141 QVHFEVRKDASPVNPMTFLE 160


>gi|222148964|ref|YP_002549921.1| lipoprotein [Agrobacterium vitis S4]
 gi|221735950|gb|ACM36913.1| lipoprotein [Agrobacterium vitis S4]
          Length = 538

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 47/80 (58%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY H D   VQ+GQKV RG  +  SG SGNA  P
Sbjct: 459 VVIYAGNGLKELGNTVLVRHDDGTVTVYGHADAISVQRGQKVQRGQQVATSGMSGNASQP 518

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+RK+A  ++P+ FLE
Sbjct: 519 TLHFEVRKDATPVNPMGFLE 538


>gi|327189125|gb|EGE56310.1| lipoprotein precursor protein [Rhizobium etli CNPAF512]
          Length = 537

 Score =  103 bits (257), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 458 VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVARGQKIQRGQTVAVSGMSGDVKQP 517

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 518 QVHFEVRKDASPVNPMTFLE 537


>gi|86357457|ref|YP_469349.1| lipoprotein precursor protein [Rhizobium etli CFN 42]
 gi|86281559|gb|ABC90622.1| lipoprotein precursor protein [Rhizobium etli CFN 42]
          Length = 529

 Score =  103 bits (257), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 450 VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVARGQKIQRGQTVAVSGMSGDVKQP 509

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 510 QVHFEVRKDASPVNPMTFLE 529


>gi|222085791|ref|YP_002544321.1| lipoprotein precursor protein [Agrobacterium radiobacter K84]
 gi|221723239|gb|ACM26395.1| lipoprotein precursor protein [Agrobacterium radiobacter K84]
          Length = 572

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 59/80 (73%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY H D   V +GQKV RG T+  SG SG+ + P
Sbjct: 493 VVIYAGNGLKELGNTVLVRHDDGTVTVYGHADALSVARGQKVQRGQTLATSGMSGDVKQP 552

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RKN+  ++P+ FLE
Sbjct: 553 QLHFEVRKNSAPVNPMTFLE 572


>gi|190891518|ref|YP_001978060.1| lipoprotein precursor protein [Rhizobium etli CIAT 652]
 gi|190696797|gb|ACE90882.1| lipoprotein precursor protein [Rhizobium etli CIAT 652]
          Length = 529

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 450 VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVARGQKIQRGQTVAVSGMSGDVKQP 509

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 510 QVHFEVRKDASPVNPMTFLE 529


>gi|241204421|ref|YP_002975517.1| peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858311|gb|ACS55978.1| Peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 534

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 455 VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVTRGQKIQRGQTVAVSGMSGDVKQP 514

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 515 QVHFEVRKDASPVNPMTFLE 534


>gi|209549094|ref|YP_002281011.1| peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534850|gb|ACI54785.1| Peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 530

 Score =  103 bits (256), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 451 VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVARGQKIQRGQTVAVSGMSGDVKQP 510

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 511 QVHFEVRKDASPVNPMTFLE 530


>gi|116251812|ref|YP_767650.1| peptidase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256460|emb|CAK07544.1| putative peptidase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 542

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 463 VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVARGQKIQRGQTVAVSGMSGDVKQP 522

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 523 QVHFEVRKDASPVNPMTFLE 542


>gi|325293085|ref|YP_004278949.1| lipoprotein precursor protein [Agrobacterium sp. H13-3]
 gi|325060938|gb|ADY64629.1| lipoprotein precursor protein [Agrobacterium sp. H13-3]
          Length = 561

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 59/80 (73%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L +LGNT+L+RHDD  VTVY +     VQ+GQKV RG TI  SG +G+A+ P
Sbjct: 482 VVIYAGNGLKQLGNTVLVRHDDGKVTVYGNAANLDVQRGQKVQRGQTIATSGMTGSAKRP 541

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P  FLE
Sbjct: 542 QVHFEVRKDATPVNPSGFLE 561


>gi|159184876|ref|NP_354688.2| lipoprotein [Agrobacterium tumefaciens str. C58]
 gi|159140156|gb|AAK87473.2| lipoprotein [Agrobacterium tumefaciens str. C58]
          Length = 537

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 59/80 (73%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L +LGNT+L+RHDD  VTVY +     VQ+GQKV RG TI  SG +G+A+ P
Sbjct: 458 VVIYAGNGLKQLGNTVLVRHDDGKVTVYGNAANLDVQRGQKVQRGQTIATSGMTGSAKRP 517

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P  FLE
Sbjct: 518 QVHFEVRKDATPVNPSGFLE 537


>gi|306843786|ref|ZP_07476384.1| Outer membrane antigenic lipoprotein B precursor [Brucella sp. BO1]
 gi|306275864|gb|EFM57580.1| Outer membrane antigenic lipoprotein B precursor [Brucella sp. BO1]
          Length = 394

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 314 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 373

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 374 KLHFEVRKNSAPVNPTKYLES 394


>gi|326408908|gb|ADZ65973.1| outer membrane antigenic lipoprotein B precursor [Brucella
           melitensis M28]
          Length = 329

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 249 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 308

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 309 KLHFEVRKNSAPVNPTKYLES 329


>gi|306840381|ref|ZP_07473147.1| Outer membrane antigenic lipoprotein B precursor [Brucella sp. BO2]
 gi|306289645|gb|EFM60847.1| Outer membrane antigenic lipoprotein B precursor [Brucella sp. BO2]
          Length = 329

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 249 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 308

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 309 KLHFEVRKNSAPVNPTKYLES 329


>gi|150396390|ref|YP_001326857.1| peptidase M23B [Sinorhizobium medicae WSM419]
 gi|150027905|gb|ABR60022.1| peptidase M23B [Sinorhizobium medicae WSM419]
          Length = 509

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 57/80 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L ELGN +L+RHDD  VTVY +     VQ+GQKV RG T+  SG +G A  P
Sbjct: 430 VVIYSGSSLKELGNAVLVRHDDGTVTVYGNAAELKVQRGQKVQRGQTLASSGMTGRASRP 489

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RKNA  ++P+ +LE
Sbjct: 490 QVHFEVRKNATPVNPVTYLE 509


>gi|227821941|ref|YP_002825911.1| lipoprotein [Sinorhizobium fredii NGR234]
 gi|227340940|gb|ACP25158.1| lipoprotein [Sinorhizobium fredii NGR234]
          Length = 511

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 56/80 (70%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L ELGN +L+RHDD  VTVY +     VQ+G+KV RG T+  SG +G A  P
Sbjct: 432 VVIYSGSSLKELGNAVLVRHDDGTVTVYGNASQLKVQRGEKVQRGQTLAASGMTGKASQP 491

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RKNA  ++P  FLE
Sbjct: 492 QVHFEVRKNATPVNPATFLE 511


>gi|319783195|ref|YP_004142671.1| peptidase M23 [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169083|gb|ADV12621.1| Peptidase M23 [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 500

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 57/80 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E GNT+L+RH++ +VTVY H  +  VQ+GQKV RG  I LSG SG    P
Sbjct: 421 VVIYAGDGLKEFGNTVLVRHENGLVTVYGHASSIEVQRGQKVKRGQEIALSGMSGTTDSP 480

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  +DP  +LE
Sbjct: 481 KLHFEVRKNSAPVDPSGYLE 500


>gi|13471177|ref|NP_102746.1| lipoprotein [Mesorhizobium loti MAFF303099]
 gi|14021921|dbj|BAB48532.1| lipoprotein [Mesorhizobium loti MAFF303099]
          Length = 515

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 57/80 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E GNT+L+RH++ +VTVY H  +  VQ+GQKV RG  I LSG SG    P
Sbjct: 436 VVIYAGDGLKEFGNTVLVRHENGLVTVYGHASSIEVQRGQKVKRGQEIALSGMSGTTDSP 495

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  +DP  +LE
Sbjct: 496 KLHFEVRKNSAPVDPSGYLE 515


>gi|254718992|ref|ZP_05180803.1| peptidase M23B [Brucella sp. 83/13]
 gi|265983983|ref|ZP_06096718.1| peptidase M23B [Brucella sp. 83/13]
 gi|306840122|ref|ZP_07472908.1| Outer membrane antigenic lipoprotein B precursor [Brucella sp. NF
           2653]
 gi|264662575|gb|EEZ32836.1| peptidase M23B [Brucella sp. 83/13]
 gi|306404850|gb|EFM61143.1| Outer membrane antigenic lipoprotein B precursor [Brucella sp. NF
           2653]
          Length = 432

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  ++P K+LE
Sbjct: 412 KLHFEVRKNSAPVNPTKYLE 431


>gi|261324995|ref|ZP_05964192.1| peptidase M23B [Brucella neotomae 5K33]
 gi|261300975|gb|EEY04472.1| peptidase M23B [Brucella neotomae 5K33]
          Length = 432

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  ++P K+LE
Sbjct: 412 KLHFEVRKNSAPVNPTKYLE 431


>gi|256060995|ref|ZP_05451152.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella neotomae
           5K33]
          Length = 427

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 347 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 406

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  ++P K+LE
Sbjct: 407 KLHFEVRKNSAPVNPTKYLE 426


>gi|189024074|ref|YP_001934842.1| peptidoglycan-binding LysM [Brucella abortus S19]
 gi|225627377|ref|ZP_03785414.1| Peptidoglycan-binding LysM [Brucella ceti str. Cudo]
 gi|225852401|ref|YP_002732634.1| peptidase M23B [Brucella melitensis ATCC 23457]
 gi|237815319|ref|ZP_04594317.1| Peptidoglycan-binding LysM [Brucella abortus str. 2308 A]
 gi|254689138|ref|ZP_05152392.1| peptidase M23B [Brucella abortus bv. 6 str. 870]
 gi|254709990|ref|ZP_05171801.1| peptidase M23B [Brucella pinnipedialis B2/94]
 gi|254730171|ref|ZP_05188749.1| peptidase M23B [Brucella abortus bv. 4 str. 292]
 gi|256044562|ref|ZP_05447466.1| peptidase M23B [Brucella melitensis bv. 1 str. Rev.1]
 gi|256159610|ref|ZP_05457372.1| peptidase M23B [Brucella ceti M490/95/1]
 gi|256264102|ref|ZP_05466634.1| peptidoglycan-binding LysM [Brucella melitensis bv. 2 str. 63/9]
 gi|260545420|ref|ZP_05821161.1| peptidoglycan-binding LysM [Brucella abortus NCTC 8038]
 gi|260563914|ref|ZP_05834400.1| peptidoglycan-binding LysM [Brucella melitensis bv. 1 str. 16M]
 gi|260754638|ref|ZP_05866986.1| peptidase M23B [Brucella abortus bv. 6 str. 870]
 gi|260757861|ref|ZP_05870209.1| peptidase M23B [Brucella abortus bv. 4 str. 292]
 gi|260761684|ref|ZP_05874027.1| peptidase M23B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883664|ref|ZP_05895278.1| peptidase M23B [Brucella abortus bv. 9 str. C68]
 gi|261213888|ref|ZP_05928169.1| peptidase M23B [Brucella abortus bv. 3 str. Tulya]
 gi|261222073|ref|ZP_05936354.1| peptidase M23B [Brucella ceti B1/94]
 gi|261314365|ref|ZP_05953562.1| peptidase M23B [Brucella pinnipedialis M163/99/10]
 gi|261317539|ref|ZP_05956736.1| peptidase M23B [Brucella pinnipedialis B2/94]
 gi|261752206|ref|ZP_05995915.1| peptidase M23B [Brucella suis bv. 5 str. 513]
 gi|261758092|ref|ZP_06001801.1| peptidoglycan-binding LysM [Brucella sp. F5/99]
 gi|265988573|ref|ZP_06101130.1| peptidase M23B [Brucella pinnipedialis M292/94/1]
 gi|265990987|ref|ZP_06103544.1| peptidase M23B [Brucella melitensis bv. 1 str. Rev.1]
 gi|265998038|ref|ZP_06110595.1| peptidase M23B [Brucella ceti M490/95/1]
 gi|297248238|ref|ZP_06931956.1| peptidase M23B [Brucella abortus bv. 5 str. B3196]
 gi|189019646|gb|ACD72368.1| Peptidoglycan-binding LysM [Brucella abortus S19]
 gi|225617382|gb|EEH14427.1| Peptidoglycan-binding LysM [Brucella ceti str. Cudo]
 gi|225640766|gb|ACO00680.1| peptidase M23B [Brucella melitensis ATCC 23457]
 gi|237790156|gb|EEP64366.1| Peptidoglycan-binding LysM [Brucella abortus str. 2308 A]
 gi|260096827|gb|EEW80702.1| peptidoglycan-binding LysM [Brucella abortus NCTC 8038]
 gi|260153930|gb|EEW89022.1| peptidoglycan-binding LysM [Brucella melitensis bv. 1 str. 16M]
 gi|260668179|gb|EEX55119.1| peptidase M23B [Brucella abortus bv. 4 str. 292]
 gi|260672116|gb|EEX58937.1| peptidase M23B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674746|gb|EEX61567.1| peptidase M23B [Brucella abortus bv. 6 str. 870]
 gi|260873192|gb|EEX80261.1| peptidase M23B [Brucella abortus bv. 9 str. C68]
 gi|260915495|gb|EEX82356.1| peptidase M23B [Brucella abortus bv. 3 str. Tulya]
 gi|260920657|gb|EEX87310.1| peptidase M23B [Brucella ceti B1/94]
 gi|261296762|gb|EEY00259.1| peptidase M23B [Brucella pinnipedialis B2/94]
 gi|261303391|gb|EEY06888.1| peptidase M23B [Brucella pinnipedialis M163/99/10]
 gi|261738076|gb|EEY26072.1| peptidoglycan-binding LysM [Brucella sp. F5/99]
 gi|261741959|gb|EEY29885.1| peptidase M23B [Brucella suis bv. 5 str. 513]
 gi|262552506|gb|EEZ08496.1| peptidase M23B [Brucella ceti M490/95/1]
 gi|263001771|gb|EEZ14346.1| peptidase M23B [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094304|gb|EEZ18165.1| peptidoglycan-binding LysM [Brucella melitensis bv. 2 str. 63/9]
 gi|264660770|gb|EEZ31031.1| peptidase M23B [Brucella pinnipedialis M292/94/1]
 gi|297175407|gb|EFH34754.1| peptidase M23B [Brucella abortus bv. 5 str. B3196]
 gi|326538626|gb|ADZ86841.1| peptidase M23B [Brucella melitensis M5-90]
          Length = 432

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  ++P K+LE
Sbjct: 412 KLHFEVRKNSAPVNPTKYLE 431


>gi|17987362|ref|NP_539996.1| lipoprotein NlpD [Brucella melitensis bv. 1 str. 16M]
 gi|62289833|ref|YP_221626.1| M24/M37 family peptidase [Brucella abortus bv. 1 str. 9-941]
 gi|82699758|ref|YP_414332.1| peptidoglycan-binding protein LysM [Brucella melitensis biovar
           Abortus 2308]
 gi|254693622|ref|ZP_05155450.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella abortus bv.
           3 str. Tulya]
 gi|254697272|ref|ZP_05159100.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254701652|ref|ZP_05163480.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella suis bv. 5
           str. 513]
 gi|254706902|ref|ZP_05168730.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella
           pinnipedialis M163/99/10]
 gi|256031484|ref|ZP_05445098.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella
           pinnipedialis M292/94/1]
 gi|256254890|ref|ZP_05460426.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella ceti B1/94]
 gi|256257388|ref|ZP_05462924.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella abortus bv.
           9 str. C68]
 gi|256369316|ref|YP_003106824.1| peptidase, M23/M37 family [Brucella microti CCM 4915]
 gi|260168618|ref|ZP_05755429.1| peptidase, M23/M37 family protein [Brucella sp. F5/99]
 gi|17983047|gb|AAL52260.1| lipoprotein nlpd [Brucella melitensis bv. 1 str. 16M]
 gi|62195965|gb|AAX74265.1| peptidase, M23/M37 family [Brucella abortus bv. 1 str. 9-941]
 gi|82615859|emb|CAJ10863.1| Peptidoglycan-binding LysM:Peptidase M23/M37 [Brucella melitensis
           biovar Abortus 2308]
 gi|255999476|gb|ACU47875.1| peptidase, M23/M37 family [Brucella microti CCM 4915]
          Length = 427

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 347 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 406

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  ++P K+LE
Sbjct: 407 KLHFEVRKNSAPVNPTKYLE 426


>gi|307317053|ref|ZP_07596494.1| Peptidase M23 [Sinorhizobium meliloti AK83]
 gi|306897141|gb|EFN27886.1| Peptidase M23 [Sinorhizobium meliloti AK83]
          Length = 512

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 56/80 (70%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L ELGN +L+RHDD  VTVY +     VQ+GQKV RG T+  SG +G A  P
Sbjct: 433 VVIYSGSSLKELGNAVLVRHDDGTVTVYGNAAELKVQRGQKVQRGQTLASSGMTGRATRP 492

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RKNA  ++P  +LE
Sbjct: 493 QVHFEVRKNATPVNPATYLE 512


>gi|256113435|ref|ZP_05454276.1| peptidase M23B [Brucella melitensis bv. 3 str. Ether]
 gi|265994824|ref|ZP_06107381.1| peptidase M23B [Brucella melitensis bv. 3 str. Ether]
 gi|262765937|gb|EEZ11726.1| peptidase M23B [Brucella melitensis bv. 3 str. Ether]
          Length = 432

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  ++P K+LE
Sbjct: 412 KLHFEVRKNSAPVNPTKYLE 431


>gi|163843159|ref|YP_001627563.1| Outer membrane antigenic lipoprotein B precursor [Brucella suis
           ATCC 23445]
 gi|163673882|gb|ABY37993.1| Outer membrane antigenic lipoprotein B precursor [Brucella suis
           ATCC 23445]
          Length = 432

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  ++P K+LE
Sbjct: 412 KLHFEVRKNSAPVNPTKYLE 431


>gi|161618848|ref|YP_001592735.1| Outer membrane antigenic lipoprotein B precursor [Brucella canis
           ATCC 23365]
 gi|260566555|ref|ZP_05837025.1| peptidoglycan-binding LysM [Brucella suis bv. 4 str. 40]
 gi|261754865|ref|ZP_05998574.1| peptidase M23B [Brucella suis bv. 3 str. 686]
 gi|161335659|gb|ABX61964.1| Outer membrane antigenic lipoprotein B precursor [Brucella canis
           ATCC 23365]
 gi|260156073|gb|EEW91153.1| peptidoglycan-binding LysM [Brucella suis bv. 4 str. 40]
 gi|261744618|gb|EEY32544.1| peptidase M23B [Brucella suis bv. 3 str. 686]
          Length = 432

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  ++P K+LE
Sbjct: 412 KLHFEVRKNSAPVNPTKYLE 431


>gi|23501774|ref|NP_697901.1| M24/M37 family peptidase [Brucella suis 1330]
 gi|254704196|ref|ZP_05166024.1| M24/M37 family peptidase [Brucella suis bv. 3 str. 686]
 gi|23347704|gb|AAN29816.1| peptidase, M23/M37 family [Brucella suis 1330]
          Length = 427

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 347 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 406

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  ++P K+LE
Sbjct: 407 KLHFEVRKNSAPVNPTKYLE 426


>gi|15965289|ref|NP_385642.1| lipoprotein precursor [Sinorhizobium meliloti 1021]
 gi|307307879|ref|ZP_07587604.1| Peptidase M23 [Sinorhizobium meliloti BL225C]
 gi|15074469|emb|CAC46115.1| Lipoprotein precursor [Sinorhizobium meliloti 1021]
 gi|306901495|gb|EFN32098.1| Peptidase M23 [Sinorhizobium meliloti BL225C]
          Length = 512

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 56/80 (70%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L ELGN +L+RHDD  VTVY +     VQ+GQKV RG T+  SG +G A  P
Sbjct: 433 VVIYSGSSLKELGNAVLVRHDDGTVTVYGNAAELKVQRGQKVQRGQTLASSGMTGRATRP 492

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RKNA  ++P  +LE
Sbjct: 493 QVHFEVRKNATPVNPATYLE 512


>gi|1754723|gb|AAB88077.1| lipoprotein [Sinorhizobium meliloti]
          Length = 512

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 56/80 (70%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L ELGN +L+RHDD  VTVY +     VQ+GQKV RG T+  SG +G A  P
Sbjct: 433 VVIYSGSSLKELGNAVLVRHDDGTVTVYGNAAELKVQRGQKVQRGQTLASSGMTGRATRP 492

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RKNA  ++P  +LE
Sbjct: 493 QVHFEVRKNATPVNPATYLE 512


>gi|261218755|ref|ZP_05933036.1| peptidase M23B [Brucella ceti M13/05/1]
 gi|261321746|ref|ZP_05960943.1| peptidase M23B [Brucella ceti M644/93/1]
 gi|260923844|gb|EEX90412.1| peptidase M23B [Brucella ceti M13/05/1]
 gi|261294436|gb|EEX97932.1| peptidase M23B [Brucella ceti M644/93/1]
          Length = 432

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  ++P K+LE
Sbjct: 412 KLHFEVRKNSAPVNPTKYLE 431


>gi|294852242|ref|ZP_06792915.1| peptidase M23B [Brucella sp. NVSL 07-0026]
 gi|294820831|gb|EFG37830.1| peptidase M23B [Brucella sp. NVSL 07-0026]
          Length = 432

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  ++P K+LE
Sbjct: 412 KLHFEVRKNSAPVNPTKYLE 431


>gi|254713991|ref|ZP_05175802.1| peptidase M23B [Brucella ceti M644/93/1]
 gi|254716950|ref|ZP_05178761.1| peptidase M23B [Brucella ceti M13/05/1]
          Length = 427

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 347 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 406

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  ++P K+LE
Sbjct: 407 KLHFEVRKNSAPVNPTKYLE 426


>gi|148559896|ref|YP_001258867.1| M24/M37 family peptidase [Brucella ovis ATCC 25840]
 gi|148371153|gb|ABQ61132.1| peptidase, M23/M37 family [Brucella ovis ATCC 25840]
          Length = 427

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 347 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 406

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  ++P K+LE
Sbjct: 407 KLHFEVRKNSAPVNPTKYLE 426


>gi|153009667|ref|YP_001370882.1| peptidase M23B [Ochrobactrum anthropi ATCC 49188]
 gi|151561555|gb|ABS15053.1| peptidase M23B [Ochrobactrum anthropi ATCC 49188]
          Length = 438

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 43/80 (53%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  +  SG SGNA+ P
Sbjct: 358 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQILVQRGQKVRRGEEVAKSGMSGNAKSP 417

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  ++P K+LE
Sbjct: 418 KLHFEVRKNSAPVNPSKYLE 437


>gi|260459794|ref|ZP_05808048.1| Peptidase M23 [Mesorhizobium opportunistum WSM2075]
 gi|259034596|gb|EEW35853.1| Peptidase M23 [Mesorhizobium opportunistum WSM2075]
          Length = 490

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 57/80 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E GNT+L+RH++ +VTVY H  +  VQ+GQKV RG  I LSG SG    P
Sbjct: 411 VVIYAGDGLKEFGNTVLVRHENGLVTVYGHASSIEVQRGQKVKRGQEIALSGMSGTTDSP 470

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  +DP  +LE
Sbjct: 471 KLHFEVRKNSAPVDPSTYLE 490


>gi|239831767|ref|ZP_04680096.1| Outer membrane antigenic lipoprotein B precursor [Ochrobactrum
           intermedium LMG 3301]
 gi|239824034|gb|EEQ95602.1| Outer membrane antigenic lipoprotein B precursor [Ochrobactrum
           intermedium LMG 3301]
          Length = 439

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/80 (53%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  +  SG SGNA+ P
Sbjct: 359 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQILVQRGQKVRRGEEVAKSGMSGNAKSP 418

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  ++P K+LE
Sbjct: 419 KLHFEVRKNSAPVNPNKYLE 438


>gi|319408336|emb|CBI81989.1| LysM/M23 peptidase domain protein [Bartonella schoenbuchensis R1]
          Length = 388

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 59/80 (73%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY  + L ELGN ++IRH+D+I+T+Y H D   V +GQKV RG  I  SG SG+A  P
Sbjct: 308 VVIYASDGLKELGNVVMIRHEDNIITIYGHNDKLVVSRGQKVRRGDEIAKSGVSGDATTP 367

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           +V+FE+RK+ + +DPIK+LE
Sbjct: 368 RVYFEVRKDTVPVDPIKYLE 387


>gi|163759443|ref|ZP_02166528.1| lipoprotein precursor protein [Hoeflea phototrophica DFL-43]
 gi|162283040|gb|EDQ33326.1| lipoprotein precursor protein [Hoeflea phototrophica DFL-43]
          Length = 635

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 60/80 (75%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+L+RHDD +VTVY+H +  +V++G KV+RG  I  SG +G A+ P
Sbjct: 556 VVIYSGDGLKEYGKTVLVRHDDGLVTVYAHANDLHVKRGDKVARGQVIASSGMTGVAKTP 615

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKNA  +DP+ +LE
Sbjct: 616 RLHFEVRKNASPVDPMGYLE 635


>gi|319407535|emb|CBI81185.1| LysM/M23 peptidase domain protein [Bartonella sp. 1-1C]
          Length = 380

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 59/80 (73%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY  N L ELGN ++IRH+++I+T+Y H     V +GQKV RG  I  SG SG+A+ P
Sbjct: 300 VVIYASNGLKELGNVVMIRHENNIITIYGHNSKLIVNRGQKVRRGDEIAKSGFSGDAKTP 359

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           +V+FE+RKN++ +DP ++LE
Sbjct: 360 RVYFEVRKNSLPVDPAEYLE 379


>gi|240850249|ref|YP_002971642.1| putative virulence determinant [Bartonella grahamii as4aup]
 gi|240267372|gb|ACS50960.1| putative virulence determinant [Bartonella grahamii as4aup]
          Length = 393

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L ELGN ++IRH+++I+T+Y       V KGQ++ RG  I  SG SGN + P
Sbjct: 313 VVIYAGDGLKELGNVVMIRHENNIITIYGCNSKLVVNKGQRIRRGDEIAKSGVSGNVKTP 372

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           +V+FE+RKN++ +DP+K+LE 
Sbjct: 373 RVYFEMRKNSLPVDPLKYLEN 393


>gi|319404543|emb|CBI78149.1| LysM/M23 peptidase domain protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 368

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 59/80 (73%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY  N L ELGN ++IRH+++I+T+Y H     V +GQKV RG  I  SG SG+A+ P
Sbjct: 288 VVIYASNGLKELGNVVMIRHENNIITIYGHNSKLIVSRGQKVRRGDEIAKSGFSGDAKTP 347

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           +V+FE+RKN++ +DP ++LE
Sbjct: 348 RVYFEVRKNSLPVDPAEYLE 367


>gi|163868044|ref|YP_001609248.1| putative virulence determinant [Bartonella tribocorum CIP 105476]
 gi|161017695|emb|CAK01253.1| putative virulence determinant [Bartonella tribocorum CIP 105476]
          Length = 389

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 59/80 (73%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L ELGN ++IRH+++I+T+Y       V KGQ++ RG  I  SG SGN + P
Sbjct: 309 VVIYAGDGLKELGNVVMIRHENNIITIYGCNSKITVNKGQRIRRGDEIAKSGVSGNVKTP 368

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           +V+FE+RKN++ +DP+K+LE
Sbjct: 369 RVYFEMRKNSLPVDPLKYLE 388


>gi|90419389|ref|ZP_01227299.1| putative peptidoglycan-binding peptidase, M23/M37 family
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90336326|gb|EAS50067.1| putative peptidoglycan-binding peptidase, M23/M37 family
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 439

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 56/80 (70%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E GNT+L++HD+ +VTVY H D   V++G KV RG  I  SG SG+   P
Sbjct: 360 VVIYAGDGLKEFGNTVLVKHDNGLVTVYGHADQIDVERGAKVKRGQQIAKSGMSGDTDVP 419

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+RK++  +DP K+L+
Sbjct: 420 LLHFEVRKDSAPVDPTKYLQ 439


>gi|319406051|emb|CBI79681.1| LysM/M23 peptidase domain protein [Bartonella sp. AR 15-3]
          Length = 373

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 59/80 (73%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY  + L ELGN ++IRH+++I+T+Y H     V +GQKV RG  I  SG SG+A+ P
Sbjct: 293 VVIYASDGLKELGNVVMIRHENNIITIYGHNSKLIVNRGQKVRRGDEIAKSGFSGDAKTP 352

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           +V+FE+RKN++ +DP ++LE
Sbjct: 353 RVYFEVRKNSLPVDPAEYLE 372


>gi|114707232|ref|ZP_01440130.1| lipoprotein [Fulvimarina pelagi HTCC2506]
 gi|114537428|gb|EAU40554.1| lipoprotein [Fulvimarina pelagi HTCC2506]
          Length = 435

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 57/80 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E GNT+L++HDD +VTVY + D+  V++G  V RG  I  SG SG+A  P
Sbjct: 356 VVIYAGDGLKEFGNTVLVKHDDGLVTVYGNADSLNVKRGDTVKRGQQIASSGMSGDATVP 415

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK++  +DP  +L+
Sbjct: 416 QLHFEVRKDSAPIDPSGYLQ 435


>gi|209964358|ref|YP_002297273.1| peptidoglycan-binding LysM [Rhodospirillum centenum SW]
 gi|209957824|gb|ACI98460.1| peptidoglycan-binding LysM [Rhodospirillum centenum SW]
          Length = 435

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 56/84 (66%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +LIRH+  +VT Y+H+DT  V++GQ V RG  IG  G++GN + P
Sbjct: 343 VVAYAGNELRGFGNLLLIRHEGGLVTAYAHLDTLQVERGQTVRRGQQIGTVGQTGNVRSP 402

Query: 61  QVHFELRKNAIAMDPIKFLEEKIP 84
           Q+HFE+R+ +  +DP   L+   P
Sbjct: 403 QLHFEVRRGSRVLDPRDHLDGSAP 426


>gi|319899188|ref|YP_004159281.1| LysM/M23 peptidase domain protein [Bartonella clarridgeiae 73]
 gi|319403152|emb|CBI76710.1| LysM/M23 peptidase domain protein [Bartonella clarridgeiae 73]
          Length = 383

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 59/80 (73%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY  + L +LGN ++IRH+++I+T+Y H     V +GQ+V RG  I  SG SG+A+ P
Sbjct: 303 VVIYASDGLKKLGNVVMIRHENNIITIYGHNSKLIVNRGQRVRRGDEIAKSGFSGDAKTP 362

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           +V+FE+RKN+I +DP ++LE
Sbjct: 363 RVYFEVRKNSIPVDPAEYLE 382


>gi|121602484|ref|YP_988836.1| LysM/M23 peptidase [Bartonella bacilliformis KC583]
 gi|120614661|gb|ABM45262.1| LysM/M23 peptidase domain protein [Bartonella bacilliformis KC583]
          Length = 397

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY  + L ELGN ++IRH+D+I+T+Y H     V +GQ+V RG  I  SG SG+A  P
Sbjct: 317 VVIYASDGLKELGNVVMIRHEDNIITIYGHNSKLTVSRGQRVKRGDEIAKSGVSGDATTP 376

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           +V+FE+R+N++ ++P ++LE
Sbjct: 377 RVYFEIRQNSVPVNPAQYLE 396


>gi|8886048|gb|AAF80360.1|AF157831_2 43 kDa antigen [Bartonella bacilliformis]
          Length = 401

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY  + L ELGN ++IRH+D+I+T+Y H     V +GQ+V RG  I  SG SG+A  P
Sbjct: 321 VVIYASDGLKELGNVVMIRHEDNIITIYGHNSKLTVSRGQRVKRGDEIAKSGVSGDATTP 380

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           +V+FE+R+N++ ++P ++LE
Sbjct: 381 RVYFEIRQNSVPVNPAQYLE 400


>gi|49474115|ref|YP_032157.1| antigen (virulence determinant) (lipoptrotein) [Bartonella quintana
           str. Toulouse]
 gi|49239619|emb|CAF25978.1| Antigen (virulence determinant) (lipoptrotein) [Bartonella quintana
           str. Toulouse]
          Length = 391

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY  + L ELGN ++IRH++ I+T+Y +     V +GQ++ RG  I  SG SG+ + P
Sbjct: 311 IVIYASDGLKELGNVVMIRHENDIITIYGYNSKLVVNRGQRIRRGDEIAKSGVSGDVKTP 370

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           +V+FE+RKN++ +DPI++LE
Sbjct: 371 RVYFEVRKNSLPVDPIEYLE 390


>gi|46201936|ref|ZP_00208309.1| COG0739: Membrane proteins related to metalloendopeptidases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 320

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 58/83 (69%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V YVGN+L   GN +LI+H D+ +T Y+H D   V++G +V RG TI   G SG+   P
Sbjct: 224 VVAYVGNELKGFGNLLLIKHADNWMTAYAHNDQLMVKRGDRVRRGQTIATLGASGSVASP 283

Query: 61  QVHFELRKNAIAMDPIKFLEEKI 83
           Q+HFE+R+   A++P+++L++K+
Sbjct: 284 QLHFEIRRGTEAVNPMEYLQDKV 306


>gi|300022791|ref|YP_003755402.1| peptidase M23 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524612|gb|ADJ23081.1| Peptidase M23 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 528

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 54/81 (66%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RHD+  VT Y+H D   V++G KV RG  I  +GK+G+   P
Sbjct: 447 VVAYSGNELKGYGNLVLLRHDNGWVTAYAHNDELLVKRGDKVKRGQVISKAGKTGSVDQP 506

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           QVHFELR+ +  +DP  +LE+
Sbjct: 507 QVHFELRQGSRPVDPTPYLEK 527


>gi|83311617|ref|YP_421881.1| membrane protein related to metalloendopeptidase [Magnetospirillum
           magneticum AMB-1]
 gi|82946458|dbj|BAE51322.1| Membrane protein related to metalloendopeptidase [Magnetospirillum
           magneticum AMB-1]
          Length = 363

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/83 (43%), Positives = 58/83 (69%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V YVGN+L   GN +LI+H D+ +T Y+H D   V++G +V RG TI   G SG+   P
Sbjct: 267 VVAYVGNELKGFGNLLLIKHADNWMTAYAHNDQLMVKRGDRVRRGQTIATLGASGSVTSP 326

Query: 61  QVHFELRKNAIAMDPIKFLEEKI 83
           Q+HFE+R+   A++P+++L++K+
Sbjct: 327 QLHFEIRRGTEAVNPVEYLQDKV 349


>gi|49475356|ref|YP_033397.1| antigen (virulence determinant) (lipoptrotein) [Bartonella henselae
           str. Houston-1]
 gi|19526703|gb|AAL89761.1|AF484425_2 NlpD [Bartonella henselae str. Houston-1]
 gi|49238162|emb|CAF27371.1| Antigen (virulence determinant) (lipoptrotein) [Bartonella henselae
           str. Houston-1]
          Length = 392

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY  + L ELGN ++IRH+++I+T+Y       V +GQ++ RG  I  SG SG+ + P
Sbjct: 312 IVIYASDGLKELGNVVMIRHENNIITIYGCNSKLVVTRGQRIRRGDEIAKSGVSGDVKTP 371

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           +V+FE+R+N++ +DPIK+LE
Sbjct: 372 RVYFEVRENSLPVDPIKYLE 391


>gi|83308757|emb|CAJ01667.1| probable lipoprotein [Methylocapsa acidiphila]
          Length = 430

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 51/79 (64%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN ILIRH +  VT Y++     V++G  V RG TI  SG+SGN   P
Sbjct: 349 VVAYAGNELKGYGNLILIRHPNGFVTAYANNGDIEVKRGDTVKRGQTIAKSGQSGNVASP 408

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFELRK A  +DP ++L
Sbjct: 409 QLHFELRKGATPVDPTQYL 427


>gi|91977251|ref|YP_569910.1| peptidase M23B [Rhodopseudomonas palustris BisB5]
 gi|91683707|gb|ABE40009.1| peptidase M23B [Rhodopseudomonas palustris BisB5]
          Length = 478

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 52/79 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G+ + RG TI  SG+SG    P
Sbjct: 397 VVAYSGNELKGYGNLVLVRHSNGYVTAYAHASELMVKRGETIKRGQTIAKSGQSGEVGSP 456

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK +  +DP+KFL
Sbjct: 457 QLHFEIRKGSSPVDPLKFL 475


>gi|110634151|ref|YP_674359.1| peptidase M23B [Mesorhizobium sp. BNC1]
 gi|110285135|gb|ABG63194.1| peptidase M23B [Chelativorans sp. BNC1]
          Length = 412

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 53/79 (67%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L   GNT+L+RH+D +VTVY H     V++G +V RG  I  SG +G+A  P
Sbjct: 333 VVIYAGDGLKGFGNTVLVRHEDGLVTVYGHASELKVKRGDQVRRGQEIARSGMTGDADRP 392

Query: 61  QVHFELRKNAIAMDPIKFL 79
           ++HFE+RK    +DP+ +L
Sbjct: 393 KLHFEVRKGTSPVDPMTYL 411


>gi|86749853|ref|YP_486349.1| peptidase M23B [Rhodopseudomonas palustris HaA2]
 gi|86572881|gb|ABD07438.1| Peptidase M23B [Rhodopseudomonas palustris HaA2]
          Length = 474

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 52/79 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G+ + RG TI  SG+SG    P
Sbjct: 393 VVAYSGNELKGYGNLVLVRHSNGYVTAYAHASELMVKRGETIKRGQTIAKSGQSGEVGSP 452

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK +  +DP+KFL
Sbjct: 453 QLHFEIRKGSSPVDPLKFL 471


>gi|90424022|ref|YP_532392.1| peptidase M23B [Rhodopseudomonas palustris BisB18]
 gi|90106036|gb|ABD88073.1| peptidase M23B [Rhodopseudomonas palustris BisB18]
          Length = 464

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 52/79 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G+ + RG TI  SG+SG    P
Sbjct: 383 VVAYSGNELKGYGNLVLVRHSNGYVTAYAHASELMVKRGETIKRGQTIAKSGQSGEVGSP 442

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK +  +DP++FL
Sbjct: 443 QLHFEIRKGSAPVDPLQFL 461


>gi|154253473|ref|YP_001414297.1| peptidase M23B [Parvibaculum lavamentivorans DS-1]
 gi|154157423|gb|ABS64640.1| peptidase M23B [Parvibaculum lavamentivorans DS-1]
          Length = 328

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/76 (48%), Positives = 52/76 (68%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH++  +T Y+H     VQ+G KV RG TI L+G SG+   P
Sbjct: 248 VVAYAGNELKGYGNLLLVRHENDWITAYAHNSKLLVQRGDKVVRGQTISLAGNSGSVVTP 307

Query: 61  QVHFELRKNAIAMDPI 76
           QVHFE+RK + A+DP+
Sbjct: 308 QVHFEVRKGSKALDPL 323


>gi|115524712|ref|YP_781623.1| peptidase M23B [Rhodopseudomonas palustris BisA53]
 gi|115518659|gb|ABJ06643.1| peptidase M23B [Rhodopseudomonas palustris BisA53]
          Length = 459

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 52/79 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G+ + RG TI  SG++G    P
Sbjct: 378 VVAYAGNELKGYGNLVLVRHSNGFVTAYAHASEVLVKRGETIKRGQTIAKSGQTGEVGSP 437

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK +  +DP++FL
Sbjct: 438 QLHFEIRKGSSPVDPLQFL 456


>gi|312113115|ref|YP_004010711.1| peptidase M23 [Rhodomicrobium vannielii ATCC 17100]
 gi|311218244|gb|ADP69612.1| Peptidase M23 [Rhodomicrobium vannielii ATCC 17100]
          Length = 624

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 50/79 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V YVG++L   GN ILIRH D  VT Y+H D   V+K   V RG  +  +G +G+A  P
Sbjct: 544 VVAYVGDELPGFGNLILIRHADEFVTAYAHTDEIMVRKCDVVKRGQVVAKAGSTGDASQP 603

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RKNA  +DP   L
Sbjct: 604 QLHFEIRKNAKPVDPAPLL 622


>gi|254469809|ref|ZP_05083214.1| peptidase M23B [Pseudovibrio sp. JE062]
 gi|211961644|gb|EEA96839.1| peptidase M23B [Pseudovibrio sp. JE062]
          Length = 587

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 52/78 (66%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN+L   GN +LIRHD+  V+ Y+H     V++G  V RG TI ++G +G+   PQ
Sbjct: 507 IVYAGNELKGFGNLVLIRHDNGWVSAYAHNKELKVRRGDVVRRGQTIAMAGATGSVTQPQ 566

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELRK+   +DP+ FL
Sbjct: 567 LHFELRKDNKPVDPMSFL 584


>gi|118589127|ref|ZP_01546534.1| Peptidase M23B [Stappia aggregata IAM 12614]
 gi|118438456|gb|EAV45090.1| Peptidase M23B [Stappia aggregata IAM 12614]
          Length = 326

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY GN+L   GN IL+RHDD  V+ Y+H     V++G  + RG  + L+G +G+   PQ
Sbjct: 246 VIYSGNELKGYGNLILVRHDDGWVSAYAHNSELKVKRGDTIRRGDVVALAGATGSVNQPQ 305

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR+    +DP+K+L  +
Sbjct: 306 LHFELRQGNKPVDPLKYLPRR 326


>gi|316934002|ref|YP_004108984.1| peptidase M23 [Rhodopseudomonas palustris DX-1]
 gi|315601716|gb|ADU44251.1| Peptidase M23 [Rhodopseudomonas palustris DX-1]
          Length = 479

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 52/79 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G++L   GN +LIRH +  V+ Y+H     V++G+ + RG  I  SG+SG+   P
Sbjct: 398 VVAYAGSELKGYGNLVLIRHSNGYVSAYAHASELMVKRGESIKRGQVIAKSGQSGDVSSP 457

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK +  +DP+KFL
Sbjct: 458 QLHFEIRKGSTPVDPLKFL 476


>gi|167043500|gb|ABZ08196.1| putative peptidase family M23/M37 [uncultured marine microorganism
           HF4000_APKG2J17]
          Length = 321

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 52/79 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +LI+H    V+ Y+H DT  V++GQKV +G  I   G +G+ + P
Sbjct: 240 VVAYAGNELRGFGNLLLIKHAGGWVSAYAHNDTVLVKRGQKVDKGQKIATVGSTGSVKSP 299

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+R+  IA DP K+L
Sbjct: 300 QLHFEIRRGRIAKDPRKYL 318


>gi|92117340|ref|YP_577069.1| peptidase M23B [Nitrobacter hamburgensis X14]
 gi|91800234|gb|ABE62609.1| peptidase M23B [Nitrobacter hamburgensis X14]
          Length = 449

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 51/79 (64%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN IL+RH +  VT Y+H     V++G  + RG  I  SG+SG A  P
Sbjct: 368 VVAYSGNELKGYGNLILVRHPNGYVTAYAHASELLVKRGDTIKRGQVIAKSGQSGEAASP 427

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK +  +DP++FL
Sbjct: 428 QLHFEIRKGSTPVDPLQFL 446


>gi|85716187|ref|ZP_01047162.1| Peptidase M23B [Nitrobacter sp. Nb-311A]
 gi|85697020|gb|EAQ34903.1| Peptidase  M23B [Nitrobacter sp. Nb-311A]
          Length = 446

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 50/79 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G  + RG  I  SG+SG A  P
Sbjct: 365 VVAYAGNELKGYGNLVLVRHSNGYVTAYAHASNLLVKRGDSIKRGQVIAKSGQSGEAGSP 424

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK +  +DP+ FL
Sbjct: 425 QLHFEIRKGSTPVDPLNFL 443


>gi|163793138|ref|ZP_02187114.1| Membrane protein [alpha proteobacterium BAL199]
 gi|159181784|gb|EDP66296.1| Membrane protein [alpha proteobacterium BAL199]
          Length = 396

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 51/81 (62%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y GN+L   GN +LI+H D   T Y+H D   V++G +V+RG  I   G++GN   P
Sbjct: 299 VVVYAGNELRGFGNLLLIKHADGWTTAYAHADALLVRRGDRVARGQPIATVGETGNVDRP 358

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           Q+HFE+RK   A+DP   L E
Sbjct: 359 QLHFEIRKGQRAVDPRDELAE 379


>gi|254504111|ref|ZP_05116262.1| M23 peptidase domain protein [Labrenzia alexandrii DFL-11]
 gi|222440182|gb|EEE46861.1| M23 peptidase domain protein [Labrenzia alexandrii DFL-11]
          Length = 477

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 52/81 (64%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY GN+L   GN +L+RHD+  V+ Y+H     V++G  V RG  + L+G +G+   PQ
Sbjct: 397 VIYAGNELKGYGNLVLVRHDEGWVSAYAHNSVLNVKRGDTVRRGDPVALAGATGSVNQPQ 456

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           VHFELR+    +DP+K+L  +
Sbjct: 457 VHFELRQGNKPVDPLKYLPRR 477


>gi|192291552|ref|YP_001992157.1| peptidase M23 [Rhodopseudomonas palustris TIE-1]
 gi|192285301|gb|ACF01682.1| Peptidase M23 [Rhodopseudomonas palustris TIE-1]
          Length = 471

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 51/79 (64%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G++L   GN +LIRH +  V+ Y+H     V++G+ + RG  I  SG+SG    P
Sbjct: 390 VVAYAGSELKGYGNLVLIRHSNGYVSAYAHASELMVKRGETIKRGQVIAKSGQSGEVSSP 449

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK +  +DP+KFL
Sbjct: 450 QLHFEIRKGSTPVDPLKFL 468


>gi|75675964|ref|YP_318385.1| peptidase M23B [Nitrobacter winogradskyi Nb-255]
 gi|74420834|gb|ABA05033.1| Peptidase M23B [Nitrobacter winogradskyi Nb-255]
          Length = 453

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 50/79 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G  + RG  I  SG+SG A  P
Sbjct: 372 VVAYAGNELKGYGNLVLVRHSNGYVTAYAHARELMVKRGDSIRRGQVIAKSGQSGEAGSP 431

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK +  +DP+ FL
Sbjct: 432 QLHFEIRKGSTPVDPLNFL 450


>gi|39935904|ref|NP_948180.1| peptidase M23B [Rhodopseudomonas palustris CGA009]
 gi|39649758|emb|CAE28279.1| Peptidoglycan-binding LysM:Peptidase M23/M37 [Rhodopseudomonas
           palustris CGA009]
          Length = 471

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 51/79 (64%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G++L   GN +LIRH +  V+ Y+H     V++G+ + RG  I  SG+SG    P
Sbjct: 390 VVAYAGSELKGYGNLVLIRHSNGYVSAYAHASELMVKRGETIKRGQVIAKSGQSGEVSSP 449

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK +  +DP+KFL
Sbjct: 450 QLHFEIRKGSTPVDPLKFL 468


>gi|217977521|ref|YP_002361668.1| Peptidase M23 [Methylocella silvestris BL2]
 gi|217502897|gb|ACK50306.1| Peptidase M23 [Methylocella silvestris BL2]
          Length = 417

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 37/79 (46%), Positives = 52/79 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G++L   GN ILIRH +  V+ Y++     V++G+ V RG TI  SG+SGN   P
Sbjct: 336 VVAYAGSELKGYGNLILIRHPNGFVSAYANNGDIEVKRGETVKRGQTIAKSGQSGNVASP 395

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFELRK A  +DP ++L
Sbjct: 396 QLHFELRKGATPVDPTQYL 414


>gi|323137662|ref|ZP_08072738.1| Peptidase M23 [Methylocystis sp. ATCC 49242]
 gi|322396959|gb|EFX99484.1| Peptidase M23 [Methylocystis sp. ATCC 49242]
          Length = 529

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 51/79 (64%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G++L   GN +LIRH +  V+ Y+H     V++G +V RG TI  SG+SGN   P
Sbjct: 448 VVAYAGSELKGYGNLVLIRHPNGFVSAYAHNGELEVKRGDQVKRGQTIAKSGQSGNVGSP 507

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFELRK +  +DP  +L
Sbjct: 508 QLHFELRKGSTPVDPTSYL 526


>gi|304391790|ref|ZP_07373732.1| peptidase M23B [Ahrensia sp. R2A130]
 gi|303296019|gb|EFL90377.1| peptidase M23B [Ahrensia sp. R2A130]
          Length = 523

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 50/78 (64%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G++L + G  IL+ H+D  V+ Y+H     V +G KVSRG  I  SGK+GN   P+
Sbjct: 444 VIYSGSELEDFGKLILVSHNDGWVSAYAHASQTLVSRGDKVSRGQVIAKSGKTGNTTVPK 503

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELRKN+   +P+  L
Sbjct: 504 LHFELRKNSNPQNPMSHL 521


>gi|328543819|ref|YP_004303928.1| M23 peptidase domain protein [polymorphum gilvum SL003B-26A1]
 gi|326413563|gb|ADZ70626.1| M23 peptidase domain protein [Polymorphum gilvum SL003B-26A1]
          Length = 426

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 49/78 (62%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY GN+L   GN +LIRH D  V+ Y+H     V++G  V RG  +  +G +G+   PQ
Sbjct: 346 VIYAGNELKGYGNLVLIRHSDGWVSAYAHNSELSVKRGDTVQRGQVVAKAGATGSVSQPQ 405

Query: 62  VHFELRKNAIAMDPIKFL 79
           VHFELR+    +DP+K+L
Sbjct: 406 VHFELRQGNKPVDPLKYL 423


>gi|296445303|ref|ZP_06887262.1| Peptidase M23 [Methylosinus trichosporium OB3b]
 gi|296257258|gb|EFH04326.1| Peptidase M23 [Methylosinus trichosporium OB3b]
          Length = 526

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 37/79 (46%), Positives = 50/79 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +LIRH +  V+ Y+H     V++G +V RG  I  SG+SGN   P
Sbjct: 445 VVAYAGNELKGYGNLVLIRHPNGFVSAYAHNGELEVKRGDQVKRGQNIAKSGQSGNVGTP 504

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFELRK A  +DP  +L
Sbjct: 505 QLHFELRKGATPVDPTSYL 523


>gi|182679614|ref|YP_001833760.1| peptidase M23 [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635497|gb|ACB96271.1| Peptidase M23 [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 500

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 52/79 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G++L   GN +LIRH +  V+ Y++     V++G+ V RG TI  SG+SGN   P
Sbjct: 419 VVAYAGSELKGYGNLVLIRHPNGFVSAYANNGDLEVKRGETVKRGQTIAKSGQSGNVNSP 478

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFELRK A  +DP ++L
Sbjct: 479 QLHFELRKGATPVDPTQYL 497


>gi|288958291|ref|YP_003448632.1| lipoprotein [Azospirillum sp. B510]
 gi|288910599|dbj|BAI72088.1| lipoprotein [Azospirillum sp. B510]
          Length = 409

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 52/83 (62%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L++H D  +T Y+H+D   V++G  V RG  I   G++G    P
Sbjct: 314 VVAYAGNELRGFGNLLLLKHSDGWITAYAHLDKIEVERGATVKRGQVIARVGQTGGVSSP 373

Query: 61  QVHFELRKNAIAMDPIKFLEEKI 83
           Q+HFELRK + A+DP   ++ K+
Sbjct: 374 QLHFELRKGSQAVDPNDQMDRKV 396


>gi|148255769|ref|YP_001240354.1| putative peptidoglycan-binding LysM [Bradyrhizobium sp. BTAi1]
 gi|146407942|gb|ABQ36448.1| putative peptidoglycan-binding LysM [Bradyrhizobium sp. BTAi1]
          Length = 484

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 50/79 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G  + RG  I  SG+SG    P
Sbjct: 403 VVAYAGNELKGYGNLVLVRHSNGYVTAYAHASELMVKRGDPIKRGQVIAKSGQSGEVGSP 462

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK +  +DP++FL
Sbjct: 463 QLHFEIRKGSSPVDPLQFL 481


>gi|332185253|ref|ZP_08387002.1| lysM domain protein [Sphingomonas sp. S17]
 gi|332014977|gb|EGI57033.1| lysM domain protein [Sphingomonas sp. S17]
          Length = 320

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 35/82 (42%), Positives = 51/82 (62%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V YVG+ +  LG  ++++H D   +VY H     VQ+GQ V RG T+ LSG+SG A  P
Sbjct: 239 VVAYVGDGIAALGGLVIVKHGDRWTSVYGHASKLLVQRGQAVKRGQTLALSGQSGFADRP 298

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
           +VHFELR+    +DP+  L  +
Sbjct: 299 EVHFELRRGRTPVDPLTQLPRR 320


>gi|83593102|ref|YP_426854.1| peptidase M23B [Rhodospirillum rubrum ATCC 11170]
 gi|83576016|gb|ABC22567.1| peptidase M23B [Rhodospirillum rubrum ATCC 11170]
          Length = 465

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 50/79 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN++   GN +LI+H+   +T Y+H D   V++G+ VSRG TI   G SG    P
Sbjct: 379 VVAYAGNEIRGFGNLLLIKHEGGFMTAYAHNDALLVKRGETVSRGQTIARVGSSGGVGAP 438

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+R+N   +DP  +L
Sbjct: 439 QIHFEIRRNGKPIDPTPYL 457


>gi|27379854|ref|NP_771383.1| lipoprotein [Bradyrhizobium japonicum USDA 110]
 gi|27353007|dbj|BAC50008.1| bll4743 [Bradyrhizobium japonicum USDA 110]
          Length = 461

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 50/79 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G  + RG  I  SG+SG    P
Sbjct: 380 VVAYSGNELKGYGNLVLVRHSNGYVTAYAHASELLVKRGDTIKRGQVIAKSGQSGEVASP 439

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK +  +DP++FL
Sbjct: 440 QLHFEIRKGSSPVDPLQFL 458


>gi|146340968|ref|YP_001206016.1| M23/M37 familypeptidase [Bradyrhizobium sp. ORS278]
 gi|146193774|emb|CAL77791.1| putative peptidoglycan-binding LysM:Peptidase M23/M37 family
           (NlpD/LppB-like) [Bradyrhizobium sp. ORS278]
          Length = 483

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 50/79 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G  + RG  I  SG+SG    P
Sbjct: 402 VVAYAGNELKGYGNLVLVRHSNGYVTAYAHASELMVKRGDPIKRGQVIAKSGQSGEVGSP 461

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK +  +DP++FL
Sbjct: 462 QLHFEIRKGSSPVDPLQFL 480


>gi|154248332|ref|YP_001419290.1| peptidase M23B [Xanthobacter autotrophicus Py2]
 gi|154162417|gb|ABS69633.1| peptidase M23B [Xanthobacter autotrophicus Py2]
          Length = 447

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 50/78 (64%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y GN+L   GN +L++H D  VT Y+H     V++G  V RG  I  +G+SGN   PQ
Sbjct: 367 VAYAGNELKGYGNLVLVKHADGYVTAYAHNSELNVKRGDTVRRGQIIAKAGQSGNVNSPQ 426

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RK + A+DP +++
Sbjct: 427 LHFEIRKGSTAVDPSRYV 444


>gi|299134933|ref|ZP_07028124.1| Peptidase M23 [Afipia sp. 1NLS2]
 gi|298589910|gb|EFI50114.1| Peptidase M23 [Afipia sp. 1NLS2]
          Length = 434

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 51/79 (64%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN IL+RH +  VT Y+H     V++G  + RG  I  SG++G+   P
Sbjct: 353 VVAYAGNELKGYGNLILVRHANGYVTAYAHASELEVKRGDTIKRGQVIAKSGQTGDVGSP 412

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK +  +DP++FL
Sbjct: 413 QLHFEIRKGSSPVDPLQFL 431


>gi|209885381|ref|YP_002289238.1| peptidase M23B [Oligotropha carboxidovorans OM5]
 gi|209873577|gb|ACI93373.1| peptidase M23B [Oligotropha carboxidovorans OM5]
          Length = 442

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN IL+RH +  VT Y+H     V++G  + RG  I  SG++G    P
Sbjct: 361 VVAYSGNELKGYGNLILVRHANGYVTAYAHASELMVKRGDSIKRGQIIAKSGQTGEVGSP 420

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK +  +DP++FL
Sbjct: 421 QLHFEIRKGSSPVDPLQFL 439


>gi|307946880|ref|ZP_07662215.1| lipoprotein NlpD [Roseibium sp. TrichSKD4]
 gi|307770544|gb|EFO29770.1| lipoprotein NlpD [Roseibium sp. TrichSKD4]
          Length = 585

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 51/78 (65%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY GN+L   GN +L+RHDD  V+ Y+H     V++G+ + RG  +  +G +G+   PQ
Sbjct: 505 VIYAGNELKGYGNLVLVRHDDGWVSAYAHNSKLQVKRGETIRRGDVVANAGATGSVSQPQ 564

Query: 62  VHFELRKNAIAMDPIKFL 79
           VHFELR+    ++P+++L
Sbjct: 565 VHFELRRGNKPVNPMRYL 582


>gi|144899897|emb|CAM76761.1| Peptidase M23B [Magnetospirillum gryphiswaldense MSR-1]
          Length = 358

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 48/79 (60%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V YVGN+L   GN +L++H D  V+ Y+H D   V+KG  V RG  I   G SG    P
Sbjct: 277 VVAYVGNELKGFGNLLLVKHADGWVSAYAHNDQLMVRKGDSVKRGQQIATVGTSGGVDSP 336

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFELR+   A++P+  L
Sbjct: 337 QLHFELRRGTEAVNPVAHL 355


>gi|304321691|ref|YP_003855334.1| putative lipoprotein [Parvularcula bermudensis HTCC2503]
 gi|303300593|gb|ADM10192.1| putative lipoprotein [Parvularcula bermudensis HTCC2503]
          Length = 457

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 50/79 (63%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G++L   GN +LIRH D  V+ Y+H D+  VQKG++V +G  +   GKSG+   PQ
Sbjct: 368 VIYTGSELEGYGNLLLIRHADGWVSAYAHADSILVQKGEQVRQGEIVAKVGKSGSVGQPQ 427

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFELR      DP+  L+
Sbjct: 428 LHFELRHELQPRDPLAALD 446


>gi|254563564|ref|YP_003070659.1| hypothetical protein METDI5234 [Methylobacterium extorquens DM4]
 gi|254270842|emb|CAX26847.1| putative protein precursor, N-terminal membrane lipoprotein lipid
           attachment site and C-terminal peptidase domain
           [Methylobacterium extorquens DM4]
          Length = 455

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 49/78 (62%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH++  V+ Y+H     V+ G+KV RG TI  SG +GN   PQ
Sbjct: 376 VAYAGSDVKGYGKLVLVRHNNGYVSAYAHNGELDVRPGEKVKRGQTIAKSGATGNVTSPQ 435

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELRK A  +DP+  L
Sbjct: 436 LHFELRKGATPVDPMPHL 453


>gi|240141050|ref|YP_002965530.1| putative protein precursor, N-terminal membrane lipoprotein lipid
           attachment site and C-terminal peptidase domain
           [Methylobacterium extorquens AM1]
 gi|240011027|gb|ACS42253.1| putative protein precursor, N-terminal membrane lipoprotein lipid
           attachment site and C-terminal peptidase domain
           [Methylobacterium extorquens AM1]
          Length = 446

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 49/78 (62%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH++  V+ Y+H     V+ G+KV RG TI  SG +GN   PQ
Sbjct: 367 VAYAGSDVKGYGKLVLVRHNNGYVSAYAHNGELDVRPGEKVKRGQTIAKSGATGNVTSPQ 426

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELRK A  +DP+  L
Sbjct: 427 LHFELRKGATPVDPMPHL 444


>gi|218532487|ref|YP_002423303.1| peptidase M23 [Methylobacterium chloromethanicum CM4]
 gi|218524790|gb|ACK85375.1| Peptidase M23 [Methylobacterium chloromethanicum CM4]
          Length = 455

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 49/78 (62%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH++  V+ Y+H     V+ G+KV RG TI  SG +GN   PQ
Sbjct: 376 VAYAGSDVKGYGKLVLVRHNNGYVSAYAHNGELDVRPGEKVKRGQTIAKSGATGNVTSPQ 435

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELRK A  +DP+  L
Sbjct: 436 LHFELRKGATPVDPMPHL 453


>gi|163853628|ref|YP_001641671.1| peptidase M23B [Methylobacterium extorquens PA1]
 gi|163665233|gb|ABY32600.1| peptidase M23B [Methylobacterium extorquens PA1]
          Length = 451

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 49/78 (62%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH++  V+ Y+H     V+ G+KV RG TI  SG +GN   PQ
Sbjct: 372 VAYAGSDVKGYGKLVLVRHNNGYVSAYAHNGELDVRPGEKVKRGQTIAKSGATGNVTSPQ 431

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELRK A  +DP+  L
Sbjct: 432 LHFELRKGATPVDPMPHL 449


>gi|23012163|ref|ZP_00052317.1| COG0739: Membrane proteins related to metalloendopeptidases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 233

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
            V Y G+D+   G  +L+RH++  V+ Y+H     V+ G+KV RG TI  SG +GN   P
Sbjct: 153 TVAYAGSDVKGYGKLVLVRHNNGYVSAYAHNGELDVRPGEKVKRGQTIAKSGATGNVTSP 212

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RK A  +DP+  L
Sbjct: 213 QLHFEIRKGATPVDPMPHL 231


>gi|315498260|ref|YP_004087064.1| peptidase m23 [Asticcacaulis excentricus CB 48]
 gi|315416272|gb|ADU12913.1| Peptidase M23 [Asticcacaulis excentricus CB 48]
          Length = 368

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/66 (51%), Positives = 45/66 (68%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVG+ + ELGNT+ IRH D   T YSH+    V+ GQKV++G  +G  GKSG    PQ
Sbjct: 285 VVYVGDQVKELGNTVYIRHADGFYTGYSHLGKVSVKSGQKVAQGQAVGTMGKSGAVDRPQ 344

Query: 62  VHFELR 67
           +HFE+R
Sbjct: 345 LHFEVR 350


>gi|298291861|ref|YP_003693800.1| peptidase M23 [Starkeya novella DSM 506]
 gi|296928372|gb|ADH89181.1| Peptidase M23 [Starkeya novella DSM 506]
          Length = 391

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 50/79 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G++L   GN +L++H D  VT Y+H     V+KG  V RG  I  +G++GN   P
Sbjct: 310 VVAYAGSELKGYGNLVLVKHADGWVTAYAHNSELDVKKGDTVKRGQVIAKAGQTGNVSSP 369

Query: 61  QVHFELRKNAIAMDPIKFL 79
           QVHFE+RK +  +DP ++L
Sbjct: 370 QVHFEIRKGSQPVDPSQYL 388


>gi|225848886|ref|YP_002729050.1| lipoprotein [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643593|gb|ACN98643.1| lipoprotein [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 440

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 55/79 (69%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G+ +   GN ++IRH++ + TVY ++D+  V++G+ V++G TIG +G+  N+ +  
Sbjct: 362 VIYAGDGIKAFGNLVVIRHNNGLTTVYGYLDSINVKEGRVVTKGETIGSAGRLKNSDNCG 421

Query: 62  VHFELRKNAIAMDPIKFLE 80
           ++FE+RKN   +DP+  LE
Sbjct: 422 IYFEVRKNVTPLDPMTVLE 440


>gi|188583936|ref|YP_001927381.1| peptidase M23 [Methylobacterium populi BJ001]
 gi|179347434|gb|ACB82846.1| Peptidase M23 [Methylobacterium populi BJ001]
          Length = 446

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 49/78 (62%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH++  V+ Y+H     V+ G+KV RG TI  SG +GN   PQ
Sbjct: 367 VAYAGSDVKGYGKLVLVRHNNGYVSAYAHNGELDVRPGEKVKRGQTIAKSGATGNVTSPQ 426

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RK A  +DP+  L
Sbjct: 427 LHFEIRKGATPVDPMPHL 444


>gi|158423355|ref|YP_001524647.1| putative lipoprotein [Azorhizobium caulinodans ORS 571]
 gi|158330244|dbj|BAF87729.1| putative lipoprotein [Azorhizobium caulinodans ORS 571]
          Length = 363

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 48/78 (61%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y GN+L   GN +LI+H D  VT Y+H     V++G  V RG  I  +G+SG    PQ
Sbjct: 283 VAYAGNELKGYGNLVLIKHADGFVTAYAHNSEISVKRGDTVRRGQIIAKAGQSGGVTTPQ 342

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RK +  +DP +++
Sbjct: 343 LHFEIRKGSQPVDPSQYV 360


>gi|78355290|ref|YP_386739.1| M24/M37 family peptidase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78217695|gb|ABB37044.1| peptidase, M23/M37 family [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 300

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 51/78 (65%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G D    G T+L+RH   IVT Y+H+ +  V+KGQKV+RG  I   G +G +  P 
Sbjct: 222 VLFTGTDGA-YGRTVLVRHSAGIVTRYAHLRSSAVKKGQKVARGELIAYMGNTGRSTGPH 280

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N + +DP++++
Sbjct: 281 LHYEVRLNGVCVDPMRYI 298


>gi|301167119|emb|CBW26698.1| putative exported peptidase [Bacteriovorax marinus SJ]
          Length = 217

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 50/82 (60%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G ++   GN  ++ H + I +VY+H    Y  KGQKV +G  I L G +G +  P
Sbjct: 134 VVVYSGKEMGGYGNITVVAHKNGIFSVYAHASKNYTAKGQKVHKGQVIALVGSTGRSTGP 193

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R+N+ A++P  F+  K
Sbjct: 194 HLHFEIRRNSKALNPKNFVSYK 215


>gi|332799483|ref|YP_004460982.1| peptidase M23 [Tepidanaerobacter sp. Re1]
 gi|332697218|gb|AEE91675.1| Peptidase M23 [Tepidanaerobacter sp. Re1]
          Length = 228

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 54/79 (68%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V  VG D  E+GN + IRHD+++VTVY+H+   YV++ ++V +G  IG  GK+G A+ P
Sbjct: 134 VVFSVGQD-KEMGNMVRIRHDNNLVTVYAHLKDVYVKEQEEVKQGFIIGTVGKTGLAETP 192

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+  N  A DP K+L
Sbjct: 193 HLHFEIWHNDKAEDPKKWL 211


>gi|114570451|ref|YP_757131.1| peptidase M23B [Maricaulis maris MCS10]
 gi|114340913|gb|ABI66193.1| peptidase M23B [Maricaulis maris MCS10]
          Length = 323

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 46/78 (58%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G++L   G  +L+RH    VT Y+H     V++G +VSRG  I  +G +G    PQ
Sbjct: 245 VVYAGSELAGYGQLVLVRHSGGFVTAYAHNSRLLVREGDQVSRGQVIAQAGATGTVDRPQ 304

Query: 62  VHFELRKNAIAMDPIKFL 79
           VHFE+R     +DP+ +L
Sbjct: 305 VHFEIRSGVNPVDPMSYL 322


>gi|237757100|ref|ZP_04585538.1| LysM domain/M23 peptidase domain protein [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237690736|gb|EEP59906.1| LysM domain/M23 peptidase domain protein [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 104

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 52/79 (65%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G+ +   GN ++IRH++ + TVY ++D   V++G+ V+RG  IG +GK  N+    
Sbjct: 26  VIYAGDGIKAFGNLVVIRHNNGLTTVYGYLDDISVREGKVVNRGDVIGKAGKLKNSDKCG 85

Query: 62  VHFELRKNAIAMDPIKFLE 80
           ++FE+RKN   +DP+  LE
Sbjct: 86  IYFEVRKNVTPVDPLNILE 104


>gi|91789946|ref|YP_550898.1| peptidase M23B [Polaromonas sp. JS666]
 gi|91699171|gb|ABE46000.1| peptidase M23B [Polaromonas sp. JS666]
          Length = 457

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 38/89 (42%), Positives = 51/89 (57%), Gaps = 9/89 (10%)

Query: 5   VGNDLVEL-------GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNA 57
           VG+ +VE        GN + IRH ++  TVY+H+    VQ+GQ VS+G TIGL G +G A
Sbjct: 337 VGDGVVEFAGVQNGYGNVVFIRHRNNHETVYAHLSKISVQRGQSVSQGQTIGLVGSTGWA 396

Query: 58  QHPQVHFELRKNAIAMDPIKFLE--EKIP 84
             P +HFE R N    DP+   +  E IP
Sbjct: 397 TGPHLHFEFRVNGAQQDPMTIAKQSETIP 425


>gi|220927134|ref|YP_002502436.1| peptidase M23 [Methylobacterium nodulans ORS 2060]
 gi|219951741|gb|ACL62133.1| Peptidase M23 [Methylobacterium nodulans ORS 2060]
          Length = 537

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 46/78 (58%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH +  V+ Y+H     V+ G KV RG  I  SG SGN   PQ
Sbjct: 457 VAYAGSDVKGYGKLVLVRHANGYVSAYAHNGEIDVRPGDKVKRGQVIAKSGASGNVTSPQ 516

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RK A  +DPI  L
Sbjct: 517 LHFEIRKGATPVDPIPRL 534


>gi|170744609|ref|YP_001773264.1| peptidase M23B [Methylobacterium sp. 4-46]
 gi|168198883|gb|ACA20830.1| peptidase M23B [Methylobacterium sp. 4-46]
          Length = 501

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 45/75 (60%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH +  V+ Y+H     V+ G KV RG  I  SG SGN   PQ
Sbjct: 421 VAYAGSDVKGYGKLVLVRHANGYVSAYAHNGEIDVRPGDKVKRGQVIAKSGASGNVTSPQ 480

Query: 62  VHFELRKNAIAMDPI 76
           +HFE+RK A  +DPI
Sbjct: 481 LHFEIRKGATPVDPI 495


>gi|121603418|ref|YP_980747.1| peptidase M23B [Polaromonas naphthalenivorans CJ2]
 gi|120592387|gb|ABM35826.1| peptidase M23B [Polaromonas naphthalenivorans CJ2]
          Length = 465

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 51/84 (60%), Gaps = 7/84 (8%)

Query: 5   VGNDLVEL-------GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNA 57
           +G+ +VE        GN + I+H +++ TVY+H+    VQ GQ VS+G TIGL G +G A
Sbjct: 345 IGDGVVEFAGVQNGFGNVVFIKHRNNLETVYAHLSKINVQPGQTVSQGQTIGLVGSTGWA 404

Query: 58  QHPQVHFELRKNAIAMDPIKFLEE 81
             P +HFE+R N +  DP+   ++
Sbjct: 405 TGPHLHFEVRVNGVQQDPMAIAKQ 428


>gi|170748688|ref|YP_001754948.1| peptidase M23 [Methylobacterium radiotolerans JCM 2831]
 gi|170655210|gb|ACB24265.1| Peptidase M23 [Methylobacterium radiotolerans JCM 2831]
          Length = 494

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 46/78 (58%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH +  V+ Y+H     V+ G KV RG TI  SG SGN   PQ
Sbjct: 414 VAYAGSDVKGYGKLVLVRHANGYVSAYAHNGEIDVKPGDKVKRGQTIAKSGASGNVTSPQ 473

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RK    +DP+  L
Sbjct: 474 LHFEIRKGGAPVDPMSQL 491


>gi|188997353|ref|YP_001931604.1| Peptidase M23 [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932420|gb|ACD67050.1| Peptidase M23 [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 509

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 52/79 (65%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G+ +   GN ++IRH++ + TVY ++D   V++G+ V+RG  IG +GK  N+    
Sbjct: 431 VIYAGDGIKAFGNLVVIRHNNGLTTVYGYLDDISVREGKVVNRGDVIGKAGKLKNSDKCG 490

Query: 62  VHFELRKNAIAMDPIKFLE 80
           ++FE+RKN   +DP+  LE
Sbjct: 491 IYFEVRKNVTPVDPLNILE 509


>gi|254491392|ref|ZP_05104571.1| M23 peptidase domain protein [Methylophaga thiooxidans DMS010]
 gi|224462870|gb|EEF79140.1| M23 peptidase domain protein [Methylophaga thiooxydans DMS010]
          Length = 268

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 54/81 (66%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+D  ++ Y+H D   V++G+ V+ G  I L G++G  Q  Q
Sbjct: 189 VVYSGSGLPRYGNLLIIKHNDVYLSAYAHSDKLLVKEGEIVTAGQKIALMGRTG-TQRDQ 247

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+N   +DP++FL ++
Sbjct: 248 LHFEIRRNGKPIDPMRFLPKR 268


>gi|293394636|ref|ZP_06638928.1| YgeR protein [Serratia odorifera DSM 4582]
 gi|291422762|gb|EFE95999.1| YgeR protein [Serratia odorifera DSM 4582]
          Length = 259

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H D+  V+ GQ+V  G  I   G SG     +
Sbjct: 174 VVYVGNQLRGYGNLIMIKHGEDFITAYAHNDSTLVRNGQQVKAGQKIATMGSSG-TDSVR 232

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 233 LHFQIRYRATALDPLRYL 250


>gi|225851379|ref|YP_002731613.1| lipoprotein [Persephonella marina EX-H1]
 gi|225645776|gb|ACO03962.1| lipoprotein [Persephonella marina EX-H1]
          Length = 403

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 52/81 (64%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G+ +   G  I+I+H ++  TVY HI+   V+ GQ V +G TIG +G   N++   
Sbjct: 315 VIFAGDSIKAYGRLIVIKHANNFNTVYGHINQINVKDGQVVKKGDTIGTAGLLNNSEKCG 374

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           ++FE+RKN + +DP+ FL EK
Sbjct: 375 IYFEIRKNTVPVDPLVFLNEK 395


>gi|94497463|ref|ZP_01304033.1| membrane protein [Sphingomonas sp. SKA58]
 gi|94423094|gb|EAT08125.1| membrane protein [Sphingomonas sp. SKA58]
          Length = 336

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 46/76 (60%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G+ +   G  +LI H    V+ Y H     V +GQKVS+G  IGL+G +G A  P
Sbjct: 255 VVAYAGDKVAVFGGLVLINHGSGWVSAYGHASRVDVVRGQKVSKGQVIGLTGDTGYASKP 314

Query: 61  QVHFELRKNAIAMDPI 76
           ++HFELRK+   +DP+
Sbjct: 315 KLHFELRKDRAPVDPL 330


>gi|163784071|ref|ZP_02179023.1| lipoprotein [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880659|gb|EDP74211.1| lipoprotein [Hydrogenivirga sp. 128-5-R1-1]
          Length = 352

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY GN +   GN ++I+H +   TVY HI    V+ GQ V +G  IG +GK  N     
Sbjct: 270 VIYAGNSIKAYGNLVIIKHPNRYNTVYGHIGRIAVKDGQYVKKGDIIGFTGKLNNGNECG 329

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           V+FE+RKNA  +DP+  L +K
Sbjct: 330 VYFEIRKNASPVDPLVLLPKK 350


>gi|291615164|ref|YP_003525321.1| peptidase M23 [Sideroxydans lithotrophicus ES-1]
 gi|291585276|gb|ADE12934.1| Peptidase M23 [Sideroxydans lithotrophicus ES-1]
          Length = 280

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           MV+Y  +   E GN + I H + +VT Y+H     V+ GQ V RG  I LSG +G +  P
Sbjct: 198 MVVY-ADAHPEYGNMVEIDHGNQVVTRYAHASKLLVKVGQMVKRGQEIALSGSTGRSTGP 256

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +HFE+R   IA +P++FLE+
Sbjct: 257 HLHFEVRYKGIAQNPVRFLEK 277


>gi|148553563|ref|YP_001261145.1| peptidase M23B [Sphingomonas wittichii RW1]
 gi|148498753|gb|ABQ67007.1| peptidase M23B [Sphingomonas wittichii RW1]
          Length = 394

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 48/82 (58%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V YVG D+   G  +L+RH D  ++ Y + D+  V +GQKV +G TI  SG S     P
Sbjct: 312 VVAYVGQDIPAYGTLVLLRHGDGWISAYGYADSITVTRGQKVVKGQTIAKSGSSPYTPEP 371

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
           Q+HFE+R     ++P+ +L  +
Sbjct: 372 QLHFEIRSGLKPVNPLSYLPSR 393


>gi|301327263|ref|ZP_07220519.1| peptidase, M23 family [Escherichia coli MS 78-1]
 gi|300846126|gb|EFK73886.1| peptidase, M23 family [Escherichia coli MS 78-1]
          Length = 116

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V KGQ V  G  I   G S +A   +
Sbjct: 31  VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNKGQSVKAGQKIATMG-STDAASVR 89

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 90  LHFQIRYRATAIDPLRYL 107


>gi|237729828|ref|ZP_04560309.1| lipoprotein YgeR [Citrobacter sp. 30_2]
 gi|226908434|gb|EEH94352.1| lipoprotein YgeR [Citrobacter sp. 30_2]
          Length = 258

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 173 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQNVKAGQKIATMGSS-DATTVR 231

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 232 LHFQIRYRATAIDPLRYL 249


>gi|218701574|ref|YP_002409203.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli IAI39]
 gi|218706372|ref|YP_002413891.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli UMN026]
 gi|218371560|emb|CAR19399.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli IAI39]
 gi|218433469|emb|CAR14372.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli UMN026]
          Length = 258

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 173 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 231

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 232 LHFQIRYRATAIDPLRYL 249


>gi|260599228|ref|YP_003211799.1| lipoprotein YgeR [Cronobacter turicensis z3032]
 gi|260218405|emb|CBA33487.1| Uncharacterized lipoprotein ygeR [Cronobacter turicensis z3032]
          Length = 230

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ+V  G  I   G +G +    
Sbjct: 145 VVYVGNQLRGYGNLIMIKHNEEYITAYAHNDTMLVNNGQQVKAGQKIATMGSTG-SDSVG 203

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF+LR  A A+DP+++L
Sbjct: 204 LHFQLRYRATAIDPLRYL 221


>gi|254037908|ref|ZP_04871966.1| peptidase [Escherichia sp. 1_1_43]
 gi|887815|gb|AAA83046.1| UUG start [Escherichia coli]
 gi|226839532|gb|EEH71553.1| peptidase [Escherichia sp. 1_1_43]
          Length = 259

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 174 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 232

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 233 LHFQIRYRATAIDPLRYL 250


>gi|24114136|ref|NP_708646.1| putative lipoprotein [Shigella flexneri 2a str. 301]
 gi|30064194|ref|NP_838365.1| putative lipoprotein [Shigella flexneri 2a str. 2457T]
 gi|24053275|gb|AAN44353.1| putative lipoprotein [Shigella flexneri 2a str. 301]
 gi|30042451|gb|AAP18175.1| putative lipoprotein [Shigella flexneri 2a str. 2457T]
 gi|281602211|gb|ADA75195.1| putative lipoprotein [Shigella flexneri 2002017]
          Length = 259

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 174 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 232

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 233 LHFQIRYRATAIDPLRYL 250


>gi|82545505|ref|YP_409452.1| lipoprotein [Shigella boydii Sb227]
 gi|81246916|gb|ABB67624.1| putative lipoprotein [Shigella boydii Sb227]
          Length = 259

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 174 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKTGQKIATMG-STDAASVR 232

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 233 LHFQIRYRATAIDPLRYL 250


>gi|26249278|ref|NP_755318.1| lipoprotein ygeR [Escherichia coli CFT073]
 gi|91212243|ref|YP_542229.1| lipoprotein YgeR [Escherichia coli UTI89]
 gi|194433035|ref|ZP_03065318.1| peptidase, M23B family [Shigella dysenteriae 1012]
 gi|237706492|ref|ZP_04536973.1| lipoprotein ygeR [Escherichia sp. 3_2_53FAA]
 gi|332280450|ref|ZP_08392863.1| lipoprotein ygeR [Shigella sp. D9]
 gi|26109685|gb|AAN81888.1|AE016765_290 Hypothetical lipoprotein ygeR precursor [Escherichia coli CFT073]
 gi|13363210|dbj|BAB37161.1| putative lipoprotein [Escherichia coli O157:H7 str. Sakai]
 gi|91073817|gb|ABE08698.1| hypothetical lipoprotein YgeR precursor [Escherichia coli UTI89]
 gi|194418762|gb|EDX34848.1| peptidase, M23B family [Shigella dysenteriae 1012]
 gi|226899532|gb|EEH85791.1| lipoprotein ygeR [Escherichia sp. 3_2_53FAA]
 gi|332102802|gb|EGJ06148.1| lipoprotein ygeR [Shigella sp. D9]
          Length = 259

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 174 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 232

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 233 LHFQIRYRATAIDPLRYL 250


>gi|302389316|ref|YP_003825137.1| Peptidase M23 [Thermosediminibacter oceani DSM 16646]
 gi|302199944|gb|ADL07514.1| Peptidase M23 [Thermosediminibacter oceani DSM 16646]
          Length = 237

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 49/75 (65%), Gaps = 2/75 (2%)

Query: 10  VELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN 69
            E+G  I IRH+  +VT+Y+H+   YV+ G KV +G  IG  GK+G A++P +HFE+ + 
Sbjct: 162 AEMGRLIKIRHEGDLVTLYAHLKDVYVKAGDKVRKGQIIGTVGKTGLAENPHLHFEVWEK 221

Query: 70  AIAMDPIKFLEEKIP 84
             A DP +++  KIP
Sbjct: 222 GAATDPERWI--KIP 234


>gi|156932660|ref|YP_001436576.1| hypothetical protein ESA_00443 [Cronobacter sakazakii ATCC BAA-894]
 gi|156530914|gb|ABU75740.1| hypothetical protein ESA_00443 [Cronobacter sakazakii ATCC BAA-894]
          Length = 116

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 3/85 (3%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ+V  G  I   G +G +    
Sbjct: 31  VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQQVKAGQKIATMGSTG-SDSVG 89

Query: 62  VHFELRKNAIAMDPIKFL--EEKIP 84
           +HF+LR  A A+DP+++L  + K P
Sbjct: 90  LHFQLRYRATAIDPLRYLPPQGKAP 114


>gi|149926952|ref|ZP_01915211.1| peptidase M23B [Limnobacter sp. MED105]
 gi|149824504|gb|EDM83722.1| peptidase M23B [Limnobacter sp. MED105]
          Length = 273

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 55/81 (67%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++HD++++T Y+H  T  V++G+ V++G  I  +G+S ++  P+
Sbjct: 194 VVYSGNALRGYGNLIILKHDNNLLTAYAHNKTLLVKEGEPVTKGQKIAEAGQS-DSDRPK 252

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK    +DP+ +L  +
Sbjct: 253 LHFEVRKQGKPVDPMDYLPAR 273


>gi|218690991|ref|YP_002399203.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli ED1a]
 gi|218428555|emb|CAR09336.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli ED1a]
          Length = 251

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-SADAASVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|197263739|ref|ZP_03163813.1| YgeR [Salmonella enterica subsp. enterica serovar Saintpaul str.
           SARA23]
 gi|205358044|ref|ZP_02575192.2| YgeR [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|197241994|gb|EDY24614.1| YgeR [Salmonella enterica subsp. enterica serovar Saintpaul str.
           SARA23]
 gi|205327988|gb|EDZ14752.1| YgeR [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|321225712|gb|EFX50766.1| Uncharacterized lipoprotein YgeR precursor [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
          Length = 250

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 165 VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 223

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 224 LHFQIRYRATAIDPLRYL 241


>gi|213161323|ref|ZP_03347033.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
          Length = 252

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 167 VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 225

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 226 LHFQIRYRATAIDPLRYL 243


>gi|238909837|ref|ZP_04653674.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 252

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 167 VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 225

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 226 LHFQIRYRATAIDPLRYL 243


>gi|16766339|ref|NP_461954.1| metalloendopeptidase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16421588|gb|AAL21913.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|261248170|emb|CBG26006.1| possible lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267995191|gb|ACY90076.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301159594|emb|CBW19113.1| possible lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312914059|dbj|BAJ38033.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|323131394|gb|ADX18824.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332989905|gb|AEF08888.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 252

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 167 VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 225

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 226 LHFQIRYRATAIDPLRYL 243


>gi|16761819|ref|NP_457436.1| lipoprotein [Salmonella enterica subsp. enterica serovar Typhi str.
           CT18]
 gi|29143306|ref|NP_806648.1| lipoprotein [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|56414984|ref|YP_152059.1| lipoprotein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. ATCC 9150]
 gi|194442369|ref|YP_002042290.1| hypothetical protein SNSL254_A3272 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194470961|ref|ZP_03076945.1| YgeR [Salmonella enterica subsp. enterica serovar Kentucky str.
           CVM29188]
 gi|194471050|ref|ZP_03077034.1| YgeR [Salmonella enterica subsp. enterica serovar Kentucky str.
           CVM29188]
 gi|194737641|ref|YP_002115988.1| YgeR [Salmonella enterica subsp. enterica serovar Schwarzengrund
           str. CVM19633]
 gi|197300790|ref|ZP_02661154.2| YgeR [Salmonella enterica subsp. enterica serovar Schwarzengrund
           str. SL480]
 gi|197363913|ref|YP_002143550.1| lipoprotein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. AKU_12601]
 gi|198242995|ref|YP_002217015.1| hypothetical protein SeD_A3373 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200389074|ref|ZP_03215686.1| YgeR [Salmonella enterica subsp. enterica serovar Virchow str.
           SL491]
 gi|204928288|ref|ZP_03219488.1| YgeR [Salmonella enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205356998|ref|ZP_02343836.2| YgeR [Salmonella enterica subsp. enterica serovar Saintpaul str.
           SARA29]
 gi|205358427|ref|ZP_02656200.2| YgeR [Salmonella enterica subsp. enterica serovar Kentucky str. CDC
           191]
 gi|205360513|ref|ZP_02683774.2| YgeR [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|25316604|pir||AD0871 probable lipoprotein [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16504121|emb|CAD02868.1| possible lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29138940|gb|AAO70508.1| possible lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|56129241|gb|AAV78747.1| possible lipoprotein [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|194401032|gb|ACF61254.1| YgeR [Salmonella enterica subsp. enterica serovar Newport str.
           SL254]
 gi|194457325|gb|EDX46164.1| YgeR [Salmonella enterica subsp. enterica serovar Kentucky str.
           CVM29188]
 gi|194457414|gb|EDX46253.1| YgeR [Salmonella enterica subsp. enterica serovar Kentucky str.
           CVM29188]
 gi|194713143|gb|ACF92364.1| YgeR [Salmonella enterica subsp. enterica serovar Schwarzengrund
           str. CVM19633]
 gi|197095390|emb|CAR60949.1| possible lipoprotein [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|197290775|gb|EDY30129.1| YgeR [Salmonella enterica subsp. enterica serovar Schwarzengrund
           str. SL480]
 gi|197937511|gb|ACH74844.1| YgeR [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199606172|gb|EDZ04717.1| YgeR [Salmonella enterica subsp. enterica serovar Virchow str.
           SL491]
 gi|204322610|gb|EDZ07807.1| YgeR [Salmonella enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205324799|gb|EDZ12638.1| YgeR [Salmonella enterica subsp. enterica serovar Saintpaul str.
           SARA29]
 gi|205334583|gb|EDZ21347.1| YgeR [Salmonella enterica subsp. enterica serovar Kentucky str. CDC
           191]
 gi|205349221|gb|EDZ35852.1| YgeR [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
          Length = 250

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 165 VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 223

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 224 LHFQIRYRATAIDPLRYL 241


>gi|320087467|emb|CBY97232.1| Outer membrane antigenic lipoprotein B Flags: Precursor; Fragment
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|322613436|gb|EFY10377.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322621028|gb|EFY17886.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322624092|gb|EFY20926.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322628169|gb|EFY24958.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322633288|gb|EFY30030.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322636134|gb|EFY32842.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322639473|gb|EFY36161.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647595|gb|EFY44084.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322648779|gb|EFY45226.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653834|gb|EFY50160.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322657940|gb|EFY54208.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664043|gb|EFY60242.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322668946|gb|EFY65097.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322673060|gb|EFY69167.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322677949|gb|EFY74012.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681125|gb|EFY77158.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322687945|gb|EFY83912.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323194859|gb|EFZ80046.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196610|gb|EFZ81758.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202690|gb|EFZ87730.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207823|gb|EFZ92769.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323212625|gb|EFZ97442.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323214892|gb|EFZ99640.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323222623|gb|EGA06988.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323225098|gb|EGA09350.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323230620|gb|EGA14738.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235029|gb|EGA19115.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323239068|gb|EGA23118.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244574|gb|EGA28580.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323247189|gb|EGA31155.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323253328|gb|EGA37157.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256365|gb|EGA40101.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262459|gb|EGA46015.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323267445|gb|EGA50929.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269151|gb|EGA52606.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 252

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 167 VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 225

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 226 LHFQIRYRATAIDPLRYL 243


>gi|205360174|ref|ZP_02835072.2| YgeR [Salmonella enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205340618|gb|EDZ27382.1| YgeR [Salmonella enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
          Length = 250

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 165 VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 223

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 224 LHFQIRYRATAIDPLRYL 241


>gi|213425817|ref|ZP_03358567.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
          Length = 252

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 167 VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 225

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 226 LHFQIRYRATAIDPLRYL 243


>gi|161615984|ref|YP_001589949.1| hypothetical protein SPAB_03784 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161365348|gb|ABX69116.1| hypothetical protein SPAB_03784 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 250

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 165 VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 223

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 224 LHFQIRYRATAIDPLRYL 241


>gi|62181548|ref|YP_217965.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|205353962|ref|YP_002227763.1| lipoprotein [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|207858301|ref|YP_002244952.1| lipoprotein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|213417497|ref|ZP_03350639.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213586001|ref|ZP_03367827.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213616406|ref|ZP_03372232.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213646958|ref|ZP_03377011.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|224584827|ref|YP_002638625.1| lipoprotein [Salmonella enterica subsp. enterica serovar Paratyphi
           C strain RKS4594]
 gi|62129181|gb|AAX66884.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|205273743|emb|CAR38738.1| possible lipoprotein [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|206710104|emb|CAR34459.1| possible lipoprotein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|224469354|gb|ACN47184.1| possible lipoprotein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|322716029|gb|EFZ07600.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|326624782|gb|EGE31127.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326629076|gb|EGE35419.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 252

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 167 VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 225

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 226 LHFQIRYRATAIDPLRYL 243


>gi|197249741|ref|YP_002147950.1| LysM domain/M23 peptidase domain-containing protein [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197213444|gb|ACH50841.1| LysM domain/M23 peptidase domain protein [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
          Length = 250

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 165 VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 223

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 224 LHFQIRYRATAIDPLRYL 241


>gi|195873619|ref|ZP_02697712.2| LysM domain/M23 peptidase domain protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|195633614|gb|EDX52028.1| LysM domain/M23 peptidase domain protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
          Length = 250

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 165 VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 223

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 224 LHFQIRYRATAIDPLRYL 241


>gi|30961860|gb|AAP40015.1| putative lipoprotein [Citrobacter freundii]
          Length = 252

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 167 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQNVKAGQKIATMGSS-DATTVR 225

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 226 LHFQIRYRATAIDPLRYL 243


>gi|297521663|ref|ZP_06940049.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli OP50]
          Length = 116

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 31  VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-SADAASVR 89

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 90  LHFQIRYRATAIDPLRYL 107


>gi|194448081|ref|YP_002047022.1| hypothetical protein SeHA_C3268 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|205359175|ref|ZP_02667756.2| YgeR [Salmonella enterica subsp. enterica serovar Heidelberg str.
           SL486]
 gi|194406385|gb|ACF66604.1| YgeR [Salmonella enterica subsp. enterica serovar Heidelberg str.
           SL476]
 gi|205338155|gb|EDZ24919.1| YgeR [Salmonella enterica subsp. enterica serovar Heidelberg str.
           SL486]
          Length = 250

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 165 VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 223

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 224 LHFQIRYRATAIDPLRYL 241


>gi|213854956|ref|ZP_03383196.1| putative metalloendopeptidase [Salmonella enterica subsp.
          enterica serovar Typhi str. M223]
          Length = 100

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2  VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
          V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 15 VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 73

Query: 62 VHFELRKNAIAMDPIKFL 79
          +HF++R  A A+DP+++L
Sbjct: 74 LHFQIRYRATAIDPLRYL 91


>gi|213022358|ref|ZP_03336805.1| putative metalloendopeptidase [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
          Length = 172

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 87  VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 145

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 146 LHFQIRYRATAIDPLRYL 163


>gi|161506414|ref|YP_001573526.1| hypothetical protein SARI_04612 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867761|gb|ABX24384.1| hypothetical protein SARI_04612 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 131

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 46  VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 104

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 105 LHFQIRYRATAIDPLRYL 122


>gi|160947220|ref|ZP_02094387.1| hypothetical protein PEPMIC_01153 [Parvimonas micra ATCC 33270]
 gi|158446354|gb|EDP23349.1| hypothetical protein PEPMIC_01153 [Parvimonas micra ATCC 33270]
          Length = 398

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (68%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I++ ++IV VY H  +  V+ GQ+VS+G  I L G +GN+  P +HFE+R N   
Sbjct: 330 GNAVMIKYTNNIVIVYGHNSSLIVRAGQRVSKGQVISLVGSTGNSTGPHLHFEVRYNGYP 389

Query: 73  MDPIKFL 79
           +DP+K+L
Sbjct: 390 VDPLKYL 396


>gi|283835353|ref|ZP_06355094.1| YgeR protein [Citrobacter youngae ATCC 29220]
 gi|291068518|gb|EFE06627.1| YgeR protein [Citrobacter youngae ATCC 29220]
          Length = 263

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 178 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQNVKAGQKIATMG-STDATTVR 236

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 237 LHFQIRYRATAIDPLRYL 254


>gi|148653553|ref|YP_001280646.1| peptidase M23B [Psychrobacter sp. PRwf-1]
 gi|148572637|gb|ABQ94696.1| peptidase M23B [Psychrobacter sp. PRwf-1]
          Length = 272

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 44/74 (59%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L E GN I+IRHDD  +TVY+H +   V++G +V  G  I   G SG      
Sbjct: 193 VLYAGNGLPEYGNLIMIRHDDRYITVYAHNNELLVKEGDQVQAGQRIATMGNSGQTNQIG 252

Query: 62  VHFELRKNAIAMDP 75
           + F++R+N   +DP
Sbjct: 253 LQFQVRENGTPIDP 266


>gi|270264885|ref|ZP_06193149.1| hypothetical protein SOD_j01000 [Serratia odorifera 4Rx13]
 gi|270041183|gb|EFA14283.1| hypothetical protein SOD_j01000 [Serratia odorifera 4Rx13]
          Length = 251

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V+ GQ V  G  IG  G +G      
Sbjct: 166 VVYVGNQLRGYGNLIMIKHGEDFITAYAHNDTTLVRNGQDVKAGQKIGTMGSTGT-DSVF 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP ++L
Sbjct: 225 LHFQIRYRATALDPQRYL 242


>gi|170683156|ref|YP_001745018.1| M23B family peptidase [Escherichia coli SMS-3-5]
 gi|170520874|gb|ACB19052.1| peptidase, M23B family [Escherichia coli SMS-3-5]
          Length = 250

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 165 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 223

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 224 LHFQIRYRATAIDPLRYL 241


>gi|283788454|ref|YP_003368319.1| cell wall degradation protein [Citrobacter rodentium ICC168]
 gi|282951908|emb|CBG91626.1| putative cell wall degradation protein [Citrobacter rodentium
           ICC168]
          Length = 249

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 164 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 222

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 223 LHFQIRYRATAIDPLRYL 240


>gi|323978843|gb|EGB73924.1| peptidase M23 [Escherichia coli TW10509]
          Length = 251

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|331674352|ref|ZP_08375112.1| YgeR [Escherichia coli TA280]
 gi|284922815|emb|CBG35903.1| putative cell wall degradation protein [Escherichia coli 042]
 gi|331068446|gb|EGI39841.1| YgeR [Escherichia coli TA280]
          Length = 251

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|89109645|ref|AP_003425.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli str. K-12 substr. W3110]
 gi|90111503|ref|NP_417341.4| novel lipoprotein, function unknown [Escherichia coli str. K-12
           substr. MG1655]
 gi|157162326|ref|YP_001459644.1| M23B family peptidase [Escherichia coli HS]
 gi|170082428|ref|YP_001731748.1| TPR repeat-containing transcriptional regulator [Escherichia coli
           str. K-12 substr. DH10B]
 gi|194436890|ref|ZP_03068990.1| peptidase, M23B family [Escherichia coli 101-1]
 gi|238901991|ref|YP_002927787.1| tetratricopeptide repeat transcriptional regulator [Escherichia
           coli BW2952]
 gi|253772294|ref|YP_003035125.1| peptidase M23 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254162778|ref|YP_003045886.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli B str. REL606]
 gi|256024625|ref|ZP_05438490.1| Tetratricopeptide repeat transcriptional regulator [Escherichia sp.
           4_1_40B]
 gi|301027840|ref|ZP_07191144.1| peptidase, M23 family [Escherichia coli MS 196-1]
 gi|307139552|ref|ZP_07498908.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli H736]
 gi|331643554|ref|ZP_08344685.1| YgeR [Escherichia coli H736]
 gi|20140975|sp|Q46798|YGER_ECOLI RecName: Full=Uncharacterized lipoprotein ygeR; Flags: Precursor
 gi|85675678|dbj|BAE76931.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli str. K12 substr. W3110]
 gi|87082174|gb|AAC75903.2| novel lipoprotein, function unknown [Escherichia coli str. K-12
           substr. MG1655]
 gi|157068006|gb|ABV07261.1| peptidase, M23B family [Escherichia coli HS]
 gi|169890263|gb|ACB03970.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli str. K-12 substr. DH10B]
 gi|194424372|gb|EDX40359.1| peptidase, M23B family [Escherichia coli 101-1]
 gi|238863631|gb|ACR65629.1| tetratricopeptide repeat transcriptional regulator [Escherichia
           coli BW2952]
 gi|242378398|emb|CAQ33177.1| putative lipoprotein; predicted DNA-binding transcriptional
           regulator [Escherichia coli BL21(DE3)]
 gi|253323338|gb|ACT27940.1| Peptidase M23 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974679|gb|ACT40350.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli B str. REL606]
 gi|253978845|gb|ACT44515.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli BL21(DE3)]
 gi|260448089|gb|ACX38511.1| Peptidase M23 [Escherichia coli DH1]
 gi|299879058|gb|EFI87269.1| peptidase, M23 family [Escherichia coli MS 196-1]
 gi|309703226|emb|CBJ02561.1| putative cell wall degradation protein [Escherichia coli ETEC
           H10407]
 gi|315137465|dbj|BAJ44624.1| peptidase [Escherichia coli DH1]
 gi|315614980|gb|EFU95618.1| lipoprotein nlpD [Escherichia coli 3431]
 gi|323935905|gb|EGB32204.1| peptidase M23 [Escherichia coli E1520]
 gi|323941614|gb|EGB37794.1| peptidase M23 [Escherichia coli E482]
 gi|323960747|gb|EGB56369.1| peptidase M23 [Escherichia coli H489]
 gi|323971699|gb|EGB66928.1| peptidase M23 [Escherichia coli TA007]
 gi|331037025|gb|EGI09249.1| YgeR [Escherichia coli H736]
          Length = 251

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|170018888|ref|YP_001723842.1| peptidase M23B [Escherichia coli ATCC 8739]
 gi|169753816|gb|ACA76515.1| peptidase M23B [Escherichia coli ATCC 8739]
          Length = 251

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|157148424|ref|YP_001455743.1| hypothetical protein CKO_04249 [Citrobacter koseri ATCC BAA-895]
 gi|157085629|gb|ABV15307.1| hypothetical protein CKO_04249 [Citrobacter koseri ATCC BAA-895]
          Length = 116

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H++  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 31  VVYVGNQLRGYGNLIMIKHNEDYITAYAHNDTLLVNNGQSVKAGQKIATMG-STDADSVR 89

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 90  LHFQIRYRATAIDPLRYL 107


>gi|323966666|gb|EGB62098.1| peptidase M23 [Escherichia coli M863]
 gi|327251627|gb|EGE63313.1| lipoprotein nlpD [Escherichia coli STEC_7v]
          Length = 251

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|293406364|ref|ZP_06650290.1| lipoprotein YgeR [Escherichia coli FVEC1412]
 gi|298382100|ref|ZP_06991697.1| lipoprotein YgeR [Escherichia coli FVEC1302]
 gi|331684490|ref|ZP_08385082.1| YgeR [Escherichia coli H299]
 gi|291426370|gb|EFE99402.1| lipoprotein YgeR [Escherichia coli FVEC1412]
 gi|298277240|gb|EFI18756.1| lipoprotein YgeR [Escherichia coli FVEC1302]
 gi|331078105|gb|EGI49311.1| YgeR [Escherichia coli H299]
          Length = 250

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 165 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 223

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 224 LHFQIRYRATAIDPLRYL 241


>gi|293416119|ref|ZP_06658759.1| ygeR lipoprotein YgeR [Escherichia coli B185]
 gi|291432308|gb|EFF05290.1| ygeR lipoprotein YgeR [Escherichia coli B185]
          Length = 251

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|331664437|ref|ZP_08365343.1| YgeR [Escherichia coli TA143]
 gi|331058368|gb|EGI30349.1| YgeR [Escherichia coli TA143]
          Length = 207

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 122 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 180

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 181 LHFQIRYRATAIDPLRYL 198


>gi|238783250|ref|ZP_04627275.1| Uncharacterized lipoprotein ygeR [Yersinia bercovieri ATCC 43970]
 gi|238715843|gb|EEQ07830.1| Uncharacterized lipoprotein ygeR [Yersinia bercovieri ATCC 43970]
          Length = 231

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V+  Q VS G  I   G SG      
Sbjct: 146 VVYVGNQLRGYGNLIMIKHGNDFITAYAHNDTMLVKNAQDVSAGQKIATMGSSGT-DTLM 204

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 205 LHFQIRYRATALDPLRYL 222


>gi|320175996|gb|EFW51067.1| Uncharacterized lipoprotein YgeR precursor [Shigella dysenteriae
           CDC 74-1112]
 gi|320185351|gb|EFW60122.1| Uncharacterized lipoprotein YgeR precursor [Shigella flexneri CDC
           796-83]
 gi|332090960|gb|EGI96051.1| lipoprotein nlpD [Shigella boydii 3594-74]
          Length = 251

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKTGQKIATMG-STDAASVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|333000480|gb|EGK20061.1| lipoprotein nlpD [Shigella flexneri K-272]
          Length = 251

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKTGQKIATMG-STDAASVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|293412223|ref|ZP_06654946.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291468994|gb|EFF11485.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 251

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|110806784|ref|YP_690304.1| putative lipoprotein [Shigella flexneri 5 str. 8401]
 gi|110616332|gb|ABF04999.1| putative lipoprotein [Shigella flexneri 5 str. 8401]
 gi|313647918|gb|EFS12364.1| lipoprotein nlpD [Shigella flexneri 2a str. 2457T]
 gi|332753572|gb|EGJ83952.1| lipoprotein nlpD [Shigella flexneri 4343-70]
 gi|332753713|gb|EGJ84092.1| lipoprotein nlpD [Shigella flexneri K-671]
 gi|332754640|gb|EGJ85006.1| lipoprotein nlpD [Shigella flexneri 2747-71]
 gi|332765810|gb|EGJ96023.1| nlpD putative outer membrane lipoprotein [Shigella flexneri
           2930-71]
 gi|332999615|gb|EGK19200.1| lipoprotein nlpD [Shigella flexneri VA-6]
 gi|332999957|gb|EGK19540.1| lipoprotein nlpD [Shigella flexneri K-218]
 gi|333015127|gb|EGK34470.1| lipoprotein nlpD [Shigella flexneri K-304]
          Length = 251

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|38704123|ref|NP_311765.2| lipoprotein [Escherichia coli O157:H7 str. Sakai]
 gi|74313424|ref|YP_311843.1| putative lipoprotein [Shigella sonnei Ss046]
 gi|110643014|ref|YP_670744.1| putative metalloendopeptidase [Escherichia coli 536]
 gi|168747658|ref|ZP_02772680.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4113]
 gi|168753802|ref|ZP_02778809.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4401]
 gi|168759992|ref|ZP_02784999.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4501]
 gi|168766857|ref|ZP_02791864.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4486]
 gi|168775741|ref|ZP_02800748.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4196]
 gi|168778877|ref|ZP_02803884.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4076]
 gi|168785710|ref|ZP_02810717.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC869]
 gi|168799997|ref|ZP_02825004.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC508]
 gi|187730251|ref|YP_001881656.1| peptidase, M23B family [Shigella boydii CDC 3083-94]
 gi|188492431|ref|ZP_02999701.1| peptidase, M23B family [Escherichia coli 53638]
 gi|191166019|ref|ZP_03027855.1| peptidase, M23B family [Escherichia coli B7A]
 gi|191173255|ref|ZP_03034786.1| peptidase, M23B family [Escherichia coli F11]
 gi|193063596|ref|ZP_03044685.1| peptidase, M23B family [Escherichia coli E22]
 gi|193070562|ref|ZP_03051501.1| peptidase, M23B family [Escherichia coli E110019]
 gi|194426500|ref|ZP_03059055.1| peptidase, M23B family [Escherichia coli B171]
 gi|195936482|ref|ZP_03081864.1| TPR repeat-containing transcriptional regulator [Escherichia coli
           O157:H7 str. EC4024]
 gi|208805657|ref|ZP_03247994.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4206]
 gi|208813062|ref|ZP_03254391.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4045]
 gi|208820365|ref|ZP_03260685.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4042]
 gi|209398939|ref|YP_002272340.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4115]
 gi|209920320|ref|YP_002294404.1| putative lipoprotein [Escherichia coli SE11]
 gi|215488166|ref|YP_002330597.1| tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O127:H6 str. E2348/69]
 gi|217327665|ref|ZP_03443748.1| peptidase, M23B family [Escherichia coli O157:H7 str. TW14588]
 gi|218555413|ref|YP_002388326.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli IAI1]
 gi|218559858|ref|YP_002392771.1| transcriptional regulator [Escherichia coli S88]
 gi|218696461|ref|YP_002404128.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli 55989]
 gi|227888413|ref|ZP_04006218.1| lipoprotein ygeR precursor [Escherichia coli 83972]
 gi|254794817|ref|YP_003079654.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O157:H7 str. TW14359]
 gi|256019337|ref|ZP_05433202.1| Tetratricopeptide repeat transcriptional regulator [Shigella sp.
           D9]
 gi|260845533|ref|YP_003223311.1| tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O103:H2 str. 12009]
 gi|260856988|ref|YP_003230879.1| tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O26:H11 str. 11368]
 gi|260869542|ref|YP_003235944.1| tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O111:H- str. 11128]
 gi|261226177|ref|ZP_05940458.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O157:H7 str. FRIK2000]
 gi|261256567|ref|ZP_05949100.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O157:H7 str. FRIK966]
 gi|291284186|ref|YP_003501004.1| hypothetical protein G2583_3519 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293449188|ref|ZP_06663609.1| ygeR [Escherichia coli B088]
 gi|306812233|ref|ZP_07446431.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli NC101]
 gi|307310516|ref|ZP_07590164.1| Peptidase M23 [Escherichia coli W]
 gi|312964876|ref|ZP_07779116.1| lipoprotein nlpD [Escherichia coli 2362-75]
 gi|331648610|ref|ZP_08349698.1| YgeR [Escherichia coli M605]
 gi|331654362|ref|ZP_08355362.1| YgeR [Escherichia coli M718]
 gi|331669599|ref|ZP_08370445.1| YgeR [Escherichia coli TA271]
 gi|331678850|ref|ZP_08379524.1| YgeR [Escherichia coli H591]
 gi|73856901|gb|AAZ89608.1| putative lipoprotein [Shigella sonnei Ss046]
 gi|110344606|gb|ABG70843.1| putative metalloendopeptidase [Escherichia coli 536]
 gi|187427243|gb|ACD06517.1| peptidase, M23B family [Shigella boydii CDC 3083-94]
 gi|187768741|gb|EDU32585.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4196]
 gi|188017829|gb|EDU55951.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4113]
 gi|188487630|gb|EDU62733.1| peptidase, M23B family [Escherichia coli 53638]
 gi|189003413|gb|EDU72399.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4076]
 gi|189358666|gb|EDU77085.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4401]
 gi|189363854|gb|EDU82273.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4486]
 gi|189369368|gb|EDU87784.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4501]
 gi|189374173|gb|EDU92589.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC869]
 gi|189377673|gb|EDU96089.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC508]
 gi|190903967|gb|EDV63680.1| peptidase, M23B family [Escherichia coli B7A]
 gi|190906506|gb|EDV66114.1| peptidase, M23B family [Escherichia coli F11]
 gi|192930873|gb|EDV83478.1| peptidase, M23B family [Escherichia coli E22]
 gi|192956145|gb|EDV86609.1| peptidase, M23B family [Escherichia coli E110019]
 gi|194415808|gb|EDX32075.1| peptidase, M23B family [Escherichia coli B171]
 gi|208725458|gb|EDZ75059.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4206]
 gi|208734339|gb|EDZ83026.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4045]
 gi|208740488|gb|EDZ88170.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4042]
 gi|209160339|gb|ACI37772.1| peptidase, M23B family [Escherichia coli O157:H7 str. EC4115]
 gi|209913579|dbj|BAG78653.1| putative lipoprotein [Escherichia coli SE11]
 gi|215266238|emb|CAS10665.1| tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O127:H6 str. E2348/69]
 gi|217320032|gb|EEC28457.1| peptidase, M23B family [Escherichia coli O157:H7 str. TW14588]
 gi|218353193|emb|CAU99092.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli 55989]
 gi|218362181|emb|CAQ99799.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli IAI1]
 gi|218366627|emb|CAR04381.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli S88]
 gi|222034561|emb|CAP77303.1| Uncharacterized lipoprotein ygeR [Escherichia coli LF82]
 gi|227834682|gb|EEJ45148.1| lipoprotein ygeR precursor [Escherichia coli 83972]
 gi|254594217|gb|ACT73578.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O157:H7 str. TW14359]
 gi|257755637|dbj|BAI27139.1| tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O26:H11 str. 11368]
 gi|257760680|dbj|BAI32177.1| tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O103:H2 str. 12009]
 gi|257765898|dbj|BAI37393.1| tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O111:H- str. 11128]
 gi|281179871|dbj|BAI56201.1| putative lipoprotein [Escherichia coli SE15]
 gi|290764059|gb|ADD58020.1| Hypothetical lipoprotein YgeR [Escherichia coli O55:H7 str. CB9615]
 gi|291322278|gb|EFE61707.1| ygeR [Escherichia coli B088]
 gi|294492725|gb|ADE91481.1| peptidase, M23B family [Escherichia coli IHE3034]
 gi|305854271|gb|EFM54709.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli NC101]
 gi|306909411|gb|EFN39906.1| Peptidase M23 [Escherichia coli W]
 gi|307554842|gb|ADN47617.1| peptidase [Escherichia coli ABU 83972]
 gi|307625562|gb|ADN69866.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli UM146]
 gi|312290432|gb|EFR18312.1| lipoprotein nlpD [Escherichia coli 2362-75]
 gi|312947398|gb|ADR28225.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O83:H1 str. NRG 857C]
 gi|315062169|gb|ADT76496.1| tetratricopeptide repeat transcriptional regulator [Escherichia
           coli W]
 gi|320182240|gb|EFW57143.1| Uncharacterized lipoprotein YgeR precursor [Shigella boydii ATCC
           9905]
 gi|320189208|gb|EFW63867.1| Uncharacterized lipoprotein YgeR precursor [Escherichia coli
           O157:H7 str. EC1212]
 gi|320194983|gb|EFW69612.1| Uncharacterized lipoprotein YgeR precursor [Escherichia coli
           WV_060327]
 gi|320202523|gb|EFW77093.1| Uncharacterized lipoprotein YgeR precursor [Escherichia coli
           EC4100B]
 gi|320640508|gb|EFX10047.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O157:H7 str. G5101]
 gi|320645755|gb|EFX14740.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O157:H- str. 493-89]
 gi|320651055|gb|EFX19495.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O157:H- str. H 2687]
 gi|320656551|gb|EFX24447.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O55:H7 str. 3256-97 TW 07815]
 gi|320662070|gb|EFX29471.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O55:H7 str. USDA 5905]
 gi|320667146|gb|EFX34109.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           coli O157:H7 str. LSU-61]
 gi|323154743|gb|EFZ40941.1| lipoprotein nlpD [Escherichia coli EPECa14]
 gi|323162545|gb|EFZ48395.1| lipoprotein nlpD [Escherichia coli E128010]
 gi|323183418|gb|EFZ68815.1| lipoprotein nlpD [Escherichia coli 1357]
 gi|323188737|gb|EFZ74022.1| lipoprotein nlpD [Escherichia coli RN587/1]
 gi|323377247|gb|ADX49515.1| Peptidase M23 [Escherichia coli KO11]
 gi|323946649|gb|EGB42672.1| peptidase M23 [Escherichia coli H120]
 gi|323951696|gb|EGB47571.1| peptidase M23 [Escherichia coli H252]
 gi|323957414|gb|EGB53136.1| peptidase M23 [Escherichia coli H263]
 gi|324119905|gb|EGC13784.1| peptidase M23 [Escherichia coli E1167]
 gi|326339051|gb|EGD62866.1| Uncharacterized lipoprotein YgeR precursor [Escherichia coli
           O157:H7 str. 1044]
 gi|326343066|gb|EGD66834.1| Uncharacterized lipoprotein YgeR precursor [Escherichia coli
           O157:H7 str. 1125]
 gi|330908899|gb|EGH37413.1| uncharacterized lipoprotein YgeR precursor [Escherichia coli AA86]
 gi|331042357|gb|EGI14499.1| YgeR [Escherichia coli M605]
 gi|331047744|gb|EGI19821.1| YgeR [Escherichia coli M718]
 gi|331063267|gb|EGI35180.1| YgeR [Escherichia coli TA271]
 gi|331073680|gb|EGI45001.1| YgeR [Escherichia coli H591]
 gi|332088630|gb|EGI93743.1| lipoprotein nlpD [Shigella dysenteriae 155-74]
 gi|332344760|gb|AEE58094.1| lipoprotein NlpD [Escherichia coli UMNK88]
          Length = 251

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|332086782|gb|EGI91918.1| lipoprotein nlpD [Shigella boydii 5216-82]
          Length = 251

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|157158148|ref|YP_001464202.1| M23B family peptidase [Escherichia coli E24377A]
 gi|157080178|gb|ABV19886.1| peptidase, M23B family [Escherichia coli E24377A]
          Length = 251

 Score = 67.8 bits (164), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDATSVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|331658994|ref|ZP_08359936.1| YgeR [Escherichia coli TA206]
 gi|331053576|gb|EGI25605.1| YgeR [Escherichia coli TA206]
          Length = 238

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 153 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 211

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 212 LHFQIRYRATAIDPLRYL 229


>gi|117625098|ref|YP_854086.1| putative lipoportein [Escherichia coli APEC O1]
 gi|115514222|gb|ABJ02297.1| putative lipoportein [Escherichia coli APEC O1]
          Length = 237

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 152 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 210

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 211 LHFQIRYRATAIDPLRYL 228


>gi|312972897|ref|ZP_07787070.1| lipoprotein nlpD [Escherichia coli 1827-70]
 gi|310332839|gb|EFQ00053.1| lipoprotein nlpD [Escherichia coli 1827-70]
          Length = 251

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKDGQKIATMG-STDAASVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|300815686|ref|ZP_07095910.1| peptidase, M23 family [Escherichia coli MS 107-1]
 gi|300820666|ref|ZP_07100817.1| peptidase, M23 family [Escherichia coli MS 119-7]
 gi|300896243|ref|ZP_07114790.1| peptidase, M23 family [Escherichia coli MS 198-1]
 gi|300906588|ref|ZP_07124279.1| peptidase, M23 family [Escherichia coli MS 84-1]
 gi|300921190|ref|ZP_07137566.1| peptidase, M23 family [Escherichia coli MS 115-1]
 gi|300925159|ref|ZP_07141070.1| peptidase, M23 family [Escherichia coli MS 182-1]
 gi|300930729|ref|ZP_07146104.1| peptidase, M23 family [Escherichia coli MS 187-1]
 gi|300936190|ref|ZP_07151126.1| peptidase, M23 family [Escherichia coli MS 21-1]
 gi|300980405|ref|ZP_07174996.1| peptidase, M23 family [Escherichia coli MS 45-1]
 gi|300995753|ref|ZP_07181247.1| peptidase, M23 family [Escherichia coli MS 200-1]
 gi|301027444|ref|ZP_07190781.1| peptidase, M23 family [Escherichia coli MS 69-1]
 gi|301049355|ref|ZP_07196322.1| peptidase, M23 family [Escherichia coli MS 185-1]
 gi|301303020|ref|ZP_07209147.1| peptidase, M23 family [Escherichia coli MS 124-1]
 gi|301643788|ref|ZP_07243825.1| peptidase, M23 family [Escherichia coli MS 146-1]
 gi|309793934|ref|ZP_07688359.1| peptidase, M23 family [Escherichia coli MS 145-7]
 gi|300298862|gb|EFJ55247.1| peptidase, M23 family [Escherichia coli MS 185-1]
 gi|300304732|gb|EFJ59252.1| peptidase, M23 family [Escherichia coli MS 200-1]
 gi|300359864|gb|EFJ75734.1| peptidase, M23 family [Escherichia coli MS 198-1]
 gi|300394952|gb|EFJ78490.1| peptidase, M23 family [Escherichia coli MS 69-1]
 gi|300401627|gb|EFJ85165.1| peptidase, M23 family [Escherichia coli MS 84-1]
 gi|300409268|gb|EFJ92806.1| peptidase, M23 family [Escherichia coli MS 45-1]
 gi|300411876|gb|EFJ95186.1| peptidase, M23 family [Escherichia coli MS 115-1]
 gi|300418699|gb|EFK02010.1| peptidase, M23 family [Escherichia coli MS 182-1]
 gi|300458647|gb|EFK22140.1| peptidase, M23 family [Escherichia coli MS 21-1]
 gi|300461418|gb|EFK24911.1| peptidase, M23 family [Escherichia coli MS 187-1]
 gi|300526930|gb|EFK47999.1| peptidase, M23 family [Escherichia coli MS 119-7]
 gi|300531615|gb|EFK52677.1| peptidase, M23 family [Escherichia coli MS 107-1]
 gi|300841684|gb|EFK69444.1| peptidase, M23 family [Escherichia coli MS 124-1]
 gi|301077821|gb|EFK92627.1| peptidase, M23 family [Escherichia coli MS 146-1]
 gi|308122341|gb|EFO59603.1| peptidase, M23 family [Escherichia coli MS 145-7]
 gi|315256745|gb|EFU36713.1| peptidase, M23 family [Escherichia coli MS 85-1]
 gi|315289409|gb|EFU48804.1| peptidase, M23 family [Escherichia coli MS 110-3]
 gi|315293841|gb|EFU53193.1| peptidase, M23 family [Escherichia coli MS 153-1]
 gi|315295734|gb|EFU55054.1| peptidase, M23 family [Escherichia coli MS 16-3]
 gi|323180308|gb|EFZ65860.1| lipoprotein nlpD domain protein [Escherichia coli 1180]
 gi|324005592|gb|EGB74811.1| peptidase, M23 family [Escherichia coli MS 57-2]
 gi|324011705|gb|EGB80924.1| peptidase, M23 family [Escherichia coli MS 60-1]
 gi|324017303|gb|EGB86522.1| peptidase, M23 family [Escherichia coli MS 117-3]
          Length = 116

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 31  VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVR 89

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 90  LHFQIRYRATAIDPLRYL 107


>gi|119774180|ref|YP_926920.1| lipoprotein NlpD [Shewanella amazonensis SB2B]
 gi|119766680|gb|ABL99250.1| lipoprotein NlpD [Shewanella amazonensis SB2B]
          Length = 296

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 54/81 (66%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H +  ++ Y+H+D   V + Q+VS G T+   G + +A+H  
Sbjct: 217 VVYSGNALRGYGNLVIIKHSEDFLSAYAHLDKILVTEKQRVSAGQTVATMGNT-DAEHVM 275

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R + ++++P+K+L +K
Sbjct: 276 LHFEIRDHGVSVNPLKYLPKK 296


>gi|294083979|ref|YP_003550736.1| peptidase M23B [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663551|gb|ADE38652.1| peptidase M23B [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 328

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 47/74 (63%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VG ++   G  +L++HD  +++ Y+H+D+  V++G  V  G +IG  G++G    PQ
Sbjct: 250 VAFVGTEVKSFGTLVLVKHDGGMISAYAHLDSVTVKEGDIVETGQSIGTVGQTGRVDSPQ 309

Query: 62  VHFELRKNAIAMDP 75
           +HFE+RK    +DP
Sbjct: 310 LHFEIRKARQPIDP 323


>gi|114320977|ref|YP_742660.1| peptidase M23B [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227371|gb|ABI57170.1| peptidase M23B [Alkalilimnicola ehrlichii MLHE-1]
          Length = 264

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 47/81 (58%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+HD   +T Y +     V +G++V RG  I   G    A HP 
Sbjct: 181 VVYSGSALRGYGNLVIIKHDSRYLTAYGYNRRLQVGEGEQVRRGQVIAEMGHGPGADHPG 240

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR++   +DP ++L EK
Sbjct: 241 LHFELRRDGEPVDPTRYLPEK 261


>gi|157368548|ref|YP_001476537.1| peptidase M23B [Serratia proteamaculans 568]
 gi|157320312|gb|ABV39409.1| peptidase M23B [Serratia proteamaculans 568]
          Length = 249

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H+D  ++ Y+H +T  V+  Q+V  G  I   G +G      
Sbjct: 164 VVYVGNQLRGYGNLIMIKHNDEYISAYAHNNTLLVRNAQEVKAGQKIATMGSTG-TDKVM 222

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP++FL
Sbjct: 223 LHFQIRYRATALDPLRFL 240


>gi|225076286|ref|ZP_03719485.1| hypothetical protein NEIFLAOT_01327 [Neisseria flavescens
           NRL30031/H210]
 gi|224952410|gb|EEG33619.1| hypothetical protein NEIFLAOT_01327 [Neisseria flavescens
           NRL30031/H210]
          Length = 234

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIYVG ++   G  ILI H+D  +T Y+H DT  VQK QKV  G  I   G+S ++   +
Sbjct: 154 VIYVGEEVRGYGKLILISHNDYTITAYAHNDTLLVQKDQKVQAGQVIATMGRS-DSDSVK 212

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R N  A+DP+ +L  
Sbjct: 213 LHFEVRLNGKAVDPLPYLTR 232


>gi|168053993|ref|XP_001779418.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162669216|gb|EDQ55808.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 540

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 44/67 (65%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T+ + H +  VT+Y+H D  +VQ GQ V +G  I LSG +G++  P +HFE++K+   
Sbjct: 471 GKTVCMDHGNGFVTLYAHCDNLHVQPGQFVRKGQVIALSGNTGHSTGPHLHFEIQKDGRT 530

Query: 73  MDPIKFL 79
           +DP+ +L
Sbjct: 531 VDPLAYL 537


>gi|332710065|ref|ZP_08430020.1| membrane-bound metallopeptidase [Lyngbya majuscula 3L]
 gi|332351208|gb|EGJ30793.1| membrane-bound metallopeptidase [Lyngbya majuscula 3L]
          Length = 392

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GNT++I H DSI T+Y H     V KG+ V RG+ I   G +G +  P +HFE+RKN   
Sbjct: 326 GNTVIIDHGDSIATLYGHASRILVSKGESVKRGNAIATVGSTGFSTGPHLHFEVRKNGEP 385

Query: 73  MDPIKFL 79
           +DP  +L
Sbjct: 386 VDPTSYL 392


>gi|318605478|emb|CBY26976.1| membrane proteins related to metalloendopeptidases [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 242

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G +G      
Sbjct: 157 VVYVGNQLRGYGNLIMIKHGEDFITAYAHNDTMLVNNGQDVKAGQKIATMGSTGTDTL-M 215

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HF++R  A A+DP+++L  +
Sbjct: 216 LHFQIRYRATALDPLRYLPAQ 236


>gi|123442684|ref|YP_001006661.1| putative lipoprotein [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|122089645|emb|CAL12497.1| putative lipoprotein [Yersinia enterocolitica subsp. enterocolitica
           8081]
          Length = 248

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G +G      
Sbjct: 163 VVYVGNQLRGYGNLIMIKHGEDFITAYAHNDTMLVNNGQDVKAGQKIATMGSTGT-DTLM 221

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 222 LHFQIRYRATALDPLRYL 239


>gi|332161491|ref|YP_004298068.1| putative lipoprotein [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|325665721|gb|ADZ42365.1| putative lipoprotein [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330864006|emb|CBX74086.1| uncharacterized lipoprotein ygeR [Yersinia enterocolitica W22703]
          Length = 231

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G +G      
Sbjct: 146 VVYVGNQLRGYGNLIMIKHGEDFITAYAHNDTMLVNNGQDVKAGQKIATMGSTG-TDTLM 204

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 205 LHFQIRYRATALDPLRYL 222


>gi|269836577|ref|YP_003318805.1| peptidase M23 [Sphaerobacter thermophilus DSM 20745]
 gi|269785840|gb|ACZ37983.1| Peptidase M23 [Sphaerobacter thermophilus DSM 20745]
          Length = 328

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 33/79 (41%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ GN     GN + I+H D  VT+Y+H     VQ GQ V +G  I L+G +G +  P
Sbjct: 107 VVIFAGNT-DSYGNRVEIQHADGTVTLYAHNAELTVQPGQTVRKGEVIALAGSTGASTGP 165

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VH+E+R++  A+DP  FL
Sbjct: 166 HVHYEIRRDGQAIDPWTFL 184


>gi|241759843|ref|ZP_04757943.1| LysM domain/M23 peptidase domain protein [Neisseria flavescens
           SK114]
 gi|241319851|gb|EER56247.1| LysM domain/M23 peptidase domain protein [Neisseria flavescens
           SK114]
          Length = 238

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIYVG ++   G  ILI H+D  +T Y+H DT  VQK QKV  G  I   G S ++ + +
Sbjct: 158 VIYVGEEVRGYGKLILISHNDYTITAYAHNDTLLVQKDQKVQAGQVIATMGSS-DSDNVK 216

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R N  A+DP+ +L  
Sbjct: 217 LHFEVRLNGKAVDPLPYLTR 236


>gi|282858000|ref|ZP_06267201.1| neprilysin [Pyramidobacter piscolens W5455]
 gi|282584154|gb|EFB89521.1| neprilysin [Pyramidobacter piscolens W5455]
          Length = 502

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T++IRHD +  T+Y H  +  ++KGQ V +G  I   G SG A  P VHFE+R+N   
Sbjct: 435 GRTVIIRHDSTYTTLYGHCQSLMIRKGQNVKKGTVIATVGSSGRATGPHVHFEVRRNDSP 494

Query: 73  MDPIKFL 79
            +P+ +L
Sbjct: 495 TNPMSYL 501


>gi|311694173|gb|ADP97046.1| peptidase M23B [marine bacterium HP15]
          Length = 296

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L+  GN I++ H++  ++ Y+H     VQ+G+ V  G  I   G SG A+ P 
Sbjct: 217 VVYAGNGLLGYGNLIIVNHNEHYLSAYAHNRKILVQEGEDVKAGQVIAELGSSG-AERPM 275

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RKN   +DP+ +L
Sbjct: 276 LHFEIRKNGNPVDPVHYL 293


>gi|187478471|ref|YP_786495.1| peptidoglycan-binding peptidase [Bordetella avium 197N]
 gi|115423057|emb|CAJ49588.1| putative peptidoglycan-binding peptidase [Bordetella avium 197N]
          Length = 283

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +  LGN I+I H +  +T Y+H  T  V+ GQ V RG  +   G+S +A  P+
Sbjct: 204 VMYSGNGVRGLGNLIIINHQNGFITAYAHNRTLLVKTGQDVKRGAKVAELGQS-DASSPK 262

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 263 LHFEIRRQGTPVDPMQYLPAR 283


>gi|307330414|ref|ZP_07609558.1| Peptidase M23 [Streptomyces violaceusniger Tu 4113]
 gi|306883931|gb|EFN14973.1| Peptidase M23 [Streptomyces violaceusniger Tu 4113]
          Length = 205

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 49/79 (62%), Gaps = 3/79 (3%)

Query: 6   GNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFE 65
           G D    GN I+I+HD++  + Y+H+    V+ GQ V+ G  IGLSG +GN+  P +HFE
Sbjct: 122 GGDGPAYGNAIVIKHDNATYSQYAHLSRIDVRIGQTVTEGQQIGLSGSTGNSTGPHLHFE 181

Query: 66  LRKN---AIAMDPIKFLEE 81
           +R       A++P+KFL +
Sbjct: 182 IRTTPNYGSAVEPLKFLRD 200


>gi|238751546|ref|ZP_04613037.1| Uncharacterized lipoprotein ygeR [Yersinia rohdei ATCC 43380]
 gi|238710264|gb|EEQ02491.1| Uncharacterized lipoprotein ygeR [Yersinia rohdei ATCC 43380]
          Length = 231

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V+  Q V  G  I   G SG      
Sbjct: 146 VVYVGNQLRGYGNLIMIKHGNDFITAYAHNDTMLVKNAQDVKAGQKIATMGSSG-TDSLM 204

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 205 LHFQIRYRATALDPLRYL 222


>gi|300947582|ref|ZP_07161756.1| peptidase, M23 family [Escherichia coli MS 116-1]
 gi|300954298|ref|ZP_07166760.1| peptidase, M23 family [Escherichia coli MS 175-1]
 gi|300318718|gb|EFJ68502.1| peptidase, M23 family [Escherichia coli MS 175-1]
 gi|300452833|gb|EFK16453.1| peptidase, M23 family [Escherichia coli MS 116-1]
          Length = 116

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 31  VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKVGQKIATMG-STDAASVR 89

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HF++R  A A+DP+++L  +
Sbjct: 90  LHFQIRYRATAIDPLRYLPPQ 110


>gi|87198871|ref|YP_496128.1| peptidase M23B [Novosphingobium aromaticivorans DSM 12444]
 gi|87134552|gb|ABD25294.1| peptidase M23B [Novosphingobium aromaticivorans DSM 12444]
          Length = 251

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G +    G  I+I H    VT Y+++ +  V++GQ V+    I L GKSG A  P 
Sbjct: 170 VIYAGKEPERFGQLIIIDHGGGFVTAYAYLGSMTVKEGQIVTARERIALVGKSGEATRPT 229

Query: 62  VHFELRKNAIAMDPIKFLEEKI 83
           VHFELR+N +  +P  +L  ++
Sbjct: 230 VHFELRRNNVPRNPELYLPPRL 251


>gi|238797814|ref|ZP_04641307.1| Uncharacterized lipoprotein ygeR [Yersinia mollaretii ATCC 43969]
 gi|238718342|gb|EEQ10165.1| Uncharacterized lipoprotein ygeR [Yersinia mollaretii ATCC 43969]
          Length = 231

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V+  Q V  G  I   G SG      
Sbjct: 146 VVYVGNQLRGYGNLIMIKHGNDFITAYAHNDTMLVKNAQDVKAGQKIATMGSSGT-DTLM 204

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 205 LHFQIRYRATALDPLRYL 222


>gi|167647074|ref|YP_001684737.1| peptidase M23B [Caulobacter sp. K31]
 gi|167349504|gb|ABZ72239.1| peptidase M23B [Caulobacter sp. K31]
          Length = 633

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 43/66 (65%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +   GN +L++H D  VT Y+H+    V+  Q+VS+G T+G  G++G    PQ
Sbjct: 548 VVYAGNQVPGFGNLVLVKHADGWVTAYAHLSATEVKMRQQVSQGDTLGAVGQTGGVTEPQ 607

Query: 62  VHFELR 67
           +HFE+R
Sbjct: 608 LHFEVR 613


>gi|238790530|ref|ZP_04634298.1| Uncharacterized lipoprotein ygeR [Yersinia frederiksenii ATCC
           33641]
 gi|238721399|gb|EEQ13071.1| Uncharacterized lipoprotein ygeR [Yersinia frederiksenii ATCC
           33641]
          Length = 231

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V+  Q V  G  I   G SG +    
Sbjct: 146 VVYVGNQLRGYGNLIMIKHGNDFITAYAHNDTMLVKNAQDVKAGQKIATLGSSG-SDTLM 204

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 205 LHFQIRYRATALDPLRYL 222


>gi|319651064|ref|ZP_08005198.1| hypothetical protein HMPREF1013_01808 [Bacillus sp. 2_A_57_CT2]
 gi|317397234|gb|EFV77938.1| hypothetical protein HMPREF1013_01808 [Bacillus sp. 2_A_57_CT2]
          Length = 493

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 49/78 (62%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  GND    GN I+I H++   TVY+H+D+  V  GQ VS+G  IG+ G +G++    
Sbjct: 414 VVSAGNDGGGYGNKIVIDHNNGFRTVYAHLDSISVSVGQTVSKGSKIGIMGSTGDSTGVH 473

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+ KN    +P+K++
Sbjct: 474 LHFEVYKNGKMQNPLKYI 491


>gi|319638623|ref|ZP_07993385.1| LysM domain/M23 peptidase domain-containing protein [Neisseria
           mucosa C102]
 gi|317400372|gb|EFV81031.1| LysM domain/M23 peptidase domain-containing protein [Neisseria
           mucosa C102]
          Length = 234

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 47/80 (58%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIYVG ++   G  ILI H+D  +T Y+H DT  VQK QKV  G  I   G S +    +
Sbjct: 154 VIYVGEEVRGYGKLILISHNDYTITAYAHNDTLLVQKDQKVQAGQVIATMGSS-DTDSVK 212

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R N  A+DP+ +L  
Sbjct: 213 LHFEVRLNGKAVDPLPYLTR 232


>gi|261380886|ref|ZP_05985459.1| YgeR protein [Neisseria subflava NJ9703]
 gi|284796363|gb|EFC51710.1| YgeR protein [Neisseria subflava NJ9703]
          Length = 234

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIYVG ++   G  ILI H+D  +T Y+H DT  VQK QKV  G  I   G S +    +
Sbjct: 154 VIYVGEEVRGYGKLILISHNDYTITAYAHNDTLLVQKDQKVQAGQVIATMGSS-DTDSVK 212

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N  A+DP+ +L
Sbjct: 213 LHFEVRLNGKAVDPLPYL 230


>gi|333015320|gb|EGK34662.1| lipoprotein nlpD domain protein [Shigella flexneri K-227]
          Length = 85

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 47/77 (61%), Gaps = 1/77 (1%)

Query: 3  IYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQV 62
          +YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   ++
Sbjct: 1  MYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKTGQKIATMG-STDAASVRL 59

Query: 63 HFELRKNAIAMDPIKFL 79
          HF++R  A A+DP+++L
Sbjct: 60 HFQIRYRATAIDPLRYL 76


>gi|323167933|gb|EFZ53623.1| liponlpD domain protein [Shigella sonnei 53G]
          Length = 85

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 47/77 (61%), Gaps = 1/77 (1%)

Query: 3  IYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQV 62
          +YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   ++
Sbjct: 1  MYVGNQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMG-STDAASVRL 59

Query: 63 HFELRKNAIAMDPIKFL 79
          HF++R  A A+DP+++L
Sbjct: 60 HFQIRYRATAIDPLRYL 76


>gi|170765936|ref|ZP_02900747.1| peptidase, M23B family [Escherichia albertii TW07627]
 gi|170125082|gb|EDS94013.1| peptidase, M23B family [Escherichia albertii TW07627]
          Length = 251

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVG+ L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G S +A   +
Sbjct: 166 VVYVGHQLRGYGNLIMIKHSEDYITAYAHNDTMLVNNGQTVKAGQKIATMGSS-DAASVR 224

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 225 LHFQIRYRATAIDPLRYL 242


>gi|294102440|ref|YP_003554298.1| Peptidase M23 [Aminobacterium colombiense DSM 12261]
 gi|293617420|gb|ADE57574.1| Peptidase M23 [Aminobacterium colombiense DSM 12261]
          Length = 404

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVG  L   G  I+I H   + TVY+H+ +  V +GQ VS+G  IG  G +G +  P 
Sbjct: 327 VLYVGW-LRGYGQIIIIDHGRDLSTVYAHLSSTGVDEGQGVSKGQVIGHVGSTGVSTGPH 385

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N  A DP+K+L+
Sbjct: 386 LHFEVRVNGDARDPMKYLQ 404


>gi|257453756|ref|ZP_05619037.1| peptidase M23B [Enhydrobacter aerosaccus SK60]
 gi|257448848|gb|EEV23810.1| peptidase M23B [Enhydrobacter aerosaccus SK60]
          Length = 270

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 45/79 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVG+DL E G  ILI+H+   ++ Y+H+    VQ+ Q V  G TIG  G   N   P 
Sbjct: 192 VLYVGSDLPEYGKLILIQHNSDYISAYAHLGNFAVQERQTVQAGQTIGTVGTDNNLNQPA 251

Query: 62  VHFELRKNAIAMDPIKFLE 80
           V F++R     ++P  +L+
Sbjct: 252 VEFQIRYRGTPVNPASYLK 270


>gi|238763011|ref|ZP_04623978.1| Uncharacterized lipoprotein ygeR [Yersinia kristensenii ATCC 33638]
 gi|238698769|gb|EEP91519.1| Uncharacterized lipoprotein ygeR [Yersinia kristensenii ATCC 33638]
          Length = 231

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V   Q V  G  I   G SG      
Sbjct: 146 VVYVGNQLRGYGNLIMIKHGEDFITAYAHNDTMLVNNAQDVKAGQKIATMGSSGTDTL-M 204

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 205 LHFQIRYRATALDPLRYL 222


>gi|225025402|ref|ZP_03714594.1| hypothetical protein EIKCOROL_02300 [Eikenella corrodens ATCC
           23834]
 gi|224941846|gb|EEG23055.1| hypothetical protein EIKCOROL_02300 [Eikenella corrodens ATCC
           23834]
          Length = 337

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 50/78 (64%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+++H+ + +T Y H     V++GQ V RG +I   G S ++Q  Q
Sbjct: 259 VVYSGSGLRGYGNLIIVQHNQTYLTAYGHNQRLLVREGQTVRRGQSIATMGNS-DSQRVQ 317

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELRKN   +DP++++
Sbjct: 318 LHFELRKNGQPVDPLQYI 335


>gi|302339676|ref|YP_003804882.1| peptidase M23 [Spirochaeta smaragdinae DSM 11293]
 gi|301636861|gb|ADK82288.1| Peptidase M23 [Spirochaeta smaragdinae DSM 11293]
          Length = 340

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 46/75 (61%)

Query: 8   DLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR 67
           D +  GN ++IRH     T Y+H+DT YV++G  V++G  IG  G +G +  P VHFE+R
Sbjct: 262 DAMGFGNYVVIRHPYGFATKYAHMDTVYVEEGDVVTQGQKIGTMGNTGLSTGPHVHFEVR 321

Query: 68  KNAIAMDPIKFLEEK 82
             +  +DP +FL  K
Sbjct: 322 IGSQVVDPERFLNVK 336


>gi|295688848|ref|YP_003592541.1| peptidase M23 [Caulobacter segnis ATCC 21756]
 gi|295430751|gb|ADG09923.1| Peptidase M23 [Caulobacter segnis ATCC 21756]
          Length = 622

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 42/76 (55%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           + Y GN +   GN +L++H D  VT Y+H+ +  V+  Q+V RG  IG  G +G    PQ
Sbjct: 537 IAYAGNQVPTFGNLVLVKHADGWVTAYAHLSSTTVKMRQQVRRGEQIGAVGATGGVNEPQ 596

Query: 62  VHFELRKNAIAMDPIK 77
           +HFE+R      D  K
Sbjct: 597 LHFEMRYAPTVKDKAK 612


>gi|251799693|ref|YP_003014424.1| peptidase M23 [Paenibacillus sp. JDR-2]
 gi|247547319|gb|ACT04338.1| Peptidase M23 [Paenibacillus sp. JDR-2]
          Length = 390

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 2/70 (2%)

Query: 13  GNTILIRHDDSIVTVYSHIDTP--YVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           GNTI+I H + + T+Y H+      V+KGQ V +G  I  SG +G++  P +HFE+RKN 
Sbjct: 321 GNTIIIDHGNGLWTLYGHLRNGGIMVEKGQSVKKGEKIAESGNTGDSTGPHLHFEVRKNQ 380

Query: 71  IAMDPIKFLE 80
           +A+DP  +L+
Sbjct: 381 VAVDPAGYLK 390


>gi|167574175|ref|ZP_02367049.1| peptidase M23B [Burkholderia oklahomensis C6786]
          Length = 186

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 49/79 (62%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN L   GN ++I+HDD  +T Y+H     V++G KV++G  I   G S +A   
Sbjct: 106 VVAYAGNSLRGYGNFVIIKHDDVYLTAYAHNRALMVKEGDKVAKGRKIAEMGSS-DADRV 164

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R+  + +DP+K+L
Sbjct: 165 MLHFEIRRKGVPVDPLKYL 183


>gi|167567685|ref|ZP_02360601.1| lipoprotein NlpD, putative [Burkholderia oklahomensis EO147]
          Length = 186

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 49/79 (62%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN L   GN ++I+HDD  +T Y+H     V++G KV++G  I   G S +A   
Sbjct: 106 VVAYAGNSLRGYGNFVIIKHDDVYLTAYAHNRALMVKEGDKVAKGRKIAEMGSS-DADRV 164

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R+  + +DP+K+L
Sbjct: 165 MLHFEIRRKGVPVDPLKYL 183


>gi|170696975|ref|ZP_02888071.1| peptidase M23B [Burkholderia ambifaria IOP40-10]
 gi|170138149|gb|EDT06381.1| peptidase M23B [Burkholderia ambifaria IOP40-10]
          Length = 409

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (60%), Gaps = 2/82 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V ++GN+    G  ++IRHD    + Y+H+    P ++ G +V RG  +G  G +G A 
Sbjct: 282 VVTFIGNEPGGYGKYVVIRHDGGYASYYAHLSAFEPTLRTGARVVRGQRVGAVGSTGTAT 341

Query: 59  HPQVHFELRKNAIAMDPIKFLE 80
            P +HFE+R++A  ++PI+ +E
Sbjct: 342 GPHLHFEVRRHARLVNPIELVE 363


>gi|51244851|ref|YP_064735.1| hypothetical protein DP0999 [Desulfotalea psychrophila LSv54]
 gi|50875888|emb|CAG35728.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 321

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 50/90 (55%), Gaps = 7/90 (7%)

Query: 2   VIYVGNDLVE-------LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKS 54
           +I  G+ +VE        GN +LI H +   T Y H+    V+KG K+ RG TIGL G S
Sbjct: 222 IIATGDGIVEKAFYNGGYGNYVLISHKNGYKTAYGHMKKFLVRKGDKIQRGQTIGLVGNS 281

Query: 55  GNAQHPQVHFELRKNAIAMDPIKFLEEKIP 84
           G +  P +H+E+  N   ++P K+L  KIP
Sbjct: 282 GRSTGPHLHYEVILNRKTINPSKYLAIKIP 311


>gi|206580990|ref|YP_002236655.1| M23 peptidase domain protein [Klebsiella pneumoniae 342]
 gi|206570048|gb|ACI11824.1| M23 peptidase domain protein [Klebsiella pneumoniae 342]
          Length = 244

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H D   V  GQ V  G  I   G S +A   +
Sbjct: 159 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDKLMVNNGQSVKAGQQIATMG-STDADSVR 217

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HF++R  A A+DP+++L  +
Sbjct: 218 LHFQIRYRATAIDPLRYLPPQ 238


>gi|317403090|gb|EFV83623.1| peptidase [Achromobacter xylosoxidans C54]
          Length = 286

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +  LGN I++ H +  +T Y+H  T  V+ GQ V RG  I   G+S +   P+
Sbjct: 207 VMYSGNGVRGLGNLIIVNHQNGFITAYAHNRTLLVKTGQDVKRGAKIAEIGQS-DTTSPR 265

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  K
Sbjct: 266 LHFEIRRQGTPVDPMQYLPAK 286


>gi|238896428|ref|YP_002921166.1| putative lipoprotein [Klebsiella pneumoniae NTUH-K2044]
 gi|238548748|dbj|BAH65099.1| putative lipoprotein [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 246

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H D   V  GQ V  G  I   G S +A   +
Sbjct: 161 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDKLMVNNGQSVKAGQQIATMG-STDADSVR 219

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HF++R  A A+DP+++L  +
Sbjct: 220 LHFQIRYRATAIDPLRYLPPQ 240


>gi|146312947|ref|YP_001178021.1| peptidase M23B [Enterobacter sp. 638]
 gi|145319823|gb|ABP61970.1| peptidase M23B [Enterobacter sp. 638]
          Length = 248

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H D+  V  GQ V  G  I   G +G A    
Sbjct: 163 VVYVGNQLRGYGNLIMIKHGEDYITAYAHNDSLLVNNGQNVKAGQKIATMGSTG-ASSVA 221

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HF++R  A A+DP ++L  +
Sbjct: 222 LHFQIRYRATAIDPQRYLPAQ 242


>gi|238756922|ref|ZP_04618110.1| Uncharacterized lipoprotein ygeR [Yersinia aldovae ATCC 35236]
 gi|238704752|gb|EEP97281.1| Uncharacterized lipoprotein ygeR [Yersinia aldovae ATCC 35236]
          Length = 245

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V+  Q V  G  I   G +G +    
Sbjct: 160 VVYVGNQLRGYGNLIMIKHGNDFITAYAHNDTLLVKNAQDVKAGQKIATMGSTG-SDTIM 218

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 219 LHFQIRYRATALDPLRYL 236


>gi|290511302|ref|ZP_06550671.1| lipoprotein ygeR [Klebsiella sp. 1_1_55]
 gi|289776295|gb|EFD84294.1| lipoprotein ygeR [Klebsiella sp. 1_1_55]
          Length = 246

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H D   V  GQ V  G  I   G S +A   +
Sbjct: 161 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDKLMVNNGQSVKAGQQIATMG-STDADSVR 219

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HF++R  A A+DP+++L  +
Sbjct: 220 LHFQIRYRATAIDPLRYLPPQ 240


>gi|288933632|ref|YP_003437691.1| peptidase M23 [Klebsiella variicola At-22]
 gi|288888361|gb|ADC56679.1| Peptidase M23 [Klebsiella variicola At-22]
          Length = 237

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H D   V  GQ V  G  I   G S +A   +
Sbjct: 152 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDKLMVNNGQSVKAGQQIATMG-STDADSVR 210

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 211 LHFQIRYRATAIDPLRYL 228


>gi|152971834|ref|YP_001336943.1| putative lipoprotein [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|330011018|ref|ZP_08306945.1| peptidase, M23 family [Klebsiella sp. MS 92-3]
 gi|150956683|gb|ABR78713.1| putative lipoprotein [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|328534307|gb|EGF60919.1| peptidase, M23 family [Klebsiella sp. MS 92-3]
          Length = 237

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H D   V  GQ V  G  I   G S +A   +
Sbjct: 152 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDKLMVNNGQSVKAGQQIATMG-STDADSVR 210

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HF++R  A A+DP+++L  +
Sbjct: 211 LHFQIRYRATAIDPLRYLPPQ 231


>gi|296104549|ref|YP_003614695.1| putative peptidase M23B family protein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295059008|gb|ADF63746.1| putative peptidase M23B family protein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 247

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G +G     +
Sbjct: 162 VVYVGNQLRGYGNLIMIKHGEDYITAYAHNDTMLVNNGQNVKAGQKIATMGSTGT-DTVK 220

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HF++R  A A+DP ++L  +
Sbjct: 221 LHFQIRYKATAIDPQRYLPAQ 241


>gi|218961321|ref|YP_001741096.1| putative metalloendopeptidase (envC); putative signal peptide
           [Candidatus Cloacamonas acidaminovorans]
 gi|167729978|emb|CAO80890.1| putative metalloendopeptidase (envC); putative signal peptide
           [Candidatus Cloacamonas acidaminovorans]
          Length = 365

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 43/68 (63%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+I H +   T+Y++     V +G KV RG TI  SG +G+A  P +HFELRK+  A
Sbjct: 298 GKLIIIDHKNGFFTLYAYNSELLVSRGTKVKRGQTIAKSGMTGSASEPSLHFELRKDGKA 357

Query: 73  MDPIKFLE 80
           ++PI +LE
Sbjct: 358 INPIPYLE 365


>gi|238792539|ref|ZP_04636172.1| Uncharacterized lipoprotein ygeR [Yersinia intermedia ATCC 29909]
 gi|238728174|gb|EEQ19695.1| Uncharacterized lipoprotein ygeR [Yersinia intermedia ATCC 29909]
          Length = 242

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V   Q V  G  I   G +G      
Sbjct: 157 VVYVGNQLRGYGNLIMIKHGEDFITAYAHNDTMLVNNAQDVKAGQKIATMGSTGT-DTVM 215

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 216 LHFQIRYRATALDPLRYL 233


>gi|261342290|ref|ZP_05970148.1| YgeR protein [Enterobacter cancerogenus ATCC 35316]
 gi|288315631|gb|EFC54569.1| YgeR protein [Enterobacter cancerogenus ATCC 35316]
          Length = 214

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G +G     +
Sbjct: 129 VVYVGNQLRGYGNLIMIKHGEDYITAYAHNDTMLVNNGQNVKAGQKIATMGSTGT-DSVK 187

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP ++L
Sbjct: 188 LHFQIRYKATAIDPQRYL 205


>gi|260752561|ref|YP_003225454.1| peptidase M23 [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258551924|gb|ACV74870.1| Peptidase M23 [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 291

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 45/78 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  +  LG  ILI+H     +VY H+D   V++G  V +G  I  +G+SGN   PQ
Sbjct: 210 VAYTGTHISVLGGVILIQHAQGWTSVYGHLDKIKVKQGDFVKKGEVIASAGESGNTPRPQ 269

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    A++P + L
Sbjct: 270 LHFEIRHGLKAVNPARLL 287


>gi|295097427|emb|CBK86517.1| Membrane proteins related to metalloendopeptidases [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 213

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H DT  V  GQ V  G  I   G +G     +
Sbjct: 128 VVYVGNQLRGYGNLIMIKHGEDYITAYAHNDTMLVNNGQNVKAGQKIATMGSTGT-DTVK 186

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HF++R  A A+DP ++L  +
Sbjct: 187 LHFQIRYKATAIDPQRYLPAQ 207


>gi|288572950|ref|ZP_06391307.1| Peptidase M23 [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288568691|gb|EFC90248.1| Peptidase M23 [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 488

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  +   G  ++++HD +  T+Y+H    YV+KGQKVS G  +   G SG +  P 
Sbjct: 411 VVYAGW-MGGYGRVVVVKHDSTYSTLYAHCQKLYVRKGQKVSAGKVVATVGTSGRSTGPH 469

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N   ++P+K+L 
Sbjct: 470 LHFEIRINNKPVNPLKYLR 488


>gi|241761800|ref|ZP_04759886.1| Peptidase M23 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241373714|gb|EER63274.1| Peptidase M23 [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 291

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 45/78 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  +  LG  ILI+H     +VY H+D   V++G  V +G  I  +G+SGN   PQ
Sbjct: 210 VAYTGTHISVLGGVILIQHAQGWTSVYGHLDKIKVKQGDFVRKGEVIASAGESGNTPRPQ 269

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    A++P + L
Sbjct: 270 LHFEIRHGLKAVNPARLL 287


>gi|119511005|ref|ZP_01630126.1| hypothetical protein N9414_04250 [Nodularia spumigena CCY9414]
 gi|119464350|gb|EAW45266.1| hypothetical protein N9414_04250 [Nodularia spumigena CCY9414]
          Length = 223

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G D   LGN I I+H D  VTVY H    +V KG+KV +G  I   G +GN+  P
Sbjct: 80  VVVKAGWDNWGLGNAIEIKHLDQSVTVYGHNRRLFVTKGEKVEQGEIIAEMGSTGNSSAP 139

Query: 61  QVHFELRKNA-IAMDPIKFL 79
            +HFE   N  +A DPI  L
Sbjct: 140 HLHFEFYPNGRVAADPIPLL 159


>gi|56551880|ref|YP_162719.1| peptidase M23 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56543454|gb|AAV89608.1| Peptidase M23 [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 291

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 45/78 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  +  LG  ILI+H     +VY H+D   V++G  V +G  I  +G+SGN   PQ
Sbjct: 210 VAYTGTHISVLGGVILIQHAQGWTSVYGHLDKIKVKQGDFVRKGEVIASAGESGNTPRPQ 269

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    A++P + L
Sbjct: 270 LHFEIRHGLKAVNPARLL 287


>gi|294102458|ref|YP_003554316.1| Peptidase M23 [Aminobacterium colombiense DSM 12261]
 gi|293617438|gb|ADE57592.1| Peptidase M23 [Aminobacterium colombiense DSM 12261]
          Length = 503

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  +++ H     T+Y+H  +  V+KGQ+VS+G  IGL G SG A  P +HFE+RKN   
Sbjct: 436 GRVVVLSHGQGYSTLYAHCSSLSVKKGQRVSQGQVIGLVGTSGRATGPHLHFEVRKNNSP 495

Query: 73  MDPIKFL 79
           ++P+K L
Sbjct: 496 INPLKVL 502


>gi|289208463|ref|YP_003460529.1| peptidase M23 [Thioalkalivibrio sp. K90mix]
 gi|288944094|gb|ADC71793.1| Peptidase M23 [Thioalkalivibrio sp. K90mix]
          Length = 246

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  LV  G  I+++HD   ++ Y H D   V +G +V  G TI   G SG A+ P 
Sbjct: 167 VVYAGGGLVGYGRLIILKHDARFLSAYGHNDELLVSEGDQVEAGETIARLGSSG-AERPM 225

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +   +DP ++L ++
Sbjct: 226 LHFEIRVDGTPVDPTRYLPDR 246


>gi|237737683|ref|ZP_04568164.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
 gi|229419563|gb|EEO34610.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
          Length = 332

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 42/67 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+I+H     T Y H+D   V+KGQ V  G  IG +G+SG    P +HFELRKN  A
Sbjct: 262 GKIIIIQHSGGYETRYGHLDKIGVRKGQYVKTGELIGKTGQSGRVTGPHLHFELRKNGKA 321

Query: 73  MDPIKFL 79
           ++P+K++
Sbjct: 322 LNPMKYM 328


>gi|323144153|ref|ZP_08078789.1| peptidase, M23 family [Succinatimonas hippei YIT 12066]
 gi|322416061|gb|EFY06759.1| peptidase, M23 family [Succinatimonas hippei YIT 12066]
          Length = 410

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I HD+  ++ Y+H D   V++GQKV RG  I   G S +A    
Sbjct: 332 VVYAGNALRGYGNLVIINHDNEFLSAYAHNDVLLVKEGQKVKRGQQIAKMG-STDASSVG 390

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++PIK+L
Sbjct: 391 LHFEIRYRGQSVNPIKYL 408


>gi|144898797|emb|CAM75661.1| peptidase family M23 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 374

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 42/67 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T+ I H + + T Y+H+    VQ GQKV+R   IGL G +G +  P +H+E+R N + 
Sbjct: 298 GQTVDIDHGNGLETRYAHLSRIKVQPGQKVTRATIIGLVGNTGRSTGPHLHYEVRLNDVP 357

Query: 73  MDPIKFL 79
            DPIKF+
Sbjct: 358 RDPIKFI 364


>gi|329850432|ref|ZP_08265277.1| lipoprotein nlpD [Asticcacaulis biprosthecum C19]
 gi|328840747|gb|EGF90318.1| lipoprotein nlpD [Asticcacaulis biprosthecum C19]
          Length = 245

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 40/64 (62%)

Query: 4   YVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVH 63
           Y G+ + ELGNTI I+H +   T YSH+    V   QKV++G  IG  G+SG    PQ+H
Sbjct: 162 YQGDQVRELGNTIYIKHPNGWYTGYSHLSAMKVTNNQKVTKGQVIGTVGQSGTIDQPQLH 221

Query: 64  FELR 67
           FE+R
Sbjct: 222 FEVR 225


>gi|186684743|ref|YP_001867939.1| peptidase M23B [Nostoc punctiforme PCC 73102]
 gi|186467195|gb|ACC82996.1| peptidase M23B [Nostoc punctiforme PCC 73102]
          Length = 401

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H + + T+Y H    YV +GQ V RG  IG  G +G +  P +HFE+R+N   
Sbjct: 335 GRAVIIDHGNGLTTLYGHTSELYVSEGQAVERGQAIGAVGSTGFSTGPHLHFEVRRNGTP 394

Query: 73  MDPIKFL 79
           +DP  +L
Sbjct: 395 VDPANYL 401


>gi|225677274|ref|ZP_03788257.1| putative lipoprotein NlpD [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225590694|gb|EEH11938.1| putative lipoprotein NlpD [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 198

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNA-QHP 60
           VIYVG  L   GN I++ H D+ +TVYS++   +V+ G KV +G  IG +GKS    + P
Sbjct: 117 VIYVGKGLRWYGNLIIVEHKDNYMTVYSYLKNIHVEIGDKVKQGQVIGSAGKSSTQDKDP 176

Query: 61  QVHFELRKNAIAMDPI 76
           Q+ F +R N  A+DP+
Sbjct: 177 QMCFTIRHNGQAVDPL 192


>gi|94496287|ref|ZP_01302865.1| Peptidase M23/M37 [Sphingomonas sp. SKA58]
 gi|94424466|gb|EAT09489.1| Peptidase M23/M37 [Sphingomonas sp. SKA58]
          Length = 392

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 43/70 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + + H + I+T Y+H+       G KV+RG TIG  G +G +  P +HFE+R N  A
Sbjct: 302 GNVVEVTHGNGIMTRYAHLSGFAAHIGDKVARGETIGRMGSTGRSTGPHLHFEVRLNGQA 361

Query: 73  MDPIKFLEEK 82
           ++P +FLE +
Sbjct: 362 INPRRFLEAR 371


>gi|311278191|ref|YP_003940422.1| Peptidase M23 [Enterobacter cloacae SCF1]
 gi|308747386|gb|ADO47138.1| Peptidase M23 [Enterobacter cloacae SCF1]
          Length = 243

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVGN L   GN I+I+H +  +T Y+H D   V  GQ V  G  I   G S +A   +
Sbjct: 158 VVYVGNQLRGYGNLIMIKHSEDYITAYAHNDKMMVNNGQSVKIGQQIATMGSS-DADTVK 216

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HF++R  A A+DP+++L  +
Sbjct: 217 LHFQIRYRATAIDPLRYLPPQ 237


>gi|107027325|ref|YP_624836.1| peptidase M23B [Burkholderia cenocepacia AU 1054]
 gi|116691278|ref|YP_836811.1| peptidase M23B [Burkholderia cenocepacia HI2424]
 gi|105896699|gb|ABF79863.1| peptidase M23B [Burkholderia cenocepacia AU 1054]
 gi|116649278|gb|ABK09918.1| peptidase M23B [Burkholderia cenocepacia HI2424]
          Length = 457

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 2/81 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V ++G +    G  ++IRHD    + Y+H+    P ++ G +V+RG  +G  G +G A 
Sbjct: 330 VVTFIGTEPRGYGKYVVIRHDGGYASYYAHLSAFEPTLRTGARVTRGQRVGAVGSTGTAT 389

Query: 59  HPQVHFELRKNAIAMDPIKFL 79
            P +HFE+R++A  +DPI+ +
Sbjct: 390 GPHLHFEVRRHARLVDPIELV 410


>gi|293605697|ref|ZP_06688074.1| lipoprotein NlpD/lppB-like protein [Achromobacter piechaudii ATCC
           43553]
 gi|292815876|gb|EFF74980.1| lipoprotein NlpD/lppB-like protein [Achromobacter piechaudii ATCC
           43553]
          Length = 285

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN +  LGN I++ H +  +T Y+H  T  V+ GQ V RG  I   G+S +   P
Sbjct: 205 LVKYSGNGVRGLGNLIIVEHQNGFITAYAHNRTLLVKTGQNVKRGAKIAELGQS-DTTSP 263

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
           ++HFE+R+    +DP+++L  +
Sbjct: 264 RLHFEIRRQGTPVDPMQYLPTR 285


>gi|307625682|gb|ADN69986.1| lipoprotein NlpD [Escherichia coli UM146]
          Length = 379

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  VQ+ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVQEQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|255066528|ref|ZP_05318383.1| YgeR protein [Neisseria sicca ATCC 29256]
 gi|255049112|gb|EET44576.1| YgeR protein [Neisseria sicca ATCC 29256]
          Length = 232

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVG ++   G  ILI H D  +T Y+H DT  VQK QKV+ G  I   G S +    +
Sbjct: 154 VLYVGEEVRGYGKLILISHSDFSITAYAHNDTILVQKDQKVAAGQPIATMGNS-DTDGVK 212

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N  A+DP+++L
Sbjct: 213 LHFEVRMNGKAVDPMQYL 230


>gi|58584863|ref|YP_198436.1| membrane protein related to metalloendopeptidase [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58419179|gb|AAW71194.1| Membrane protein related to metalloendopeptidase [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 205

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNA-QHP 60
           VIYVG  L   GN I++ H D+ +TVYS++   +V+ G KV +G  IG +GKS    + P
Sbjct: 124 VIYVGKGLRWYGNLIIVEHKDNYMTVYSYLKNIHVEIGDKVKQGQVIGSAGKSSTQDKDP 183

Query: 61  QVHFELRKNAIAMDPI 76
           Q+ F +R N  A+DP+
Sbjct: 184 QMCFTIRHNGQAVDPL 199


>gi|220930240|ref|YP_002507149.1| peptidase M23 [Clostridium cellulolyticum H10]
 gi|220000568|gb|ACL77169.1| Peptidase M23 [Clostridium cellulolyticum H10]
          Length = 282

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G      G  I+I HD+   T+Y H     V KG+ V +G  I L G +G +  P 
Sbjct: 199 VIYAGYS-SGYGRHIIIDHDNGFKTIYGHSSKLLVNKGKTVKKGQKIALVGSTGRSTGPH 257

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R + IA+DPIK++E K
Sbjct: 258 LHFEIRISDIAVDPIKYIEFK 278


>gi|58699048|ref|ZP_00373890.1| lipoprotein NlpD, putative [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225629914|ref|YP_002726705.1| peptidase, M23/M37 family [Wolbachia sp. wRi]
 gi|58534442|gb|EAL58599.1| lipoprotein NlpD, putative [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225591895|gb|ACN94914.1| peptidase, M23/M37 family [Wolbachia sp. wRi]
          Length = 198

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNA-QHP 60
           VIYVG  L   GN I++ H D+ +TVYS++   +V+ G KV +G  IG +GKS    + P
Sbjct: 117 VIYVGKGLRWYGNLIIVEHKDNYMTVYSYLKNIHVEIGDKVKQGQVIGSAGKSSTQDKDP 176

Query: 61  QVHFELRKNAIAMDPI 76
           Q+ F +R N  A+DP+
Sbjct: 177 QMCFTIRHNGQAVDPL 192


>gi|220910260|ref|YP_002485571.1| peptidase M23 [Cyanothece sp. PCC 7425]
 gi|219866871|gb|ACL47210.1| Peptidase M23 [Cyanothece sp. PCC 7425]
          Length = 411

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 42/67 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GNT++I H   + T+Y+H    YV++GQ V RG  I   G +G +  P +HFE+R+N   
Sbjct: 343 GNTVIIDHGGGLTTLYAHTSQMYVREGQTVQRGEAIAAVGSTGLSTGPHLHFEVRENGEP 402

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 403 VNPLNYL 409


>gi|83644703|ref|YP_433138.1| metalloendopeptidase-like membrane protein [Hahella chejuensis KCTC
           2396]
 gi|83632746|gb|ABC28713.1| Membrane protein related to metalloendopeptidase [Hahella
           chejuensis KCTC 2396]
          Length = 287

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L+  G  +++ H D  ++ Y+H     V++G  + RG  I   G++G    P 
Sbjct: 208 VVYAGNGLLGYGKLVILSHGDEYISAYAHNSKILVKEGDLIKRGQKIAEIGETG-TNRPM 266

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN   +DP+K+L ++
Sbjct: 267 LHFEIRKNGNPVDPLKYLPKR 287


>gi|42519973|ref|NP_965888.1| M24/M37 family peptidase [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42409710|gb|AAS13822.1| peptidase, M23/M37 family [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 190

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNA-QHP 60
           VIYVG  L   GN I++ H D+ +TVYS++   +V+ G KV +G  IG +GKS    + P
Sbjct: 109 VIYVGKGLRWYGNLIIVEHKDNYMTVYSYLKNIHVEIGDKVKQGQVIGSAGKSSTQDKDP 168

Query: 61  QVHFELRKNAIAMDPI 76
           Q+ F +R N  A+DP+
Sbjct: 169 QMCFTIRHNGQAVDPL 184


>gi|168061355|ref|XP_001782655.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162665888|gb|EDQ52558.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 498

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 42/67 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T+ + H +  +T+Y+H D  +VQ GQ V +G  I LSG +G++  P +HFE+ K+   
Sbjct: 429 GKTVCMDHGNGYITLYAHCDNVHVQPGQFVRKGQVIALSGNTGHSTGPHLHFEIHKDGRT 488

Query: 73  MDPIKFL 79
           +DP+  L
Sbjct: 489 VDPLAHL 495


>gi|254479614|ref|ZP_05092921.1| M23 peptidase domain protein [Carboxydibrachium pacificum DSM
           12653]
 gi|214034442|gb|EEB75209.1| M23 peptidase domain protein [Carboxydibrachium pacificum DSM
           12653]
          Length = 208

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 48/75 (64%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ +  +  +LG  +++RH+  + TVY+H+   +V++GQ++ +G  IG SG +G    P 
Sbjct: 120 VVMLATEKEDLGKVVVLRHEGDVRTVYAHLSEIFVKEGQQIRQGEVIGKSGDTGKVTAPH 179

Query: 62  VHFELRKNAIAMDPI 76
           +HFE+ +N   +DP+
Sbjct: 180 LHFEVWENGKPIDPL 194


>gi|312796083|ref|YP_004029005.1| peptidoglycan-specific endopeptidase, M23 family [Burkholderia
           rhizoxinica HKI 454]
 gi|312167858|emb|CBW74861.1| Peptidoglycan-specific endopeptidase, M23 family [Burkholderia
           rhizoxinica HKI 454]
          Length = 301

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+ + +T Y+H  T  V++G  V++G TI   G S +A    
Sbjct: 222 VVYAGNGLRGYGNLIIIKHNATYLTAYAHNRTLLVKEGDPVTQGQTIAEMGGS-DADKVM 280

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RK    +DP+K+L
Sbjct: 281 LHFEVRKQGKPVDPMKYL 298


>gi|126735605|ref|ZP_01751350.1| peptidase, M23/M37 family protein [Roseobacter sp. CCS2]
 gi|126714792|gb|EBA11658.1| peptidase, M23/M37 family protein [Roseobacter sp. CCS2]
          Length = 435

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 43/67 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I IRHD  I T Y+H++T  V+ GQ+VSRG  IG  G SG +  P +H+E+R N   
Sbjct: 362 GRLIKIRHDFGIETRYAHLNTMDVRVGQRVSRGERIGAMGNSGRSTGPHLHYEVRVNGNP 421

Query: 73  MDPIKFL 79
           ++P+ ++
Sbjct: 422 VNPMTYI 428


>gi|332298381|ref|YP_004440303.1| Peptidase M23 [Treponema brennaborense DSM 12168]
 gi|332181484|gb|AEE17172.1| Peptidase M23 [Treponema brennaborense DSM 12168]
          Length = 311

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 42/67 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I HD++  +VY+H+    V+KG  V+ G  IG  G +G +  P +HFE+R N  A
Sbjct: 242 GNFIIIDHDNNTQSVYAHLSRILVEKGNSVTGGSIIGNVGSTGLSTGPHLHFEIRINGSA 301

Query: 73  MDPIKFL 79
            DP KFL
Sbjct: 302 QDPRKFL 308


>gi|326318747|ref|YP_004236419.1| peptidase M23 [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323375583|gb|ADX47852.1| Peptidase M23 [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 462

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 42/69 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I I+H++  VTVY+H+    V+KGQ V +G TIG  G +G A  P +HFE R N   
Sbjct: 356 GNVIYIKHNNQHVTVYAHLSRIDVRKGQAVEQGQTIGAVGATGWATGPHLHFESRVNGQH 415

Query: 73  MDPIKFLEE 81
            DP+   ++
Sbjct: 416 QDPMVLAQQ 424


>gi|170736684|ref|YP_001777944.1| peptidase M23B [Burkholderia cenocepacia MC0-3]
 gi|254249346|ref|ZP_04942666.1| hypothetical protein BCPG_04209 [Burkholderia cenocepacia PC184]
 gi|124875847|gb|EAY65837.1| hypothetical protein BCPG_04209 [Burkholderia cenocepacia PC184]
 gi|169818872|gb|ACA93454.1| peptidase M23B [Burkholderia cenocepacia MC0-3]
          Length = 457

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V ++G +    G  ++IRHD    + Y+H+    P ++ G +V RG  +G  G +G A 
Sbjct: 330 VVTFIGTEPRGYGKYVVIRHDGGYASYYAHLSAFEPTLRTGARVMRGQRVGAVGSTGTAT 389

Query: 59  HPQVHFELRKNAIAMDPIKFLE 80
            P +HFE+R++A  +DPI+ ++
Sbjct: 390 GPHLHFEVRRHARLVDPIELVQ 411


>gi|270264029|ref|ZP_06192297.1| lipoprotein NlpD [Serratia odorifera 4Rx13]
 gi|270042222|gb|EFA15318.1| lipoprotein NlpD [Serratia odorifera 4Rx13]
          Length = 328

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 249 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 307

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 308 LHFEIRYKGKSVNPLRFLPQR 328


>gi|167758711|ref|ZP_02430838.1| hypothetical protein CLOSCI_01053 [Clostridium scindens ATCC 35704]
 gi|167663907|gb|EDS08037.1| hypothetical protein CLOSCI_01053 [Clostridium scindens ATCC 35704]
          Length = 497

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 44/67 (65%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H D +VT Y H D  YV++GQKV +G  IGLSG +GN+    +HF++ ++ +A
Sbjct: 429 GIMVEIDHGDGLVTKYMHHDKIYVEEGQKVEKGQQIGLSGTTGNSTGNHLHFQVEEDGVA 488

Query: 73  MDPIKFL 79
           +DP  +L
Sbjct: 489 IDPGLYL 495


>gi|20807388|ref|NP_622559.1| membrane proteins related to metalloendopeptidase
           [Thermoanaerobacter tengcongensis MB4]
 gi|20515908|gb|AAM24163.1| Membrane proteins related to metalloendopeptidases
           [Thermoanaerobacter tengcongensis MB4]
          Length = 239

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 48/75 (64%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ +  +  +LG  +++RH+  + TVY+H+   +V++GQ++ +G  IG SG +G    P 
Sbjct: 151 VVMLATEKEDLGKVVVLRHEGDVRTVYAHLSEIFVKEGQQIRQGEVIGKSGDTGKVTAPH 210

Query: 62  VHFELRKNAIAMDPI 76
           +HFE+ +N   +DP+
Sbjct: 211 LHFEVWENGKPIDPL 225


>gi|171315589|ref|ZP_02904824.1| peptidase M23B [Burkholderia ambifaria MEX-5]
 gi|171099260|gb|EDT44019.1| peptidase M23B [Burkholderia ambifaria MEX-5]
          Length = 451

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 50/82 (60%), Gaps = 2/82 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V ++G++    G  ++IRHD    + Y+H+    P ++ G +V RG  +G  G +G A 
Sbjct: 324 VVTFIGSEPGGYGKYVVIRHDGGYASYYAHLSAFEPTLRTGARVVRGQRVGAVGSTGTAT 383

Query: 59  HPQVHFELRKNAIAMDPIKFLE 80
            P +HFE+R++A  +DPI+ ++
Sbjct: 384 GPHLHFEVRRHARLVDPIELVQ 405


>gi|166032791|ref|ZP_02235620.1| hypothetical protein DORFOR_02506 [Dorea formicigenerans ATCC
           27755]
 gi|166027148|gb|EDR45905.1| hypothetical protein DORFOR_02506 [Dorea formicigenerans ATCC
           27755]
          Length = 377

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 43/67 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I H + ++T Y H +T +V  GQKVS+G  IG  G +GN+  P +HF++  N   
Sbjct: 311 GNLIIINHGNGLLTYYMHCNTIFVSAGQKVSKGQNIGQVGTTGNSTGPHLHFQVMNNGKP 370

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 371 VNPMNYL 377


>gi|325498433|gb|EGC96292.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           fergusonii ECD227]
          Length = 247

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H +  +T Y+H DT  V  G+ V  G  I   G S +A   +
Sbjct: 162 VVYAGNQLRGYGNLVMIKHSEDYITAYAHNDTILVNNGETVKAGQKIATMG-STDAASVR 220

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 221 LHFQIRYRATAIDPLRYL 238


>gi|218550119|ref|YP_002383910.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           fergusonii ATCC 35469]
 gi|218357660|emb|CAQ90301.1| Tetratricopeptide repeat transcriptional regulator [Escherichia
           fergusonii ATCC 35469]
 gi|324115112|gb|EGC09077.1| peptidase M23 [Escherichia fergusonii B253]
          Length = 252

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H +  +T Y+H DT  V  G+ V  G  I   G S +A   +
Sbjct: 167 VVYAGNQLRGYGNLVMIKHSEDYITAYAHNDTILVNNGETVKAGQKIATMG-STDAASVR 225

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++R  A A+DP+++L
Sbjct: 226 LHFQIRYRATAIDPLRYL 243


>gi|289523288|ref|ZP_06440142.1| peptidase, M23/M37 family [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289502980|gb|EFD24144.1| peptidase, M23/M37 family [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 399

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 44/67 (65%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I++ H   + TVY+H+    V++GQ V++G  IG  G +G A  P +HFE+R NA A
Sbjct: 332 GQVIILDHGGDMTTVYAHLSAINVREGQVVNQGDVIGRVGNTGVATGPHLHFEVRINANA 391

Query: 73  MDPIKFL 79
           +DP+K+L
Sbjct: 392 VDPLKYL 398


>gi|304316538|ref|YP_003851683.1| peptidase M23 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778040|gb|ADL68599.1| Peptidase M23 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 311

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  L   GN ++I H   I +VY H     V+ GQ V+RG  I  SG +G +  P
Sbjct: 232 VVTYAGW-LSGYGNVVMINHGYGITSVYGHNSQLLVKVGQTVNRGDIIAKSGSTGRSTGP 290

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+R N  A+DP+K+L
Sbjct: 291 HVHFEIRLNGNAVDPLKYL 309


>gi|257143000|ref|ZP_05591262.1| lipoprotein NlpD, putative [Burkholderia thailandensis E264]
          Length = 190

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G+ L   GN ++I+HDD+ ++ Y+H     V++G  V++G  I   G S +A   
Sbjct: 110 VVAYAGDSLRGYGNFVIIKHDDTYLSAYAHNRKLLVKEGDPVAKGQVIAEMGDS-DADRV 168

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R+  +A+DP+K+L  +
Sbjct: 169 MLHFEIRRKGVAVDPLKYLPAR 190


>gi|147679196|ref|YP_001213411.1| membrane protein [Pelotomaculum thermopropionicum SI]
 gi|146275293|dbj|BAF61042.1| membrane protein [Pelotomaculum thermopropionicum SI]
          Length = 472

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GNT+ I H   IVT Y+H+ +  V+ GQ+V RG  IGL G +GN   P +HFE+  +   
Sbjct: 405 GNTVEINHGGGIVTRYAHLSSIKVRSGQRVDRGELIGLVGATGNTTGPHLHFEVLISGQP 464

Query: 73  MDPIKFL 79
            DP+ +L
Sbjct: 465 RDPLDYL 471


>gi|83717650|ref|YP_439848.1| lipoprotein NlpD [Burkholderia thailandensis E264]
 gi|83651475|gb|ABC35539.1| lipoprotein NlpD, putative [Burkholderia thailandensis E264]
          Length = 186

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G+ L   GN ++I+HDD+ ++ Y+H     V++G  V++G  I   G S +A   
Sbjct: 106 VVAYAGDSLRGYGNFVIIKHDDTYLSAYAHNRKLLVKEGDPVAKGQVIAEMGDS-DADRV 164

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R+  +A+DP+K+L  +
Sbjct: 165 MLHFEIRRKGVAVDPLKYLPAR 186


>gi|167616451|ref|ZP_02385083.1| lipoprotein NlpD, putative [Burkholderia thailandensis Bt4]
          Length = 131

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G+ L   GN ++I+HDD+ ++ Y+H     V++G  V++G  I   G S +A   
Sbjct: 51  VVAYAGDSLRGYGNFVIIKHDDTYLSAYAHNRKLLVKEGDPVAKGQVIAEMGDS-DADRV 109

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R+  +A+DP+K+L  +
Sbjct: 110 MLHFEIRRKGVAVDPLKYLPAR 131


>gi|312621992|ref|YP_004023605.1| peptidase M23 [Caldicellulosiruptor kronotskyensis 2002]
 gi|312202459|gb|ADQ45786.1| Peptidase M23 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 379

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G TI+I +   I T+Y+H+ T  V  GQKV +G TIG  G +G A  P +HFE+R N   
Sbjct: 312 GKTIIIDNGSGISTLYAHLSTIKVSIGQKVKKGETIGYVGATGYATGPHLHFEVRINGDV 371

Query: 73  MDPIKFL 79
            DP+ FL
Sbjct: 372 TDPLNFL 378


>gi|282862347|ref|ZP_06271409.1| Peptidase M23 [Streptomyces sp. ACTE]
 gi|282562686|gb|EFB68226.1| Peptidase M23 [Streptomyces sp. ACTE]
          Length = 263

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN I++R  D   T Y H+ +  VQ GQ+VS G  IGLSG +GN+  P +HFE R     
Sbjct: 187 GNNIVLRMTDGTYTQYGHLSSIGVQVGQRVSSGQQIGLSGSTGNSTGPHLHFEARTTPQY 246

Query: 70  AIAMDPIKFL 79
              MDP+ +L
Sbjct: 247 GSDMDPVAYL 256


>gi|332970910|gb|EGK09886.1| lipoprotein [Psychrobacter sp. 1501(2011)]
          Length = 276

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 43/75 (57%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y GN L E GN I+IRHDD  +TVY+H +   V++G +V  G  I   G SG     
Sbjct: 196 VVMYAGNGLPEYGNLIMIRHDDRYITVYAHNNELLVREGDQVQAGQRIATMGSSGQTTMV 255

Query: 61  QVHFELRKNAIAMDP 75
            + F++R     +DP
Sbjct: 256 GLQFQVRDGGTPIDP 270


>gi|261822743|ref|YP_003260849.1| lipoprotein NlpD [Pectobacterium wasabiae WPP163]
 gi|261606756|gb|ACX89242.1| Peptidase M23 [Pectobacterium wasabiae WPP163]
          Length = 345

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q V+ G  I   G +G +   +
Sbjct: 266 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQDVTAGQKIATMGSTGTSS-VR 324

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 325 LHFEIRYKGKSVNPLRFLPQR 345


>gi|227114061|ref|ZP_03827717.1| lipoprotein NlpD [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 344

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q V+ G  I   G +G +   +
Sbjct: 265 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQDVTAGQKIATMGSTGTSS-VR 323

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 324 LHFEIRYKGKSVNPLRFLPQR 344


>gi|172062294|ref|YP_001809945.1| peptidase M23 [Burkholderia ambifaria MC40-6]
 gi|171994811|gb|ACB65729.1| Peptidase M23 [Burkholderia ambifaria MC40-6]
          Length = 450

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V ++G +    G  ++IRHD    + Y+H+    P ++ G +V RG  +G  G +G A 
Sbjct: 323 VVTFIGTEPGGYGKYVVIRHDGGYASYYAHLSAFEPTLRTGARVVRGQRVGAVGSTGTAT 382

Query: 59  HPQVHFELRKNAIAMDPIKFLE 80
            P +HFE+R++A  +DPI+ ++
Sbjct: 383 GPHLHFEVRRHARLVDPIELVQ 404


>gi|302543551|ref|ZP_07295893.1| putative secreted metallopeptidase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302461169|gb|EFL24262.1| putative secreted metallopeptidase [Streptomyces himastatinicus
           ATCC 53653]
          Length = 200

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (57%), Gaps = 3/78 (3%)

Query: 7   NDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFEL 66
            D    GN I+I+HD+   T Y+H+    V+ GQ V+ G  IGLSG +GN+  P +HFE+
Sbjct: 118 GDGPAYGNAIVIKHDNDTYTQYAHLSRVDVRIGQSVTTGQQIGLSGSTGNSTGPHLHFEV 177

Query: 67  RKN---AIAMDPIKFLEE 81
           R       A+ P+ FL E
Sbjct: 178 RTTPNYGSAVGPLTFLRE 195


>gi|50122452|ref|YP_051619.1| lipoprotein NlpD [Pectobacterium atrosepticum SCRI1043]
 gi|49612978|emb|CAG76429.1| putative cell wall degradation lipoprotein [Pectobacterium
           atrosepticum SCRI1043]
          Length = 344

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q V+ G  I   G +G +   +
Sbjct: 265 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQDVTAGQKIATMGSTGTSS-VR 323

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 324 LHFEIRYKGKSVNPLRFLPQR 344


>gi|163856859|ref|YP_001631157.1| M23-family peptidase [Bordetella petrii DSM 12804]
 gi|163260587|emb|CAP42889.1| M23-family peptidase [Bordetella petrii]
          Length = 282

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +  LGN I+I H +  +T Y+H     V+ GQ V RG  I   G++ +   P+
Sbjct: 203 VMYSGNGVRGLGNLIIINHQNGFITAYAHNQKLLVKTGQTVKRGAKIAEVGQT-DTTSPR 261

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+++L
Sbjct: 262 LHFEIRRQGTPVDPLQYL 279


>gi|253689711|ref|YP_003018901.1| Peptidase M23 [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251756289|gb|ACT14365.1| Peptidase M23 [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 344

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q V+ G  I   G +G +   +
Sbjct: 265 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQDVTAGQKIATMGSTGTSS-VR 323

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 324 LHFEIRYKGKSVNPLRFLPQR 344


>gi|154148472|ref|YP_001406114.1| M24/M37 family peptidase [Campylobacter hominis ATCC BAA-381]
 gi|153804481|gb|ABS51488.1| peptidase, M23/M37 family [Campylobacter hominis ATCC BAA-381]
          Length = 255

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 48/80 (60%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++ +  D    GN+++I H   I + Y H+    VQ  ++V+RG  IGLSG+SG    P 
Sbjct: 168 IVRIAKDRYYAGNSVVIDHGGGIFSQYYHLSKISVQPNERVNRGQIIGLSGQSGRVTGPH 227

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HF +  N I+++P+ F+E+
Sbjct: 228 LHFGIAINGISVNPLSFIEQ 247


>gi|227327751|ref|ZP_03831775.1| lipoprotein NlpD [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 340

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q V+ G  I   G +G +   +
Sbjct: 261 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQDVTAGQKIATMGSTGTSS-VR 319

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 320 LHFEIRYKGKSVNPLRFLPQR 340


>gi|28211685|ref|NP_782629.1| cell wall endopeptidase [Clostridium tetani E88]
 gi|28204127|gb|AAO36566.1| cell wall endopeptidase, family M23/M37 [Clostridium tetani E88]
          Length = 257

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 42/71 (59%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
           LG  IL+ H D I T Y H++   V+KGQ + +GH IG SG +G +  P +HFEL     
Sbjct: 187 LGKYILVDHGDGIETKYGHLNKINVKKGQTIGKGHVIGHSGNTGKSTEPHLHFELMYMGD 246

Query: 72  AMDPIKFLEEK 82
             DP +F+E K
Sbjct: 247 NKDPKEFIEMK 257


>gi|115359852|ref|YP_776990.1| peptidase M23B [Burkholderia ambifaria AMMD]
 gi|115285140|gb|ABI90656.1| peptidase M23B [Burkholderia ambifaria AMMD]
          Length = 345

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V ++G +    G  ++IRHD    + Y+H+    P ++ G +V RG  +G  G +G A 
Sbjct: 218 VVAFIGTEPGGYGKYVVIRHDGGYASYYAHLSAFEPTLRTGARVVRGQRVGAVGSTGTAT 277

Query: 59  HPQVHFELRKNAIAMDPIKFLE 80
            P +HFE+R++A  +DPI+ ++
Sbjct: 278 GPHLHFEVRRHARLVDPIELVQ 299


>gi|256751921|ref|ZP_05492792.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1]
 gi|256749226|gb|EEU62259.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1]
          Length = 452

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H +  VT Y H     V+KG KV++G  I L G +G A  P +HFE+RKN + 
Sbjct: 383 GYLVKIDHHNGYVTYYGHASKLLVKKGDKVAKGQKIALVGSTGRATGPHLHFEVRKNGVP 442

Query: 73  MDPIKFLEEK 82
           +DP+ FL  +
Sbjct: 443 IDPMPFLNRR 452


>gi|156932760|ref|YP_001436676.1| lipoprotein NlpD [Cronobacter sakazakii ATCC BAA-894]
 gi|156531014|gb|ABU75840.1| hypothetical protein ESA_00549 [Cronobacter sakazakii ATCC BAA-894]
          Length = 322

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G SG +   +
Sbjct: 243 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSSGTSST-R 301

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 302 LHFEIRYKGKSVNPLRYLPQR 322


>gi|323706153|ref|ZP_08117721.1| Peptidase M23 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534446|gb|EGB24229.1| Peptidase M23 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 401

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + + H +  VT Y H     V+KG KV++G  I L G +GN   P VHFE+RKN + 
Sbjct: 334 GNLVEVDHGNGYVTYYGHASKLLVKKGDKVNKGQEIALVGMTGNTTGPHVHFEVRKNGVP 393

Query: 73  MDPIKFLE 80
           ++P+ +L+
Sbjct: 394 VNPMMYLK 401


>gi|167036532|ref|YP_001664110.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167040956|ref|YP_001663941.1| peptidase M23B [Thermoanaerobacter sp. X514]
 gi|300913833|ref|ZP_07131150.1| Peptidase M23 [Thermoanaerobacter sp. X561]
 gi|307725481|ref|YP_003905232.1| peptidase M23 [Thermoanaerobacter sp. X513]
 gi|320114964|ref|YP_004185123.1| peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166855196|gb|ABY93605.1| peptidase M23B [Thermoanaerobacter sp. X514]
 gi|166855366|gb|ABY93774.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|300890518|gb|EFK85663.1| Peptidase M23 [Thermoanaerobacter sp. X561]
 gi|307582542|gb|ADN55941.1| Peptidase M23 [Thermoanaerobacter sp. X513]
 gi|319928055|gb|ADV78740.1| Peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 452

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H +  VT Y H     V+KG KV++G  I L G +G A  P +HFE+RKN + 
Sbjct: 383 GYLVKIDHHNGYVTYYGHASKLLVKKGDKVAKGQKIALVGSTGRATGPHLHFEVRKNGVP 442

Query: 73  MDPIKFLEEK 82
           +DP+ FL  +
Sbjct: 443 IDPMPFLNRR 452


>gi|78063788|ref|YP_373696.1| peptidase M23B [Burkholderia sp. 383]
 gi|77971673|gb|ABB13052.1| Peptidase M23B [Burkholderia sp. 383]
          Length = 454

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V ++G +    G  +++RHDD   + Y+H+    P ++ G +V+RG  +G  G +G A 
Sbjct: 327 VVTFIGTEPRGYGKYVVVRHDDGYASYYAHLSAFEPALRTGMRVARGQRVGAVGSTGTAT 386

Query: 59  HPQVHFELRKNAIAMDPIKFLE 80
            P +HFE+R++   +DP+  ++
Sbjct: 387 GPHLHFEVRRHDRLVDPVVLVQ 408


>gi|254468802|ref|ZP_05082208.1| peptidase M23B [beta proteobacterium KB13]
 gi|207087612|gb|EDZ64895.1| peptidase M23B [beta proteobacterium KB13]
          Length = 286

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G DL   G  I+I+HDD I++VY H     V +GQK+S G  I   G++ + +   
Sbjct: 206 VIYAGEDLKGYGKLIIIKHDDDILSVYGHNRELLVTEGQKISAGEIISTMGQTDDGK-IH 264

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK+ ++++P+ + + +
Sbjct: 265 LHFEIRKSGLSVNPMNYFKSR 285


>gi|42523482|ref|NP_968862.1| hypothetical protein Bd2006 [Bdellovibrio bacteriovorus HD100]
 gi|39575688|emb|CAE79855.1| nlpD4 [Bdellovibrio bacteriovorus HD100]
          Length = 193

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G +    G  +LI   +   T+Y+H D   V +GQKV +G  +G  G++G A    
Sbjct: 109 VIYAGREFRGYGKMVLIESGNGWATLYAHFDKILVSEGQKVRQGEVVGAMGRTGRATGVH 168

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RK+   +DP+  L
Sbjct: 169 LHFEVRKDRGPIDPLPLL 186


>gi|206562050|ref|YP_002232813.1| subfamily M23B metallopeptidase [Burkholderia cenocepacia J2315]
 gi|198038090|emb|CAR54038.1| metallo peptidase, subfamily M23B [Burkholderia cenocepacia J2315]
          Length = 457

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V ++G +    G  ++IRHD    + Y+H+    P ++ G +V RG  +G  G +G A 
Sbjct: 330 VVTFIGTEPRGYGKYVVIRHDGGYASYYAHLSAFEPTLRTGARVMRGQRVGAVGSTGTAT 389

Query: 59  HPQVHFELRKNAIAMDPIKFL 79
            P +HFE+R++A  +DPI+ +
Sbjct: 390 GPHLHFEVRRHARLVDPIELV 410


>gi|239815016|ref|YP_002943926.1| peptidase M23 [Variovorax paradoxus S110]
 gi|239801593|gb|ACS18660.1| Peptidase M23 [Variovorax paradoxus S110]
          Length = 167

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVG +L   GN ++I+H+++ +T Y+H  T  V++   V +G  I   GKS      +
Sbjct: 85  VVYVGGELRSYGNMVIIKHNETFLTAYAHAQTILVKENAVVRQGQKIAEMGKS-ETDRVK 143

Query: 62  VHFELRKNAIAMDPIKFLEEKI 83
           +HFE+RKN  A+DP  +L  ++
Sbjct: 144 LHFEIRKNGTAVDPEPYLNGRL 165


>gi|254252248|ref|ZP_04945566.1| Peptidoglycan-binding LysM [Burkholderia dolosa AUO158]
 gi|124894857|gb|EAY68737.1| Peptidoglycan-binding LysM [Burkholderia dolosa AUO158]
          Length = 293

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 214 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 272

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 273 LHFEVRRQGKPVDPLKYL 290


>gi|6643919|gb|AAF20815.1|AF198628_1 NlpD [Xenorhabdus nematophila]
          Length = 154

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HDD  ++ Y+H DT  V++ Q V  G  I   G +G +   +
Sbjct: 75  VVYAGNALRGYGNLIIIKHDDDYLSAYAHNDTMLVREQQDVQAGQKISTMGSTGTSS-VR 133

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 134 LHFEIRYKGKSVNPLRYLSQR 154


>gi|221212760|ref|ZP_03585736.1| LysM domain/M23 peptidase domain protein [Burkholderia multivorans
           CGD1]
 gi|221166973|gb|EED99443.1| LysM domain/M23 peptidase domain protein [Burkholderia multivorans
           CGD1]
          Length = 289

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 210 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 268

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 269 LHFEVRRQGKPVDPMKYL 286


>gi|260222310|emb|CBA31746.1| hypothetical protein Csp_D28660 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 236

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 2/75 (2%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            GN ++++H ++  TVY+H+    V+KGQ VS+G  IG  G +G A  P +HFE R N +
Sbjct: 130 FGNVVMVKHRNNQTTVYAHLSRINVKKGQNVSQGQNIGAVGATGWATGPHLHFEFRVNGV 189

Query: 72  AMDPIKFLE--EKIP 84
             DP+      E +P
Sbjct: 190 HHDPLTIARQSEAVP 204


>gi|311278283|ref|YP_003940514.1| Peptidase M23 [Enterobacter cloacae SCF1]
 gi|308747478|gb|ADO47230.1| Peptidase M23 [Enterobacter cloacae SCF1]
          Length = 372

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G SG +   +
Sbjct: 293 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSSGTSS-TR 351

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 352 LHFEIRYKGKSVNPLQYLPQR 372


>gi|167769369|ref|ZP_02441422.1| hypothetical protein ANACOL_00695 [Anaerotruncus colihominis DSM
           17241]
 gi|167668337|gb|EDS12467.1| hypothetical protein ANACOL_00695 [Anaerotruncus colihominis DSM
           17241]
          Length = 744

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H     TVY+H    YVQ GQ+VS+G TI   G++GNA  P +HFE+R N   
Sbjct: 676 GYRVIIDHGGGYQTVYAHCSALYVQAGQQVSQGDTIAAIGQTGNATGPHLHFEIRINGTP 735

Query: 73  MDPIKFL 79
           +D   +L
Sbjct: 736 VDAAPYL 742


>gi|269140217|ref|YP_003296918.1| outer membrane lipoprotein [Edwardsiella tarda EIB202]
 gi|267985878|gb|ACY85707.1| outer membrane lipoprotein [Edwardsiella tarda EIB202]
          Length = 316

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G A   +
Sbjct: 237 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTG-ASSVR 295

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 296 LHFEIRYKGKSVNPLQYLPQR 316


>gi|253998696|ref|YP_003050759.1| peptidase M23 [Methylovorus sp. SIP3-4]
 gi|253985375|gb|ACT50232.1| Peptidase M23 [Methylovorus sp. SIP3-4]
          Length = 354

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 52/83 (62%), Gaps = 1/83 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G+DL   G  ++I+H+ + ++VY+H +   V++GQ+VSRG  I   G S +    +
Sbjct: 273 VIYSGSDLRGYGKLVIIKHNKTYLSVYAHNNQILVKEGQQVSRGQKIAEMGNS-DTDKVK 331

Query: 62  VHFELRKNAIAMDPIKFLEEKIP 84
           +HFE+R+   ++DP K+L    P
Sbjct: 332 LHFEIRQQGKSVDPAKYLPGSNP 354


>gi|161524625|ref|YP_001579637.1| peptidase M23B [Burkholderia multivorans ATCC 17616]
 gi|189350619|ref|YP_001946247.1| lipoprotein [Burkholderia multivorans ATCC 17616]
 gi|160342054|gb|ABX15140.1| peptidase M23B [Burkholderia multivorans ATCC 17616]
 gi|189334641|dbj|BAG43711.1| lipoprotein [Burkholderia multivorans ATCC 17616]
          Length = 292

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 213 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 271

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 272 LHFEVRRQGKPVDPMKYL 289


>gi|291279746|ref|YP_003496581.1| hypothetical protein DEFDS_1364 [Deferribacter desulfuricans SSM1]
 gi|290754448|dbj|BAI80825.1| hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 387

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 46/71 (64%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
           LGN I+I HD    T+Y++ID   V KGQ+V +G  IG+     N +   ++FE+RK + 
Sbjct: 316 LGNIIIINHDRFFYTLYANIDEVLVAKGQQVKKGDKIGIIDVDLNNKSSYLYFEIRKESK 375

Query: 72  AMDPIKFLEEK 82
           A+DP+ +LE++
Sbjct: 376 AVDPLNWLEKR 386


>gi|124514648|gb|EAY56160.1| putative peptidase, M23B family [Leptospirillum rubarum]
          Length = 332

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+VG D    G T+ IRH D IVT++ H+   +V+ G +V RG  I   G +G +  P
Sbjct: 238 VVIWVGWD-AGFGKTVKIRHVDGIVTLFGHLSRYFVRMGDRVKRGQVIAALGNTGMSTGP 296

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+  NA  ++P+++ 
Sbjct: 297 HLHYEILVNAKPVNPLRYF 315


>gi|16126239|ref|NP_420803.1| M24/M37 family peptidase [Caulobacter crescentus CB15]
 gi|221235012|ref|YP_002517448.1| peptidoglycan binding endopeptidase DipM [Caulobacter crescentus
           NA1000]
 gi|13423465|gb|AAK23971.1| peptidase, M23/M37 family [Caulobacter crescentus CB15]
 gi|220964184|gb|ACL95540.1| peptidoglycan binding endopeptidase DipM [Caulobacter crescentus
           NA1000]
 gi|302486591|gb|ADL39794.1| DipM [Caulobacter crescentus CB15]
          Length = 609

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 42/76 (55%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           + Y GN +   GN +L++H D  VT Y+H+ +  V+  Q+V +G  +G  G +G    PQ
Sbjct: 524 IAYAGNQVPTFGNLVLVKHADGWVTAYAHLSSTNVKMRQQVKQGEQLGTVGATGGVNEPQ 583

Query: 62  VHFELRKNAIAMDPIK 77
           +HFE+R      D  K
Sbjct: 584 LHFEMRYAPTVKDKAK 599


>gi|221198090|ref|ZP_03571136.1| LysM domain/M23 peptidase domain protein [Burkholderia multivorans
           CGD2M]
 gi|221204351|ref|ZP_03577368.1| LysM domain/M23 peptidase domain protein [Burkholderia multivorans
           CGD2]
 gi|221175208|gb|EEE07638.1| LysM domain/M23 peptidase domain protein [Burkholderia multivorans
           CGD2]
 gi|221182022|gb|EEE14423.1| LysM domain/M23 peptidase domain protein [Burkholderia multivorans
           CGD2M]
          Length = 290

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 211 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 269

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 270 LHFEVRRQGKPVDPMKYL 287


>gi|163754031|ref|ZP_02161154.1| hypothetical protein KAOT1_20452 [Kordia algicida OT-1]
 gi|161326245|gb|EDP97571.1| hypothetical protein KAOT1_20452 [Kordia algicida OT-1]
          Length = 324

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (57%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+   N     G  I I H    V++Y+H+    V+KG+KV RG  IG  G +G +Q P
Sbjct: 222 VVVRADNSSSGFGKHIRIDHGYGYVSLYAHLSKYNVRKGRKVKRGDLIGFVGSTGRSQAP 281

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E+RKN   ++PI F
Sbjct: 282 HLHYEIRKNGEKINPINF 299


>gi|255994781|ref|ZP_05427916.1| peptidase, M23B family [Eubacterium saphenum ATCC 49989]
 gi|255993494|gb|EEU03583.1| peptidase, M23B family [Eubacterium saphenum ATCC 49989]
          Length = 385

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 42/68 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H   + T Y+H  +  V+ GQ VS+G  + LSG +G A  P  HFE+RKN  A
Sbjct: 318 GNLVVVDHGGGMATAYAHNSSIKVRVGQMVSKGQVLALSGMTGAATGPHCHFEVRKNGTA 377

Query: 73  MDPIKFLE 80
           ++P+ +L 
Sbjct: 378 VNPMSYLR 385


>gi|294634770|ref|ZP_06713299.1| lipoprotein [Edwardsiella tarda ATCC 23685]
 gi|291091829|gb|EFE24390.1| lipoprotein [Edwardsiella tarda ATCC 23685]
          Length = 313

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G A   +
Sbjct: 234 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTG-ASSVR 292

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 293 LHFEIRYKGKSVNPLQYLPQR 313


>gi|303325583|ref|ZP_07356026.1| M23 peptidase domain protein [Desulfovibrio sp. 3_1_syn3]
 gi|302863499|gb|EFL86430.1| M23 peptidase domain protein [Desulfovibrio sp. 3_1_syn3]
          Length = 296

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 41/69 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN++ I H   IVT Y H+    VQ GQ V RG  IG  G SG    P +H+E+R N + 
Sbjct: 228 GNSVEINHGGGIVTKYGHMQRWAVQPGQWVKRGEIIGYIGMSGRTTGPHLHYEVRLNGVP 287

Query: 73  MDPIKFLEE 81
           ++P++++ E
Sbjct: 288 VNPMRYILE 296


>gi|239980293|ref|ZP_04702817.1| M23 family secreted peptidase [Streptomyces albus J1074]
 gi|291452157|ref|ZP_06591547.1| peptidase [Streptomyces albus J1074]
 gi|291355106|gb|EFE82008.1| peptidase [Streptomyces albus J1074]
          Length = 237

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 3/78 (3%)

Query: 8   DLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR 67
           D    GN ++++H D+  T Y+H+    V  GQ V  G  I LSG +GN+  P +HFE+R
Sbjct: 158 DGPAYGNAVVVKHTDNTYTQYAHLSQINVSPGQTVKEGQKIALSGNTGNSSGPHLHFEVR 217

Query: 68  KN---AIAMDPIKFLEEK 82
            +     A+DP  FL  K
Sbjct: 218 TSPNYGSAIDPAAFLRSK 235


>gi|304320845|ref|YP_003854488.1| M23/M37 peptidase domain protein [Parvularcula bermudensis
           HTCC2503]
 gi|303299747|gb|ADM09346.1| M23/M37 peptidase domain protein [Parvularcula bermudensis
           HTCC2503]
          Length = 142

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G  +   G  + +RH   + T Y+H+    VQ G +V RG TIG +G SGNA    
Sbjct: 60  VIFAGW-MGGFGRLVKVRHKGEVETWYAHLSKFTVQPGSRVYRGQTIGFAGASGNATGAH 118

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R     +DP+ +L  +
Sbjct: 119 LHFEIRHRGKPVDPLLYLNTR 139


>gi|269101862|ref|ZP_06154559.1| hypothetical lipoprotein NlpD [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268161760|gb|EEZ40256.1| hypothetical lipoprotein NlpD [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 278

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+D  ++ Y+H D   V++ Q+V+ G  I L G +G A   +
Sbjct: 199 VVYAGNALRGYGNLVIIKHNDDYLSAYAHNDKLLVKEQQQVTAGQKIALMGDTG-ADSVK 257

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 258 LHFEIRYKGKSVDPLRYLPRQ 278


>gi|302535155|ref|ZP_07287497.1| peptidase [Streptomyces sp. C]
 gi|302444050|gb|EFL15866.1| peptidase [Streptomyces sp. C]
          Length = 205

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (56%), Gaps = 3/79 (3%)

Query: 6   GNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFE 65
           G D    GN I+I+H D+  + Y+H+    V+ GQKVS    I LSG +GN+  P +HFE
Sbjct: 122 GGDGPAYGNAIVIKHADNTYSQYAHLSKIQVRIGQKVSAAQQIALSGNTGNSSGPHLHFE 181

Query: 66  LRKN---AIAMDPIKFLEE 81
           +R       A++P+ FL  
Sbjct: 182 IRTTPNYGSAVNPVAFLRN 200


>gi|284048029|ref|YP_003398368.1| Peptidase M23 [Acidaminococcus fermentans DSM 20731]
 gi|283952250|gb|ADB47053.1| Peptidase M23 [Acidaminococcus fermentans DSM 20731]
          Length = 377

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 44/67 (65%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H   +VT+Y H  +  V +G++VS+G TI L+G +GN+  P  HFE+R +   
Sbjct: 310 GNAVMIDHGGGMVTLYGHNSSITVGEGEQVSKGQTIALAGSTGNSTGPHCHFEVRIHGEV 369

Query: 73  MDPIKFL 79
           + P+++L
Sbjct: 370 VSPLQYL 376


>gi|320180824|gb|EFW55747.1| Lipoprotein NlpD [Shigella boydii ATCC 9905]
          Length = 379

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|281179748|dbj|BAI56078.1| lipoprotein [Escherichia coli SE15]
          Length = 379

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|260869421|ref|YP_003235823.1| putative outer membrane lipoprotein NlpD [Escherichia coli O111:H-
           str. 11128]
 gi|257765777|dbj|BAI37272.1| predicted outer membrane lipoprotein NlpD [Escherichia coli O111:H-
           str. 11128]
 gi|323180168|gb|EFZ65720.1| lipoprotein nlpD [Escherichia coli 1180]
          Length = 379

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|22124744|ref|NP_668167.1| lipoprotein NlpD [Yersinia pestis KIM 10]
 gi|45440188|ref|NP_991727.1| lipoprotein NlpD [Yersinia pestis biovar Microtus str. 91001]
 gi|108808778|ref|YP_652694.1| lipoprotein NlpD [Yersinia pestis Antiqua]
 gi|108810902|ref|YP_646669.1| lipoprotein NlpD [Yersinia pestis Nepal516]
 gi|145600261|ref|YP_001164337.1| lipoprotein NlpD [Yersinia pestis Pestoides F]
 gi|153997600|ref|ZP_02022700.1| lipoprotein [Yersinia pestis CA88-4125]
 gi|218930374|ref|YP_002348249.1| lipoprotein NlpD [Yersinia pestis CO92]
 gi|229838983|ref|ZP_04459142.1| predicted outer membrane lipoprotein [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229896463|ref|ZP_04511631.1| predicted outer membrane lipoprotein [Yersinia pestis Pestoides A]
 gi|229899550|ref|ZP_04514691.1| predicted outer membrane lipoprotein [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229901115|ref|ZP_04516238.1| predicted outer membrane lipoprotein [Yersinia pestis Nepal516]
 gi|21957563|gb|AAM84418.1|AE013686_1 lipoprotein [Yersinia pestis KIM 10]
 gi|45435044|gb|AAS60604.1| lipoprotein [Yersinia pestis biovar Microtus str. 91001]
 gi|108774550|gb|ABG17069.1| lipoprotein [Yersinia pestis Nepal516]
 gi|108780691|gb|ABG14749.1| lipoprotein [Yersinia pestis Antiqua]
 gi|115348985|emb|CAL21945.1| lipoprotein [Yersinia pestis CO92]
 gi|145211957|gb|ABP41364.1| lipoprotein [Yersinia pestis Pestoides F]
 gi|149289237|gb|EDM39317.1| lipoprotein [Yersinia pestis CA88-4125]
 gi|224483371|gb|ACN50512.1| NlpD [Yersinia pestis]
 gi|229681840|gb|EEO77933.1| predicted outer membrane lipoprotein [Yersinia pestis Nepal516]
 gi|229687042|gb|EEO79117.1| predicted outer membrane lipoprotein [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229695349|gb|EEO85396.1| predicted outer membrane lipoprotein [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229700537|gb|EEO88568.1| predicted outer membrane lipoprotein [Yersinia pestis Pestoides A]
 gi|320016551|gb|ADW00123.1| putative outer membrane lipoprotein [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 333

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 254 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 312

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 313 LHFEIRYKGKSVNPLRYLPQR 333


>gi|238758206|ref|ZP_04619385.1| hypothetical protein yaldo0001_26160 [Yersinia aldovae ATCC 35236]
 gi|238703536|gb|EEP96074.1| hypothetical protein yaldo0001_26160 [Yersinia aldovae ATCC 35236]
          Length = 322

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 243 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 301

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 302 LHFEIRYKGKSVNPLRYLPQR 322


>gi|194431819|ref|ZP_03064110.1| lipoprotein NlpD [Shigella dysenteriae 1012]
 gi|194420175|gb|EDX36253.1| lipoprotein NlpD [Shigella dysenteriae 1012]
          Length = 379

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|162419853|ref|YP_001605523.1| lipoprotein NlpD [Yersinia pestis Angola]
 gi|165925754|ref|ZP_02221586.1| lipoprotein nlpD [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165936668|ref|ZP_02225235.1| lipoprotein nlpD [Yersinia pestis biovar Orientalis str. IP275]
 gi|166010173|ref|ZP_02231071.1| lipoprotein nlpD [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166213138|ref|ZP_02239173.1| lipoprotein nlpD [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167399591|ref|ZP_02305115.1| lipoprotein nlpD [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167421505|ref|ZP_02313258.1| lipoprotein nlpD [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167423088|ref|ZP_02314841.1| lipoprotein nlpD [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|270489293|ref|ZP_06206367.1| peptidase, M23 family [Yersinia pestis KIM D27]
 gi|294505064|ref|YP_003569126.1| lipoprotein nlpD [Yersinia pestis Z176003]
 gi|162352668|gb|ABX86616.1| lipoprotein nlpD [Yersinia pestis Angola]
 gi|165915317|gb|EDR33927.1| lipoprotein nlpD [Yersinia pestis biovar Orientalis str. IP275]
 gi|165922366|gb|EDR39543.1| lipoprotein nlpD [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165991080|gb|EDR43381.1| lipoprotein nlpD [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166205925|gb|EDR50405.1| lipoprotein nlpD [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166960424|gb|EDR56445.1| lipoprotein nlpD [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167052095|gb|EDR63503.1| lipoprotein nlpD [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167057258|gb|EDR67004.1| lipoprotein nlpD [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|262363124|gb|ACY59845.1| lipoprotein nlpD [Yersinia pestis D106004]
 gi|270337797|gb|EFA48574.1| peptidase, M23 family [Yersinia pestis KIM D27]
 gi|294355523|gb|ADE65864.1| lipoprotein nlpD [Yersinia pestis Z176003]
          Length = 327

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 248 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 306

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 307 LHFEIRYKGKSVNPLRYLPQR 327


>gi|300724641|ref|YP_003713966.1| lipoprotein [Xenorhabdus nematophila ATCC 19061]
 gi|297631183|emb|CBJ91878.1| lipoprotein [Xenorhabdus nematophila ATCC 19061]
          Length = 359

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HDD  ++ Y+H DT  V++ Q V  G  I   G +G +   +
Sbjct: 280 VVYAGNALRGYGNLIIIKHDDDYLSAYAHNDTMLVREQQDVQAGQKISTMGSTGTSS-VR 338

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 339 LHFEIRYKGKSVNPLRYLSQR 359


>gi|118076341|gb|ABK60038.1| putative peptidase [Streptomyces griseus]
          Length = 237

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 3/78 (3%)

Query: 8   DLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR 67
           D    GN ++++H D+  T Y+H+    V  GQ V  G  I LSG +GN+  P +HFE+R
Sbjct: 158 DGPAYGNAVVVKHADNTYTQYAHLSQINVSPGQTVKEGQKIALSGNTGNSSGPHLHFEVR 217

Query: 68  KN---AIAMDPIKFLEEK 82
            +     A+DP  FL  K
Sbjct: 218 TSPNYGSAIDPAAFLRSK 235


>gi|84515551|ref|ZP_01002913.1| peptidase, M23/M37 family [Loktanella vestfoldensis SKA53]
 gi|84510834|gb|EAQ07289.1| peptidase, M23/M37 family [Loktanella vestfoldensis SKA53]
          Length = 430

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 43/67 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I IRHD  + T Y+H++T  V+ GQ+VSRG  IG  G SG +  P +H+E+R N   
Sbjct: 357 GRLITIRHDFGLETRYAHLNTIDVRVGQRVSRGDRIGAMGNSGRSTGPHLHYEVRVNGNP 416

Query: 73  MDPIKFL 79
           ++P+ ++
Sbjct: 417 VNPMTYI 423


>gi|157158958|ref|YP_001464065.1| lipoprotein NlpD [Escherichia coli E24377A]
 gi|157162190|ref|YP_001459508.1| lipoprotein NlpD [Escherichia coli HS]
 gi|170019012|ref|YP_001723966.1| lipoprotein NlpD [Escherichia coli ATCC 8739]
 gi|191166807|ref|ZP_03028633.1| lipoprotein NlpD [Escherichia coli B7A]
 gi|193064994|ref|ZP_03046069.1| lipoprotein NlpD [Escherichia coli E22]
 gi|193069679|ref|ZP_03050631.1| lipoprotein NlpD [Escherichia coli E110019]
 gi|194427802|ref|ZP_03060348.1| lipoprotein NlpD [Escherichia coli B171]
 gi|194438973|ref|ZP_03071057.1| lipoprotein NlpD [Escherichia coli 101-1]
 gi|209920185|ref|YP_002294269.1| lipoprotein NlpD [Escherichia coli SE11]
 gi|218696340|ref|YP_002404007.1| lipoprotein NlpD [Escherichia coli 55989]
 gi|253772402|ref|YP_003035233.1| lipoprotein NlpD [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254037784|ref|ZP_04871842.1| lipoprotein nlpD [Escherichia sp. 1_1_43]
 gi|254162673|ref|YP_003045781.1| lipoprotein NlpD [Escherichia coli B str. REL606]
 gi|256024750|ref|ZP_05438615.1| lipoprotein NlpD [Escherichia sp. 4_1_40B]
 gi|260845389|ref|YP_003223167.1| putative outer membrane lipoprotein NlpD [Escherichia coli O103:H2
           str. 12009]
 gi|260856853|ref|YP_003230744.1| putative outer membrane lipoprotein NlpD [Escherichia coli O26:H11
           str. 11368]
 gi|297518366|ref|ZP_06936752.1| lipoprotein NlpD [Escherichia coli OP50]
 gi|307139430|ref|ZP_07498786.1| lipoprotein NlpD [Escherichia coli H736]
 gi|312973047|ref|ZP_07787220.1| lipoprotein nlpD [Escherichia coli 1827-70]
 gi|331643428|ref|ZP_08344559.1| lipoprotein NlpD [Escherichia coli H736]
 gi|157067870|gb|ABV07125.1| lipoprotein NlpD [Escherichia coli HS]
 gi|157080988|gb|ABV20696.1| lipoprotein NlpD [Escherichia coli E24377A]
 gi|169753940|gb|ACA76639.1| peptidase M23B [Escherichia coli ATCC 8739]
 gi|190903178|gb|EDV62901.1| lipoprotein NlpD [Escherichia coli B7A]
 gi|192927291|gb|EDV81910.1| lipoprotein NlpD [Escherichia coli E22]
 gi|192957042|gb|EDV87493.1| lipoprotein NlpD [Escherichia coli E110019]
 gi|194414035|gb|EDX30311.1| lipoprotein NlpD [Escherichia coli B171]
 gi|194422094|gb|EDX38097.1| lipoprotein NlpD [Escherichia coli 101-1]
 gi|209913444|dbj|BAG78518.1| lipoprotein [Escherichia coli SE11]
 gi|218353072|emb|CAU98897.1| outer membrane lipoprotein [Escherichia coli 55989]
 gi|226839408|gb|EEH71429.1| lipoprotein nlpD [Escherichia sp. 1_1_43]
 gi|242378297|emb|CAQ33074.1| NlpD putative outer membrane lipoprotein [Escherichia coli
           BL21(DE3)]
 gi|253323446|gb|ACT28048.1| Peptidase M23 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974574|gb|ACT40245.1| predicted outer membrane lipoprotein [Escherichia coli B str.
           REL606]
 gi|253978741|gb|ACT44411.1| predicted outer membrane lipoprotein [Escherichia coli BL21(DE3)]
 gi|257755502|dbj|BAI27004.1| predicted outer membrane lipoprotein NlpD [Escherichia coli O26:H11
           str. 11368]
 gi|257760536|dbj|BAI32033.1| predicted outer membrane lipoprotein NlpD [Escherichia coli O103:H2
           str. 12009]
 gi|309703101|emb|CBJ02433.1| lipoprotein [Escherichia coli ETEC H10407]
 gi|310332989|gb|EFQ00203.1| lipoprotein nlpD [Escherichia coli 1827-70]
 gi|315062023|gb|ADT76350.1| predicted outer membrane lipoprotein [Escherichia coli W]
 gi|315615131|gb|EFU95768.1| lipoprotein nlpD [Escherichia coli 3431]
 gi|320202393|gb|EFW76963.1| Lipoprotein NlpD [Escherichia coli EC4100B]
 gi|323183274|gb|EFZ68671.1| lipoprotein nlpD [Escherichia coli 1357]
 gi|323377394|gb|ADX49662.1| Peptidase M23 [Escherichia coli KO11]
 gi|323935701|gb|EGB32015.1| peptidase M23 [Escherichia coli E1520]
 gi|323941427|gb|EGB37610.1| peptidase M23 [Escherichia coli E482]
 gi|323946372|gb|EGB42400.1| peptidase M23 [Escherichia coli H120]
 gi|323960598|gb|EGB56224.1| peptidase M23 [Escherichia coli H489]
 gi|323971529|gb|EGB66762.1| peptidase M23 [Escherichia coli TA007]
 gi|324119996|gb|EGC13874.1| peptidase M23 [Escherichia coli E1167]
 gi|331036899|gb|EGI09123.1| lipoprotein NlpD [Escherichia coli H736]
          Length = 379

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|82545185|ref|YP_409132.1| lipoprotein NlpD [Shigella boydii Sb227]
 gi|187730414|ref|YP_001881515.1| lipoprotein NlpD [Shigella boydii CDC 3083-94]
 gi|81246596|gb|ABB67304.1| lipoprotein [Shigella boydii Sb227]
 gi|187427406|gb|ACD06680.1| lipoprotein NlpD [Shigella boydii CDC 3083-94]
 gi|320173408|gb|EFW48607.1| Lipoprotein NlpD [Shigella dysenteriae CDC 74-1112]
 gi|320186526|gb|EFW61254.1| Lipoprotein NlpD [Shigella flexneri CDC 796-83]
          Length = 363

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 284 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 342

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 343 LHFEIRYKGKSVNPLRYLPQR 363


>gi|83312966|ref|YP_423230.1| membrane protein related to metalloendopeptidase [Magnetospirillum
           magneticum AMB-1]
 gi|82947807|dbj|BAE52671.1| Membrane protein related to metalloendopeptidase [Magnetospirillum
           magneticum AMB-1]
          Length = 426

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 44/67 (65%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T+ + H + + T Y+H+    V++GQKV+R   +GL G +G +  P +H+E+R + IA
Sbjct: 350 GLTVDVNHGNGVTTRYAHMSRIKVKEGQKVTRSTVVGLLGNTGRSTGPHLHYEVRVSDIA 409

Query: 73  MDPIKFL 79
            DP+KF+
Sbjct: 410 KDPLKFI 416


>gi|268681866|ref|ZP_06148728.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268622150|gb|EEZ54550.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
          Length = 403

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L E GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 325 VVYAGSGLREYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 383

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 384 LHFEVRQNGKPVNPNSYI 401


>gi|331648465|ref|ZP_08349553.1| lipoprotein NlpD [Escherichia coli M605]
 gi|330908778|gb|EGH37292.1| lipoprotein NlpD [Escherichia coli AA86]
 gi|331042212|gb|EGI14354.1| lipoprotein NlpD [Escherichia coli M605]
          Length = 379

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|306812376|ref|ZP_07446574.1| lipoprotein NlpD [Escherichia coli NC101]
 gi|305854414|gb|EFM54852.1| lipoprotein NlpD [Escherichia coli NC101]
          Length = 379

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|218547742|ref|YP_002381533.1| lipoprotein NlpD [Escherichia fergusonii ATCC 35469]
 gi|218355283|emb|CAQ87890.1| outer membrane lipoprotein [Escherichia fergusonii ATCC 35469]
 gi|325496209|gb|EGC94068.1| lipoprotein NlpD [Escherichia fergusonii ECD227]
          Length = 380

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 301 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 359

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 360 LHFEIRYKGKSVNPLRYLPQR 380


>gi|91212109|ref|YP_542095.1| lipoprotein NlpD [Escherichia coli UTI89]
 gi|91073683|gb|ABE08564.1| lipoprotein NlpD precursor [Escherichia coli UTI89]
          Length = 379

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|16130649|ref|NP_417222.1| activator of AmiC murein hydrolase activity, lipoprotein
           [Escherichia coli str. K-12 substr. MG1655]
 gi|30064099|ref|NP_838270.1| lipoprotein NlpD [Shigella flexneri 2a str. 2457T]
 gi|56480176|ref|NP_708547.2| lipoprotein NlpD [Shigella flexneri 2a str. 301]
 gi|74313308|ref|YP_311727.1| lipoprotein NlpD [Shigella sonnei Ss046]
 gi|82778109|ref|YP_404458.1| lipoprotein NlpD [Shigella dysenteriae Sd197]
 gi|89109529|ref|AP_003309.1| predicted outer membrane lipoprotein [Escherichia coli str. K-12
           substr. W3110]
 gi|110642883|ref|YP_670613.1| lipoprotein NlpD [Escherichia coli 536]
 gi|110806627|ref|YP_690147.1| lipoprotein NlpD [Shigella flexneri 5 str. 8401]
 gi|117624977|ref|YP_853965.1| lipoprotein NlpD [Escherichia coli APEC O1]
 gi|170082317|ref|YP_001731637.1| outer membrane lipoprotein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170679671|ref|YP_001744891.1| lipoprotein NlpD [Escherichia coli SMS-3-5]
 gi|188494507|ref|ZP_03001777.1| lipoprotein NlpD [Escherichia coli 53638]
 gi|191171266|ref|ZP_03032816.1| lipoprotein NlpD [Escherichia coli F11]
 gi|218555289|ref|YP_002388202.1| lipoprotein NlpD [Escherichia coli IAI1]
 gi|218559735|ref|YP_002392648.1| lipoprotein NlpD [Escherichia coli S88]
 gi|218690869|ref|YP_002399081.1| lipoprotein NlpD [Escherichia coli ED1a]
 gi|218701233|ref|YP_002408862.1| lipoprotein NlpD [Escherichia coli IAI39]
 gi|218706236|ref|YP_002413755.1| lipoprotein NlpD [Escherichia coli UMN026]
 gi|237706629|ref|ZP_04537110.1| lipoprotein NlpD [Escherichia sp. 3_2_53FAA]
 gi|238901879|ref|YP_002927675.1| putative outer membrane lipoprotein [Escherichia coli BW2952]
 gi|256019473|ref|ZP_05433338.1| lipoprotein NlpD [Shigella sp. D9]
 gi|293406234|ref|ZP_06650160.1| nlpD [Escherichia coli FVEC1412]
 gi|293412097|ref|ZP_06654820.1| nlpD [Escherichia coli B354]
 gi|293415988|ref|ZP_06658628.1| nlpD [Escherichia coli B185]
 gi|298381971|ref|ZP_06991568.1| nlpD [Escherichia coli FVEC1302]
 gi|301027335|ref|ZP_07190676.1| peptidase, M23 family [Escherichia coli MS 196-1]
 gi|332280595|ref|ZP_08393008.1| outer membrane lipoprotein [Shigella sp. D9]
 gi|83305830|sp|P0ADA3|NLPD_ECOLI RecName: Full=Lipoprotein nlpD; Flags: Precursor
 gi|83305831|sp|P0ADA4|NLPD_SHIFL RecName: Full=Lipoprotein nlpD; Flags: Precursor
 gi|433185|gb|AAA17875.1| lipoprotein precursor [Escherichia coli]
 gi|882635|gb|AAA69252.1| lipoprotein NlpD precursor [Escherichia coli str. K-12 substr.
           MG1655]
 gi|1789099|gb|AAC75784.1| activator of AmiC murein hydrolase activity, lipoprotein
           [Escherichia coli str. K-12 substr. MG1655]
 gi|30042355|gb|AAP18080.1| lipoprotein [Shigella flexneri 2a str. 2457T]
 gi|56383727|gb|AAN44254.2| lipoprotein [Shigella flexneri 2a str. 301]
 gi|73856785|gb|AAZ89492.1| lipoprotein [Shigella sonnei Ss046]
 gi|81242257|gb|ABB62967.1| lipoprotein [Shigella dysenteriae Sd197]
 gi|85675563|dbj|BAE76819.1| predicted outer membrane lipoprotein [Escherichia coli str. K12
           substr. W3110]
 gi|110344475|gb|ABG70712.1| lipoprotein NlpD precursor [Escherichia coli 536]
 gi|110616175|gb|ABF04842.1| lipoprotein [Shigella flexneri 5 str. 8401]
 gi|115514101|gb|ABJ02176.1| putative outer membrane lipoprotein [Escherichia coli APEC O1]
 gi|169890152|gb|ACB03859.1| predicted outer membrane lipoprotein [Escherichia coli str. K-12
           substr. DH10B]
 gi|170517389|gb|ACB15567.1| lipoprotein NlpD [Escherichia coli SMS-3-5]
 gi|188489706|gb|EDU64809.1| lipoprotein NlpD [Escherichia coli 53638]
 gi|190908566|gb|EDV68155.1| lipoprotein NlpD [Escherichia coli F11]
 gi|218362057|emb|CAQ99666.1| outer membrane lipoprotein [Escherichia coli IAI1]
 gi|218366504|emb|CAR04256.1| outer membrane lipoprotein [Escherichia coli S88]
 gi|218371219|emb|CAR19050.1| outer membrane lipoprotein [Escherichia coli IAI39]
 gi|218428433|emb|CAR09213.1| outer membrane lipoprotein [Escherichia coli ED1a]
 gi|218433333|emb|CAR14233.1| outer membrane lipoprotein [Escherichia coli UMN026]
 gi|222034439|emb|CAP77181.1| Lipoprotein nlpD [Escherichia coli LF82]
 gi|226899669|gb|EEH85928.1| lipoprotein NlpD [Escherichia sp. 3_2_53FAA]
 gi|238862709|gb|ACR64707.1| predicted outer membrane lipoprotein [Escherichia coli BW2952]
 gi|260448207|gb|ACX38629.1| Peptidase M23 [Escherichia coli DH1]
 gi|281602113|gb|ADA75097.1| Lipoprotein NlpD [Shigella flexneri 2002017]
 gi|284922678|emb|CBG35766.1| lipoprotein [Escherichia coli 042]
 gi|291426240|gb|EFE99272.1| nlpD [Escherichia coli FVEC1412]
 gi|291432177|gb|EFF05159.1| nlpD [Escherichia coli B185]
 gi|291468868|gb|EFF11359.1| nlpD [Escherichia coli B354]
 gi|294491833|gb|ADE90589.1| lipoprotein NlpD [Escherichia coli IHE3034]
 gi|298277111|gb|EFI18627.1| nlpD [Escherichia coli FVEC1302]
 gi|299879328|gb|EFI87539.1| peptidase, M23 family [Escherichia coli MS 196-1]
 gi|312947274|gb|ADR28101.1| lipoprotein NlpD [Escherichia coli O83:H1 str. NRG 857C]
 gi|315137349|dbj|BAJ44508.1| nlpD [Escherichia coli DH1]
 gi|320194881|gb|EFW69510.1| Lipoprotein NlpD [Escherichia coli WV_060327]
 gi|323188841|gb|EFZ74126.1| lipoprotein nlpD [Escherichia coli RN587/1]
 gi|323951036|gb|EGB46912.1| peptidase M23 [Escherichia coli H252]
 gi|323957043|gb|EGB52768.1| peptidase M23 [Escherichia coli H263]
 gi|332102947|gb|EGJ06293.1| outer membrane lipoprotein [Shigella sp. D9]
 gi|1090176|prf||2018294A lipoprotein
          Length = 379

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|324111375|gb|EGC05357.1| peptidase M23 [Escherichia fergusonii B253]
          Length = 380

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 301 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 359

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 360 LHFEIRYKGKSVNPLRYLPQR 380


>gi|268598709|ref|ZP_06132876.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268601067|ref|ZP_06135234.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|291044121|ref|ZP_06569837.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|268582840|gb|EEZ47516.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268585198|gb|EEZ49874.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|291012584|gb|EFE04573.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
          Length = 403

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L E GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 325 VVYAGSGLREYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 383

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 384 LHFEVRQNGKPVNPNSYI 401


>gi|170765928|ref|ZP_02900739.1| lipoprotein NlpD [Escherichia albertii TW07627]
 gi|170125074|gb|EDS94005.1| lipoprotein NlpD [Escherichia albertii TW07627]
          Length = 386

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 307 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 365

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 366 LHFEIRYKGKSVNPLRYLPQR 386


>gi|170025641|ref|YP_001722146.1| lipoprotein NlpD [Yersinia pseudotuberculosis YPIII]
 gi|186894138|ref|YP_001871250.1| lipoprotein NlpD [Yersinia pseudotuberculosis PB1/+]
 gi|169752175|gb|ACA69693.1| peptidase M23B [Yersinia pseudotuberculosis YPIII]
 gi|186697164|gb|ACC87793.1| Peptidase M23 [Yersinia pseudotuberculosis PB1/+]
          Length = 327

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 248 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 306

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 307 LHFEIRYKGKSVNPLRYLPQR 327


>gi|153947948|ref|YP_001402251.1| lipoprotein NlpD [Yersinia pseudotuberculosis IP 31758]
 gi|152959443|gb|ABS46904.1| lipoprotein nlpD [Yersinia pseudotuberculosis IP 31758]
          Length = 327

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 248 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 306

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 307 LHFEIRYKGKSVNPLRYLPQR 327


>gi|322614254|gb|EFY11185.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322621682|gb|EFY18535.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322624543|gb|EFY21376.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322633399|gb|EFY30141.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322636025|gb|EFY32733.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322639618|gb|EFY36304.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322646917|gb|EFY43420.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322652218|gb|EFY48577.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322654703|gb|EFY51022.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322658924|gb|EFY55177.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322664509|gb|EFY60703.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322668242|gb|EFY64399.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322673778|gb|EFY69879.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322677839|gb|EFY73902.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322681331|gb|EFY77363.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322683733|gb|EFY79743.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323193879|gb|EFZ79082.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323200348|gb|EFZ85430.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323202370|gb|EFZ87414.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323205604|gb|EFZ90569.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323216418|gb|EGA01145.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323220765|gb|EGA05206.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323226391|gb|EGA10599.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323230729|gb|EGA14847.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323234920|gb|EGA19006.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323238959|gb|EGA23009.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323241659|gb|EGA25690.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323248194|gb|EGA32130.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323251222|gb|EGA35095.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323257394|gb|EGA41090.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323263242|gb|EGA46780.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323264256|gb|EGA47762.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323271082|gb|EGA54510.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 377

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|297158240|gb|ADI07952.1| secreted peptidase [Streptomyces bingchenggensis BCW-1]
          Length = 211

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN ++IRH D + + Y+H+ +  V  GQK+  G  IGLSG +GN   P +H E+R +   
Sbjct: 135 GNQVIIRHSDGMYSQYAHLSSLTVSAGQKIKAGQKIGLSGATGNVSGPHLHMEIRNSPAY 194

Query: 70  AIAMDPIKFLEE 81
              +DP+++L +
Sbjct: 195 GTDIDPLRYLRQ 206


>gi|215488062|ref|YP_002330493.1| lipoprotein NlpD [Escherichia coli O127:H6 str. E2348/69]
 gi|215266134|emb|CAS10560.1| predicted outer membrane lipoprotein [Escherichia coli O127:H6 str.
           E2348/69]
          Length = 379

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|168749932|ref|ZP_02774954.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4113]
 gi|168755488|ref|ZP_02780495.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4401]
 gi|168768835|ref|ZP_02793842.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4486]
 gi|168774724|ref|ZP_02799731.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4196]
 gi|168778726|ref|ZP_02803733.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4076]
 gi|195939454|ref|ZP_03084836.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4024]
 gi|208806036|ref|ZP_03248373.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4206]
 gi|208814031|ref|ZP_03255360.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4045]
 gi|208821071|ref|ZP_03261391.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4042]
 gi|209400494|ref|YP_002272205.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4115]
 gi|254794682|ref|YP_003079519.1| lipoprotein NlpD [Escherichia coli O157:H7 str. TW14359]
 gi|187769624|gb|EDU33468.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4196]
 gi|188015835|gb|EDU53957.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4113]
 gi|189003514|gb|EDU72500.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4076]
 gi|189357376|gb|EDU75795.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4401]
 gi|189362066|gb|EDU80485.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4486]
 gi|208725837|gb|EDZ75438.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4206]
 gi|208735308|gb|EDZ83995.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4045]
 gi|208741194|gb|EDZ88876.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4042]
 gi|209161894|gb|ACI39327.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4115]
 gi|254594082|gb|ACT73443.1| predicted outer membrane lipoprotein [Escherichia coli O157:H7 str.
           TW14359]
          Length = 363

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 284 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 342

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 343 LHFEIRYKGKSVNPLRYLPQR 363


>gi|15803259|ref|NP_289291.1| lipoprotein NlpD [Escherichia coli O157:H7 EDL933]
 gi|15832850|ref|NP_311623.1| lipoprotein NlpD [Escherichia coli O157:H7 str. Sakai]
 gi|168762857|ref|ZP_02787864.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4501]
 gi|168787998|ref|ZP_02813005.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC869]
 gi|168800178|ref|ZP_02825185.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC508]
 gi|217327536|ref|ZP_03443619.1| lipoprotein NlpD [Escherichia coli O157:H7 str. TW14588]
 gi|261226036|ref|ZP_05940317.1| lipoprotein NlpD [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256707|ref|ZP_05949240.1| lipoprotein NlpD [Escherichia coli O157:H7 str. FRIK966]
 gi|291284069|ref|YP_003500887.1| Lipoprotein [Escherichia coli O55:H7 str. CB9615]
 gi|12517196|gb|AAG57849.1|AE005502_3 lipoprotein [Escherichia coli O157:H7 str. EDL933]
 gi|13363067|dbj|BAB37019.1| putative lipoprotein [Escherichia coli O157:H7 str. Sakai]
 gi|189366917|gb|EDU85333.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4501]
 gi|189372137|gb|EDU90553.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC869]
 gi|189377501|gb|EDU95917.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC508]
 gi|217319903|gb|EEC28328.1| lipoprotein NlpD [Escherichia coli O157:H7 str. TW14588]
 gi|290763942|gb|ADD57903.1| Lipoprotein [Escherichia coli O55:H7 str. CB9615]
 gi|320189071|gb|EFW63730.1| Lipoprotein NlpD [Escherichia coli O157:H7 str. EC1212]
 gi|320640385|gb|EFX09924.1| lipoprotein NlpD [Escherichia coli O157:H7 str. G5101]
 gi|320645932|gb|EFX14913.1| lipoprotein NlpD [Escherichia coli O157:H- str. 493-89]
 gi|320651232|gb|EFX19667.1| lipoprotein NlpD [Escherichia coli O157:H- str. H 2687]
 gi|320656782|gb|EFX24670.1| lipoprotein NlpD [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320662324|gb|EFX29721.1| lipoprotein NlpD [Escherichia coli O55:H7 str. USDA 5905]
 gi|320667376|gb|EFX34334.1| lipoprotein NlpD [Escherichia coli O157:H7 str. LSU-61]
 gi|326339190|gb|EGD63005.1| Lipoprotein NlpD [Escherichia coli O157:H7 str. 1044]
 gi|326342927|gb|EGD66695.1| Lipoprotein NlpD [Escherichia coli O157:H7 str. 1125]
          Length = 379

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|16766231|ref|NP_461846.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167550224|ref|ZP_02343981.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|168230999|ref|ZP_02656057.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168242665|ref|ZP_02667597.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168261947|ref|ZP_02683920.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|168820375|ref|ZP_02832375.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194444146|ref|YP_002042166.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194451660|ref|YP_002046883.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194471325|ref|ZP_03077309.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|197251233|ref|YP_002147822.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197264254|ref|ZP_03164328.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|200386978|ref|ZP_03213590.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205353866|ref|YP_002227667.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207858185|ref|YP_002244836.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|20141556|sp|P40827|NLPD_SALTY RecName: Full=Lipoprotein nlpD; Flags: Precursor
 gi|16421474|gb|AAL21805.1| lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|194402809|gb|ACF63031.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194409964|gb|ACF70183.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194457689|gb|EDX46528.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|197214936|gb|ACH52333.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197242509|gb|EDY25129.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|199604076|gb|EDZ02621.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205273647|emb|CAR38636.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205324818|gb|EDZ12657.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205334456|gb|EDZ21220.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205337974|gb|EDZ24738.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205342848|gb|EDZ29612.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205349313|gb|EDZ35944.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|206709988|emb|CAR34343.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261248061|emb|CBG25895.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995055|gb|ACY89940.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301159484|emb|CBW19003.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312913943|dbj|BAJ37917.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|320087328|emb|CBY97093.1| DNA-directed RNA polymerase subunit beta RNAP subunit beta;
           Transcriptase subunit beta; RNA polymerase subunit beta
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|323131277|gb|ADX18707.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|326628976|gb|EGE35319.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 377

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|198243830|ref|YP_002216891.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|13432179|sp|P39700|NLPD_SALDU RecName: Full=Lipoprotein nlpD; Flags: Precursor
 gi|3150246|emb|CAA06881.1| nlpD [Salmonella enterica subsp. enterica serovar Dublin]
 gi|197938346|gb|ACH75679.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|326624654|gb|EGE30999.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 377

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|56414873|ref|YP_151948.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197363801|ref|YP_002143438.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|56129130|gb|AAV78636.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197095278|emb|CAR60831.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 377

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|26249147|ref|NP_755187.1| lipoprotein NlpD [Escherichia coli CFT073]
 gi|227888285|ref|ZP_04006090.1| lipoprotein NlpD [Escherichia coli 83972]
 gi|26109554|gb|AAN81757.1|AE016765_159 Lipoprotein nlpD precursor [Escherichia coli CFT073]
 gi|227834554|gb|EEJ45020.1| lipoprotein NlpD [Escherichia coli 83972]
 gi|307554721|gb|ADN47496.1| lipoprotein NlpD precursor [Escherichia coli ABU 83972]
          Length = 379

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|51595125|ref|YP_069316.1| lipoprotein NlpD [Yersinia pseudotuberculosis IP 32953]
 gi|51588407|emb|CAH20015.1| lipoprotein [Yersinia pseudotuberculosis IP 32953]
          Length = 333

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 254 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 312

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 313 LHFEIRYKGKSVNPLRYLPQR 333


>gi|323978650|gb|EGB73732.1| peptidase M23 [Escherichia coli TW10509]
          Length = 379

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|323966894|gb|EGB62323.1| peptidase M23 [Escherichia coli M863]
 gi|327251470|gb|EGE63156.1| lipoprotein nlpD [Escherichia coli STEC_7v]
          Length = 379

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|204928307|ref|ZP_03219507.1| lipoprotein [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|204322629|gb|EDZ07826.1| lipoprotein [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
          Length = 377

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|121533973|ref|ZP_01665799.1| peptidase M23B [Thermosinus carboxydivorans Nor1]
 gi|121307484|gb|EAX48400.1| peptidase M23B [Thermosinus carboxydivorans Nor1]
          Length = 108

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H + I T+Y H     V  GQ V +G  I  +G +G +  P VH+E+R N  A
Sbjct: 35  GNIVQINHGNGIETIYGHNSQIAVSVGQSVRKGQVIAYAGSTGKSTGPHVHYEVRVNGTA 94

Query: 73  MDPIKFL 79
           +DPIKFL
Sbjct: 95  VDPIKFL 101


>gi|107029000|ref|YP_626095.1| peptidase M23B [Burkholderia cenocepacia AU 1054]
 gi|116689842|ref|YP_835465.1| peptidase M23B [Burkholderia cenocepacia HI2424]
 gi|254248063|ref|ZP_04941384.1| Peptidoglycan-binding LysM [Burkholderia cenocepacia PC184]
 gi|105898164|gb|ABF81122.1| peptidase M23B [Burkholderia cenocepacia AU 1054]
 gi|116647931|gb|ABK08572.1| peptidase M23B [Burkholderia cenocepacia HI2424]
 gi|124872839|gb|EAY64555.1| Peptidoglycan-binding LysM [Burkholderia cenocepacia PC184]
          Length = 296

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 217 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 275

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 276 LHFEVRRQGKPVDPLKYL 293


>gi|114562237|ref|YP_749750.1| peptidase M23B [Shewanella frigidimarina NCIMB 400]
 gi|114333530|gb|ABI70912.1| peptidase M23B [Shewanella frigidimarina NCIMB 400]
          Length = 309

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 52/81 (64%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+D  ++ Y+H DT  V++ Q VS G T+   G +G  Q   
Sbjct: 230 VVYAGNALRGYGNLVIIKHNDDFLSAYAHADTILVKEKQYVSAGQTVAKMGSTGTHQV-M 288

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+++L ++
Sbjct: 289 LHFEVRFHGKSVNPLRYLPKQ 309


>gi|190571142|ref|YP_001975500.1| Putative Lipoprotein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018546|ref|ZP_03334354.1| putative Lipoprotein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357414|emb|CAQ54848.1| Putative Lipoprotein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995497|gb|EEB56137.1| putative Lipoprotein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 196

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNA-QHP 60
           VIYVG  L   GN I++ H D+ +T+YS++    V+ G KV +G  IG +GKS    + P
Sbjct: 115 VIYVGKGLRWYGNLIIVEHKDNYMTMYSYLKNIQVEIGDKVKQGQVIGSAGKSSTQDKDP 174

Query: 61  QVHFELRKNAIAMDPI 76
           Q+ F +R N  A+DP+
Sbjct: 175 QMCFTIRHNGQAVDPL 190


>gi|311106596|ref|YP_003979449.1| LysM domain-containing protein 3 [Achromobacter xylosoxidans A8]
 gi|310761285|gb|ADP16734.1| LysM domain protein 3 [Achromobacter xylosoxidans A8]
          Length = 284

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN +  LGN I++ H +  +T Y+H     V+ GQ V RG  I   G+S +   P
Sbjct: 204 LVKYSGNGVRGLGNLIIVEHQNGFITAYAHNRAVLVKTGQTVKRGAKIAELGQS-DTTSP 262

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
           ++HFE+R+    +DP+++L  K
Sbjct: 263 RLHFEIRRQGQPVDPMQYLPAK 284


>gi|302038995|ref|YP_003799317.1| hypothetical protein NIDE3714 [Candidatus Nitrospira defluvii]
 gi|300607059|emb|CBK43392.1| conserved protein of unknown function, putative Peptidase M23B
           [Candidatus Nitrospira defluvii]
          Length = 339

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 43/69 (62%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           ++GN + + H   I TVY H+    V++GQ+V RG  + L G +G +  P +H+ ++KN 
Sbjct: 269 KMGNMVKLDHGYGIETVYGHLAKSLVKEGQRVKRGDVVALVGSTGLSTGPHLHYMVKKNG 328

Query: 71  IAMDPIKFL 79
            A+DP KF+
Sbjct: 329 QALDPTKFI 337


>gi|258517058|ref|YP_003193280.1| Peptidase M23 [Desulfotomaculum acetoxidans DSM 771]
 gi|257780763|gb|ACV64657.1| Peptidase M23 [Desulfotomaculum acetoxidans DSM 771]
          Length = 376

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI VG+ +   GN ++I H   ++T+Y+H+    V  GQ+V+RG  I   G +G +  P 
Sbjct: 300 VIQVGS-MTGYGNIVMINHGGGLITLYAHLSRQLVSSGQQVTRGQVIAKVGSTGMSTGPH 358

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N  A++P+ +L
Sbjct: 359 LHFEVRLNGSAVNPMGYL 376


>gi|33601994|ref|NP_889554.1| putative peptidase [Bordetella bronchiseptica RB50]
 gi|33576432|emb|CAE33510.1| putative peptidase [Bordetella bronchiseptica RB50]
          Length = 292

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +  LGN I+I H +  +T Y+H     V+ GQ V RG  I   G++ +   P+
Sbjct: 213 VMYSGNGVRGLGNLIIINHQNGFITAYAHNRALLVKTGQNVKRGAKIAEIGET-DTTSPR 271

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+++L
Sbjct: 272 LHFEIRRQGTPVDPMQYL 289


>gi|269792103|ref|YP_003317007.1| Peptidase M23 [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269099738|gb|ACZ18725.1| Peptidase M23 [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 404

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   G  I++ H   + TVY+H+    V +G+KVSRG  IG  G +G A  P 
Sbjct: 327 VLYAGW-LRGYGQVIILDHGRDLTTVYAHLSKIEVNEGEKVSRGEQIGRVGSTGIATGPH 385

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N  A++P+ +L+
Sbjct: 386 LHFEVRVNGKAVNPMGYLK 404


>gi|206560256|ref|YP_002231020.1| family M23 peptidase [Burkholderia cenocepacia J2315]
 gi|198036297|emb|CAR52193.1| family M23 peptidase [Burkholderia cenocepacia J2315]
          Length = 299

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 220 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 278

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 279 LHFEVRRQGKPVDPLKYL 296


>gi|170733181|ref|YP_001765128.1| peptidase M23B [Burkholderia cenocepacia MC0-3]
 gi|169816423|gb|ACA91006.1| peptidase M23B [Burkholderia cenocepacia MC0-3]
          Length = 296

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 217 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 275

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 276 LHFEVRRQGKPVDPLKYL 293


>gi|317121054|ref|YP_004101057.1| peptidase M23 [Thermaerobacter marianensis DSM 12885]
 gi|315591034|gb|ADU50330.1| Peptidase M23 [Thermaerobacter marianensis DSM 12885]
          Length = 460

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I HD++  T+Y+H+   YV  G  V RG  IG+ G +G +    +HFE+R N   
Sbjct: 393 GNAIIIAHDETFSTLYAHLSRRYVGPGDVVRRGQVIGMVGTTGASTGTHLHFEVRINGQP 452

Query: 73  MDPIKFL 79
           +DP+ +L
Sbjct: 453 VDPMPYL 459


>gi|33597591|ref|NP_885234.1| putative peptidase [Bordetella parapertussis 12822]
 gi|33574019|emb|CAE38342.1| putative peptidase [Bordetella parapertussis]
          Length = 294

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +  LGN I+I H +  +T Y+H     V+ GQ V RG  I   G++ +   P+
Sbjct: 215 VMYSGNGVRGLGNLIIINHQNGFITAYAHNRALLVKTGQNVKRGAKIAEIGET-DTTSPR 273

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+++L
Sbjct: 274 LHFEIRRQGTPVDPMQYL 291


>gi|284047558|ref|YP_003397897.1| Peptidase M23 [Acidaminococcus fermentans DSM 20731]
 gi|283951779|gb|ADB46582.1| Peptidase M23 [Acidaminococcus fermentans DSM 20731]
          Length = 318

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 38/66 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H + I T Y H+    VQ GQ V RG  IG +G SG +  P VHFE+R+N   
Sbjct: 248 GRFVSIDHGNGITTCYGHMSAIAVQPGQTVRRGDVIGYAGSSGYSTGPHVHFEVRQNGSP 307

Query: 73  MDPIKF 78
           ++P+ F
Sbjct: 308 VNPLNF 313


>gi|289805537|ref|ZP_06536166.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
          Typhi str. AG3]
 gi|558644|emb|CAA57639.1| unnamed protein product [Salmonella enterica]
          Length = 94

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2  VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
          V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 15 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 73

Query: 62 VHFELRKNAIAMDPIKFLEEK 82
          +HFE+R    +++P+++L ++
Sbjct: 74 LHFEIRYKGKSVNPLRYLPQR 94


>gi|329296049|ref|ZP_08253385.1| lipoprotein NlpD [Plautia stali symbiont]
          Length = 374

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 295 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 353

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 354 LHFEIRYKGKSVNPLRYLPQR 374


>gi|172060781|ref|YP_001808433.1| peptidase M23 [Burkholderia ambifaria MC40-6]
 gi|171993298|gb|ACB64217.1| Peptidase M23 [Burkholderia ambifaria MC40-6]
          Length = 295

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 216 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 274

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 275 LHFEVRRQGKPVDPLKYL 292


>gi|322807930|emb|CBZ05505.1| peptidase, M23/M37 family [Clostridium botulinum H04402 065]
          Length = 311

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 42/68 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I I+H+  ++T+Y+H    YV+ GQ V +G  IG  G +G +  P VHFELRKN   
Sbjct: 244 GKVIKIKHNSELITIYAHCSKLYVKVGQYVKKGEKIGEVGSTGRSTGPHVHFELRKNNEP 303

Query: 73  MDPIKFLE 80
            +P+ +++
Sbjct: 304 CNPLIYIK 311


>gi|152978240|ref|YP_001343869.1| peptidase M23B [Actinobacillus succinogenes 130Z]
 gi|150839963|gb|ABR73934.1| peptidase M23B [Actinobacillus succinogenes 130Z]
          Length = 419

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HDD  ++ Y+H D+  V+  Q+V  G  I   G SG     +
Sbjct: 340 VVYAGNALRGYGNLIIIKHDDDFLSAYAHNDSISVRDQQEVKAGQQIAKMGSSG-TNRVK 398

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  +
Sbjct: 399 LHFEIRYKGKSVDPTRYLPRR 419


>gi|238921112|ref|YP_002934627.1| peptidase M23B [Edwardsiella ictaluri 93-146]
 gi|238870681|gb|ACR70392.1| peptidase M23B [Edwardsiella ictaluri 93-146]
          Length = 271

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G A   +
Sbjct: 192 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTG-ASSVR 250

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 251 LHFEIRYKGKSVNPLQYLPQR 271


>gi|238754523|ref|ZP_04615878.1| hypothetical protein yruck0001_24610 [Yersinia ruckeri ATCC 29473]
 gi|238707352|gb|EEP99714.1| hypothetical protein yruck0001_24610 [Yersinia ruckeri ATCC 29473]
          Length = 325

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 246 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 304

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 305 LHFEIRYKGKSVNPLRYLPQR 325


>gi|134036991|gb|ABO47832.1| putative outer membrane lipoprotein [Escherichia coli]
 gi|134037009|gb|ABO47844.1| putative outer membrane lipoprotein [Escherichia coli]
          Length = 181

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 102 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 160

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 161 LHFEIRYKGKSVNPLRYLPQR 181


>gi|317493946|ref|ZP_07952363.1| peptidase family M23 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918273|gb|EFV39615.1| peptidase family M23 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 329

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|20809035|ref|NP_624206.1| membrane proteins related to metalloendopeptidase
           [Thermoanaerobacter tengcongensis MB4]
 gi|20517706|gb|AAM25810.1| Membrane proteins related to metalloendopeptidases
           [Thermoanaerobacter tengcongensis MB4]
          Length = 449

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H +  VT Y H     V+ G KV +G  I L G +G+A  P VHFE+RKN + 
Sbjct: 381 GYLVKIDHHNGYVTYYGHASKLLVKVGDKVEKGQKIALVGATGHATGPHVHFEVRKNGVP 440

Query: 73  MDPIKFL 79
           +DP++FL
Sbjct: 441 IDPMRFL 447


>gi|304560048|gb|ADM42712.1| Lipoprotein NlpD precursor [Edwardsiella tarda FL6-60]
          Length = 273

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G A   +
Sbjct: 194 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTG-ASSVR 252

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 253 LHFEIRYKGKSVNPLQYLPQR 273


>gi|12483894|gb|AAG53882.1|AF275947_1 lipoprotein NlpD [Escherichia coli]
          Length = 164

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 85  VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 143

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 144 LHFEIRYKGKSVNPLRYLPQR 164


>gi|332092026|gb|EGI97104.1| lipoprotein nlpD [Shigella boydii 3594-74]
          Length = 313

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 234 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 292

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 293 LHFEIRYKGKSVNPLRYLPQR 313


>gi|300815848|ref|ZP_07096072.1| peptidase, M23 family [Escherichia coli MS 107-1]
 gi|300919221|ref|ZP_07135744.1| peptidase, M23 family [Escherichia coli MS 115-1]
 gi|300922265|ref|ZP_07138391.1| peptidase, M23 family [Escherichia coli MS 182-1]
 gi|300930601|ref|ZP_07145993.1| peptidase, M23 family [Escherichia coli MS 187-1]
 gi|301326218|ref|ZP_07219601.1| peptidase, M23 family [Escherichia coli MS 78-1]
 gi|301645275|ref|ZP_07245226.1| peptidase, M23 family [Escherichia coli MS 146-1]
 gi|309795209|ref|ZP_07689628.1| peptidase, M23 family [Escherichia coli MS 145-7]
 gi|300413666|gb|EFJ96976.1| peptidase, M23 family [Escherichia coli MS 115-1]
 gi|300421395|gb|EFK04706.1| peptidase, M23 family [Escherichia coli MS 182-1]
 gi|300461543|gb|EFK25036.1| peptidase, M23 family [Escherichia coli MS 187-1]
 gi|300531777|gb|EFK52839.1| peptidase, M23 family [Escherichia coli MS 107-1]
 gi|300847063|gb|EFK74823.1| peptidase, M23 family [Escherichia coli MS 78-1]
 gi|301076440|gb|EFK91246.1| peptidase, M23 family [Escherichia coli MS 146-1]
 gi|308121180|gb|EFO58442.1| peptidase, M23 family [Escherichia coli MS 145-7]
 gi|323154964|gb|EFZ41156.1| lipoprotein nlpD [Escherichia coli EPECa14]
 gi|323159950|gb|EFZ45920.1| lipoprotein nlpD [Escherichia coli E128010]
 gi|323172965|gb|EFZ58596.1| lipoprotein nlpD [Escherichia coli LT-68]
 gi|324017013|gb|EGB86232.1| peptidase, M23 family [Escherichia coli MS 117-3]
 gi|332344624|gb|AEE57958.1| lipoprotein NlpD [Escherichia coli UMNK88]
          Length = 329

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|33592792|ref|NP_880436.1| putative peptidase [Bordetella pertussis Tohama I]
 gi|33572440|emb|CAE42008.1| putative peptidase [Bordetella pertussis Tohama I]
 gi|332382205|gb|AEE67052.1| putative peptidase [Bordetella pertussis CS]
          Length = 294

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +  LGN I+I H +  +T Y+H     V+ GQ V RG  I   G++ +   P+
Sbjct: 215 VMYSGNGVRGLGNLIIINHQNGFITAYAHNRALLVKTGQNVKRGAKIAEIGET-DTTSPR 273

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+++L
Sbjct: 274 LHFEIRRQGTPVDPMQYL 291


>gi|134295852|ref|YP_001119587.1| peptidase M23B [Burkholderia vietnamiensis G4]
 gi|134139009|gb|ABO54752.1| peptidase M23B [Burkholderia vietnamiensis G4]
          Length = 293

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 214 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 272

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 273 LHFEVRRQGKPVDPLKYL 290


>gi|283786706|ref|YP_003366571.1| lipoprotein [Citrobacter rodentium ICC168]
 gi|282950160|emb|CBG89796.1| lipoprotein [Citrobacter rodentium ICC168]
          Length = 375

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 296 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 354

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 355 LHFEIRYKGKSVNPLRYLPQR 375


>gi|157369076|ref|YP_001477065.1| lipoprotein NlpD [Serratia proteamaculans 568]
 gi|157320840|gb|ABV39937.1| peptidase M23B [Serratia proteamaculans 568]
          Length = 328

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 249 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 307

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 308 LHFEIRYKGKSVNPLRYLPQR 328


>gi|62181427|ref|YP_217844.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62129060|gb|AAX66763.1| lipoprotein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322715911|gb|EFZ07482.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 373

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 294 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 352

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 353 LHFEIRYKGKSVNPLRYLPQR 373


>gi|312796756|ref|YP_004029678.1| peptidoglycan-specific endopeptidase, M23 family [Burkholderia
           rhizoxinica HKI 454]
 gi|312168531|emb|CBW75534.1| Peptidoglycan-specific endopeptidase, M23 family [Burkholderia
           rhizoxinica HKI 454]
          Length = 267

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+ + +T Y+H     V++GQ V++G TI   G S ++    
Sbjct: 188 VVYAGNGLRGYGNLLIIKHNANFLTAYAHNRALLVKEGQNVTQGQTIAEMGDS-DSNRVA 246

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELR +  ++DP ++L
Sbjct: 247 LHFELRYDGKSIDPARYL 264


>gi|293449063|ref|ZP_06663484.1| nlpD [Escherichia coli B088]
 gi|291322153|gb|EFE61582.1| nlpD [Escherichia coli B088]
          Length = 379

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|187777408|ref|ZP_02993881.1| hypothetical protein CLOSPO_00975 [Clostridium sporogenes ATCC
           15579]
 gi|187774336|gb|EDU38138.1| hypothetical protein CLOSPO_00975 [Clostridium sporogenes ATCC
           15579]
          Length = 311

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 42/68 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I I+H+  ++T+Y+H    YV+ GQ V +G  IG  G +G +  P VHFELRKN   
Sbjct: 244 GKVIKIKHNSELITIYAHCSKLYVKVGQYVKKGEKIGEVGNTGRSTGPHVHFELRKNNEP 303

Query: 73  MDPIKFLE 80
            +P+ +++
Sbjct: 304 CNPLIYIK 311


>gi|167993164|ref|ZP_02574259.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205328712|gb|EDZ15476.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|332989796|gb|AEF08779.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 373

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 294 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 352

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 353 LHFEIRYKGKSVNPLRYLPQR 373


>gi|148381545|ref|YP_001256086.1| putative peptidase [Clostridium botulinum A str. ATCC 3502]
 gi|153932276|ref|YP_001385919.1| putative peptidase [Clostridium botulinum A str. ATCC 19397]
 gi|153935479|ref|YP_001389326.1| putative peptidase [Clostridium botulinum A str. Hall]
 gi|148291029|emb|CAL85166.1| putative exported peptidase [Clostridium botulinum A str. ATCC
           3502]
 gi|152928320|gb|ABS33820.1| putative peptidase [Clostridium botulinum A str. ATCC 19397]
 gi|152931393|gb|ABS36892.1| putative peptidase [Clostridium botulinum A str. Hall]
          Length = 311

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I I+H   ++T+Y+H    YV+ GQ V +G  IG  G +G +  P VHFELRKN   
Sbjct: 244 GKVIKIQHSSELITIYAHCSNLYVKVGQYVKKGEKIGEVGSTGRSTGPHVHFELRKNNEP 303

Query: 73  MDPIKFLE 80
            +P+ +++
Sbjct: 304 CNPLTYIK 311


>gi|6175917|gb|AAF05333.1|AF182102_1 lipoprotein [Escherichia coli]
 gi|6175923|gb|AAF05337.1|AF182104_1 lipoprotein [Escherichia coli]
 gi|6175926|gb|AAF05339.1|AF182105_1 lipoprotein [Escherichia coli]
 gi|6175929|gb|AAF05341.1|AF182106_1 lipoprotein [Escherichia coli]
 gi|6175932|gb|AAF05343.1|AF182107_1 lipoprotein [Escherichia coli]
          Length = 162

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 83  VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 141

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 142 LHFEIRYKGKSVNPLRYLPQR 162


>gi|171321355|ref|ZP_02910312.1| protein-L-isoaspartate O-methyltransferase [Burkholderia ambifaria
           MEX-5]
 gi|171093373|gb|EDT38563.1| protein-L-isoaspartate O-methyltransferase [Burkholderia ambifaria
           MEX-5]
          Length = 527

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 448 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 506

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 507 LHFEVRRQGKPVDPLKYL 524


>gi|168235963|ref|ZP_02661021.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194737503|ref|YP_002115874.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|194713005|gb|ACF92226.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197290900|gb|EDY30254.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
          Length = 377

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|134036994|gb|ABO47834.1| putative outer membrane lipoprotein [Escherichia coli]
 gi|134036997|gb|ABO47836.1| putative outer membrane lipoprotein [Escherichia coli]
 gi|134037000|gb|ABO47838.1| putative outer membrane lipoprotein [Escherichia coli]
 gi|134037003|gb|ABO47840.1| putative outer membrane lipoprotein [Escherichia coli]
 gi|134037006|gb|ABO47842.1| putative outer membrane lipoprotein [Escherichia coli]
          Length = 181

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 102 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 160

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 161 LHFEIRYKGKSVNPLRYLPQR 181


>gi|404099|dbj|BAA04487.1| ORF-X protein [Escherichia coli]
          Length = 281

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 202 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTS-STR 260

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 261 LHFEIRYKGKSVNPLRYLPQR 281


>gi|16761697|ref|NP_457314.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|29143181|ref|NP_806523.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|213619185|ref|ZP_03373011.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-2068]
 gi|213648320|ref|ZP_03378373.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
 gi|213859420|ref|ZP_03385124.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. M223]
 gi|289829789|ref|ZP_06547304.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-3139]
 gi|17433727|sp|Q56131|NLPD_SALTI RecName: Full=Lipoprotein nlpD; Flags: Precursor
 gi|25316608|pir||AH0855 lipoprotein NlpD precursor [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16503998|emb|CAD06031.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138814|gb|AAO70383.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 373

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 294 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 352

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 353 LHFEIRYKGKSVNPLRYLPQR 373


>gi|331654220|ref|ZP_08355220.1| lipoprotein NlpD [Escherichia coli M718]
 gi|331658856|ref|ZP_08359798.1| lipoprotein NlpD [Escherichia coli TA206]
 gi|331664298|ref|ZP_08365204.1| lipoprotein NlpD [Escherichia coli TA143]
 gi|331669481|ref|ZP_08370327.1| lipoprotein NlpD [Escherichia coli TA271]
 gi|331674248|ref|ZP_08375008.1| lipoprotein NlpD [Escherichia coli TA280]
 gi|331678722|ref|ZP_08379396.1| lipoprotein NlpD [Escherichia coli H591]
 gi|331684361|ref|ZP_08384953.1| lipoprotein NlpD [Escherichia coli H299]
 gi|331047602|gb|EGI19679.1| lipoprotein NlpD [Escherichia coli M718]
 gi|331053438|gb|EGI25467.1| lipoprotein NlpD [Escherichia coli TA206]
 gi|331058229|gb|EGI30210.1| lipoprotein NlpD [Escherichia coli TA143]
 gi|331063149|gb|EGI35062.1| lipoprotein NlpD [Escherichia coli TA271]
 gi|331068342|gb|EGI39737.1| lipoprotein NlpD [Escherichia coli TA280]
 gi|331073552|gb|EGI44873.1| lipoprotein NlpD [Escherichia coli H591]
 gi|331077976|gb|EGI49182.1| lipoprotein NlpD [Escherichia coli H299]
          Length = 321

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 242 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTS-STR 300

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 301 LHFEIRYKGKSVNPLRYLPQR 321


>gi|238896222|ref|YP_002920958.1| lipoprotein NlpD [Klebsiella pneumoniae NTUH-K2044]
 gi|238548540|dbj|BAH64891.1| lipoprotein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 376

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 297 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 355

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 356 LHFEIRYKGKSVNPLQYLPQR 376


>gi|134037012|gb|ABO47846.1| putative outer membrane lipoprotein [Escherichia coli]
          Length = 181

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 102 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 160

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 161 LHFEIRYKGKSVNPLRYLPQR 181


>gi|71065256|ref|YP_263983.1| hypothetical protein Psyc_0690 [Psychrobacter arcticus 273-4]
 gi|71038241|gb|AAZ18549.1| conserved hypothetical protein [Psychrobacter arcticus 273-4]
          Length = 272

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 41/74 (55%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L E GN I+IRH D+ +T Y+H     V++G  V RG  I   G SG      
Sbjct: 193 VLYSGNGLPEYGNLIMIRHSDNYITAYAHNSQLLVKEGDSVQRGQRIANMGNSGQTNQVG 252

Query: 62  VHFELRKNAIAMDP 75
           + F++R N   +DP
Sbjct: 253 LEFQVRLNGNPIDP 266


>gi|93005491|ref|YP_579928.1| peptidase M23B [Psychrobacter cryohalolentis K5]
 gi|92393169|gb|ABE74444.1| peptidase M23B [Psychrobacter cryohalolentis K5]
          Length = 270

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 41/74 (55%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L E GN I+IRH D+ +T Y+H     V++G  V RG  I   G SG      
Sbjct: 191 VLYSGNGLPEYGNLIMIRHSDNYITAYAHNSQLLVKEGDSVQRGQRIANMGNSGQTNQVG 250

Query: 62  VHFELRKNAIAMDP 75
           + F++R N   +DP
Sbjct: 251 LEFQVRLNGNPIDP 264


>gi|332753465|gb|EGJ83845.1| lipoprotein nlpD [Shigella flexneri 4343-70]
 gi|332999976|gb|EGK19559.1| lipoprotein nlpD [Shigella flexneri K-218]
          Length = 329

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|300941125|ref|ZP_07155637.1| peptidase, M23 family [Escherichia coli MS 21-1]
 gi|300454168|gb|EFK17661.1| peptidase, M23 family [Escherichia coli MS 21-1]
          Length = 329

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|161502016|ref|YP_001569128.1| lipoprotein NlpD [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160863363|gb|ABX19986.1| hypothetical protein SARI_00032 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 315

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 236 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 294

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 295 LHFEIRYKGKSVNPLRYLPQR 315


>gi|326441676|ref|ZP_08216410.1| peptidase [Streptomyces clavuligerus ATCC 27064]
          Length = 191

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 3/80 (3%)

Query: 6   GNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFE 65
           G D    GN ++I+H ++  + Y+H+ T  V  GQ+VS G  I LSG +GN+  P +HFE
Sbjct: 108 GGDGPAYGNAVVIKHSNNTYSQYAHLSTIGVSVGQQVSGGQQIALSGNTGNSSGPHLHFE 167

Query: 66  LRKN---AIAMDPIKFLEEK 82
           +R       A+DP+  L  +
Sbjct: 168 IRTTPNYGSAVDPVAHLRAQ 187


>gi|300820523|ref|ZP_07100674.1| peptidase, M23 family [Escherichia coli MS 119-7]
 gi|300899983|ref|ZP_07118186.1| peptidase, M23 family [Escherichia coli MS 198-1]
 gi|300906753|ref|ZP_07124435.1| peptidase, M23 family [Escherichia coli MS 84-1]
 gi|300946979|ref|ZP_07161205.1| peptidase, M23 family [Escherichia coli MS 116-1]
 gi|300954985|ref|ZP_07167396.1| peptidase, M23 family [Escherichia coli MS 175-1]
 gi|300976232|ref|ZP_07173329.1| peptidase, M23 family [Escherichia coli MS 200-1]
 gi|301027158|ref|ZP_07190527.1| peptidase, M23 family [Escherichia coli MS 69-1]
 gi|301306157|ref|ZP_07212233.1| peptidase, M23 family [Escherichia coli MS 124-1]
 gi|309786169|ref|ZP_07680797.1| lipoprotein nlpD [Shigella dysenteriae 1617]
 gi|312964992|ref|ZP_07779232.1| lipoprotein nlpD [Escherichia coli 2362-75]
 gi|300308577|gb|EFJ63097.1| peptidase, M23 family [Escherichia coli MS 200-1]
 gi|300318077|gb|EFJ67861.1| peptidase, M23 family [Escherichia coli MS 175-1]
 gi|300356492|gb|EFJ72362.1| peptidase, M23 family [Escherichia coli MS 198-1]
 gi|300395190|gb|EFJ78728.1| peptidase, M23 family [Escherichia coli MS 69-1]
 gi|300401447|gb|EFJ84985.1| peptidase, M23 family [Escherichia coli MS 84-1]
 gi|300453366|gb|EFK16986.1| peptidase, M23 family [Escherichia coli MS 116-1]
 gi|300526787|gb|EFK47856.1| peptidase, M23 family [Escherichia coli MS 119-7]
 gi|300838589|gb|EFK66349.1| peptidase, M23 family [Escherichia coli MS 124-1]
 gi|308925914|gb|EFP71393.1| lipoprotein nlpD [Shigella dysenteriae 1617]
 gi|312290548|gb|EFR18428.1| lipoprotein nlpD [Escherichia coli 2362-75]
 gi|313647808|gb|EFS12254.1| lipoprotein nlpD [Shigella flexneri 2a str. 2457T]
 gi|315254526|gb|EFU34494.1| peptidase, M23 family [Escherichia coli MS 85-1]
 gi|315289256|gb|EFU48651.1| peptidase, M23 family [Escherichia coli MS 110-3]
 gi|315298765|gb|EFU58019.1| peptidase, M23 family [Escherichia coli MS 16-3]
 gi|323167242|gb|EFZ52959.1| lipoprotein nlpD [Shigella sonnei 53G]
 gi|324005708|gb|EGB74927.1| peptidase, M23 family [Escherichia coli MS 57-2]
 gi|324015518|gb|EGB84737.1| peptidase, M23 family [Escherichia coli MS 60-1]
 gi|332753599|gb|EGJ83978.1| lipoprotein nlpD [Shigella flexneri K-671]
 gi|332755683|gb|EGJ86046.1| lipoprotein nlpD [Shigella flexneri 2747-71]
 gi|332765695|gb|EGJ95908.1| nlpD putative outer membrane lipoprotein [Shigella flexneri
           2930-71]
 gi|333001094|gb|EGK20664.1| lipoprotein nlpD [Shigella flexneri K-272]
 gi|333015401|gb|EGK34740.1| lipoprotein nlpD [Shigella flexneri K-227]
 gi|333015737|gb|EGK35075.1| lipoprotein nlpD [Shigella flexneri K-304]
          Length = 329

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|168463935|ref|ZP_02697852.1| lipoprotein [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|195633684|gb|EDX52098.1| lipoprotein [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
          Length = 373

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 294 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 352

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 353 LHFEIRYKGKSVNPLRYLPQR 373


>gi|161615846|ref|YP_001589810.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|161365210|gb|ABX68978.1| hypothetical protein SPAB_03638 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 327

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 248 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 306

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 307 LHFEIRYKGKSVNPLRYLPQR 327


>gi|11036546|gb|AAG27176.1|AF270497_1 lipoprotein [Escherichia coli]
          Length = 176

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 97  VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 155

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 156 LHFEIRYKGKSVNPLRYLPQR 176


>gi|332087628|gb|EGI92755.1| lipoprotein nlpD [Shigella dysenteriae 155-74]
          Length = 329

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|224584702|ref|YP_002638500.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224469229|gb|ACN47059.1| lipoprotein [Salmonella enterica subsp. enterica serovar Paratyphi
           C strain RKS4594]
          Length = 315

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 236 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 294

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 295 LHFEIRYKGKSVNPLRYLPQR 315


>gi|213417288|ref|ZP_03350432.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. E01-6750]
 gi|213425677|ref|ZP_03358427.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|213580999|ref|ZP_03362825.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-0664]
          Length = 315

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 236 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 294

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 295 LHFEIRYKGKSVNPLRYLPQR 315


>gi|213029653|ref|ZP_03344100.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. 404ty]
          Length = 125

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 46  VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 104

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 105 LHFEIRYKGKSVNPLRYLPQR 125


>gi|206580086|ref|YP_002236888.1| lipoprotein NlpD [Klebsiella pneumoniae 342]
 gi|288933842|ref|YP_003437901.1| peptidase M23 [Klebsiella variicola At-22]
 gi|290511077|ref|ZP_06550446.1| lipoprotein NlpD [Klebsiella sp. 1_1_55]
 gi|206569144|gb|ACI10920.1| lipoprotein NlpD [Klebsiella pneumoniae 342]
 gi|288888571|gb|ADC56889.1| Peptidase M23 [Klebsiella variicola At-22]
 gi|289776070|gb|EFD84069.1| lipoprotein NlpD [Klebsiella sp. 1_1_55]
          Length = 378

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 299 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 357

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 358 LHFEIRYKGKSVNPLQYLPQR 378


>gi|91792038|ref|YP_561689.1| peptidase M23B [Shewanella denitrificans OS217]
 gi|91714040|gb|ABE53966.1| peptidase M23B [Shewanella denitrificans OS217]
          Length = 482

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 31/68 (45%), Positives = 38/68 (55%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GNTILI H     T+Y+H+D   VQ G KV  G  IG  G SG A  P +HFEL +    
Sbjct: 412 GNTILIDHGHGYQTLYAHLDAFSVQSGDKVRAGQQIGAVGASGFATGPHLHFELLQKGQQ 471

Query: 73  MDPIKFLE 80
           +DP   L+
Sbjct: 472 LDPTHKLQ 479


>gi|240123240|ref|ZP_04736196.1| hypothetical protein NgonP_04749 [Neisseria gonorrhoeae PID332]
          Length = 376

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L E GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 298 VVYAGSGLREYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 356

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 357 LHFEVRQNGKPVNPNSYI 374


>gi|194098292|ref|YP_002001350.1| hypothetical protein NGK_0725 [Neisseria gonorrhoeae NCCP11945]
 gi|240014369|ref|ZP_04721282.1| hypothetical protein NgonD_06933 [Neisseria gonorrhoeae DGI18]
 gi|240016802|ref|ZP_04723342.1| hypothetical protein NgonFA_06484 [Neisseria gonorrhoeae FA6140]
 gi|240112643|ref|ZP_04727133.1| hypothetical protein NgonM_03501 [Neisseria gonorrhoeae MS11]
 gi|240115388|ref|ZP_04729450.1| hypothetical protein NgonPID1_03939 [Neisseria gonorrhoeae PID18]
 gi|240121931|ref|ZP_04734893.1| hypothetical protein NgonPI_09243 [Neisseria gonorrhoeae PID24-1]
 gi|260440804|ref|ZP_05794620.1| hypothetical protein NgonDG_06901 [Neisseria gonorrhoeae DGI2]
 gi|193933582|gb|ACF29406.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945]
          Length = 376

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L E GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 298 VVYAGSGLREYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 356

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 357 LHFEVRQNGKPVNPNSYI 374


>gi|3820468|emb|CAA76806.1| NlpD [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
          Length = 105

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 26  VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 84

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 85  LHFEIRYKGKSVNPLRYLPQR 105


>gi|115351810|ref|YP_773649.1| peptidase M23B [Burkholderia ambifaria AMMD]
 gi|115281798|gb|ABI87315.1| peptidase M23B [Burkholderia ambifaria AMMD]
          Length = 295

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 216 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 274

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 275 LHFEVRRQGKPVDPLKYL 292


>gi|300976794|ref|ZP_07173611.1| peptidase, M23 family [Escherichia coli MS 45-1]
 gi|301049495|ref|ZP_07196453.1| peptidase, M23 family [Escherichia coli MS 185-1]
 gi|300298726|gb|EFJ55111.1| peptidase, M23 family [Escherichia coli MS 185-1]
 gi|300409980|gb|EFJ93518.1| peptidase, M23 family [Escherichia coli MS 45-1]
 gi|315293696|gb|EFU53048.1| peptidase, M23 family [Escherichia coli MS 153-1]
          Length = 329

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|293392780|ref|ZP_06637098.1| outer membrane antigenic lipoprotein B [Serratia odorifera DSM
           4582]
 gi|291424639|gb|EFE97850.1| outer membrane antigenic lipoprotein B [Serratia odorifera DSM
           4582]
          Length = 316

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 237 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 295

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 296 LHFEIRYKGKSVNPLRYLPQR 316


>gi|152971626|ref|YP_001336735.1| lipoprotein NlpD [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|150956475|gb|ABR78505.1| lipoprotein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
          Length = 378

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 299 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 357

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 358 LHFEIRYKGKSVNPLQYLPQR 378


>gi|332999495|gb|EGK19080.1| lipoprotein nlpD [Shigella flexneri VA-6]
          Length = 329

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|332087477|gb|EGI92605.1| lipoprotein nlpD [Shigella boydii 5216-82]
          Length = 329

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|322628874|gb|EFY25657.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|323210116|gb|EFZ95019.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
          Length = 319

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 240 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 298

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 299 LHFEIRYKGKSVNPLRYLPQR 319


>gi|238909693|ref|ZP_04653530.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|321225599|gb|EFX50653.1| Lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
          Length = 319

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 240 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 298

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 299 LHFEIRYKGKSVNPLRYLPQR 319


>gi|254520733|ref|ZP_05132789.1| peptidase [Clostridium sp. 7_2_43FAA]
 gi|226914482|gb|EEH99683.1| peptidase [Clostridium sp. 7_2_43FAA]
          Length = 346

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 43/67 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+++H+D++VT Y H+   YV+ G KV +G  IG  G +G +  P +HFELR +   
Sbjct: 278 GNLIIVKHEDNMVTYYGHLSDFYVKVGDKVKKGDIIGAIGSTGFSTGPHLHFELRVDNEP 337

Query: 73  MDPIKFL 79
           +DP  ++
Sbjct: 338 VDPTNYI 344


>gi|206602545|gb|EDZ39026.1| Putative peptidase, M23B family [Leptospirillum sp. Group II '5-way
           CG']
          Length = 332

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+VG D    G T+ IRH D IVT++ H+   +V  G +V RG  I   G +G +  P
Sbjct: 238 VVIWVGWD-AGFGKTVKIRHVDGIVTLFGHLSRYFVHMGDRVKRGQVIAALGNTGMSTGP 296

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+  NA  ++P+++ 
Sbjct: 297 HLHYEILVNAKPVNPLRYF 315


>gi|308187919|ref|YP_003932050.1| Lipoprotein nlpD precursor [Pantoea vagans C9-1]
 gi|308058429|gb|ADO10601.1| Lipoprotein nlpD precursor [Pantoea vagans C9-1]
          Length = 366

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 287 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 345

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 346 LHFEIRYKGKSVNPLRYLPQR 366


>gi|157148285|ref|YP_001455604.1| lipoprotein NlpD [Citrobacter koseri ATCC BAA-895]
 gi|157085490|gb|ABV15168.1| hypothetical protein CKO_04102 [Citrobacter koseri ATCC BAA-895]
          Length = 317

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 238 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 296

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 297 LHFEIRYKGKSVNPLRYLPQR 317


>gi|20808489|ref|NP_623660.1| membrane proteins related to metalloendopeptidase
           [Thermoanaerobacter tengcongensis MB4]
 gi|20517109|gb|AAM25264.1| Membrane proteins related to metalloendopeptidases
           [Thermoanaerobacter tengcongensis MB4]
          Length = 571

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 45/67 (67%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I+H D + TVY H+    V +G++V +G  IGLSG +G +    +HFE+RK++  
Sbjct: 301 GKAVIIKHTDGLSTVYGHLSEIKVGEGKEVKQGEVIGLSGNTGRSTGSHLHFEIRKDSQP 360

Query: 73  MDPIKFL 79
           +DP+++L
Sbjct: 361 VDPLQYL 367


>gi|168183686|ref|ZP_02618350.1| putative peptidase [Clostridium botulinum Bf]
 gi|237797065|ref|YP_002864617.1| putative peptidase [Clostridium botulinum Ba4 str. 657]
 gi|182673249|gb|EDT85210.1| putative peptidase [Clostridium botulinum Bf]
 gi|229262140|gb|ACQ53173.1| putative peptidase [Clostridium botulinum Ba4 str. 657]
          Length = 311

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 42/68 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I I+H+  ++T+Y+H    YV+ GQ V +G  IG  G +G +  P VHFELRKN   
Sbjct: 244 GKVIKIQHNSELITIYAHCSNLYVKVGQYVKKGEKIGEVGSTGRSTGPHVHFELRKNNEP 303

Query: 73  MDPIKFLE 80
            +P+ +++
Sbjct: 304 CNPLVYIK 311


>gi|90412103|ref|ZP_01220110.1| hypothetical lipoprotein NlpD [Photobacterium profundum 3TCK]
 gi|90327081|gb|EAS43460.1| hypothetical lipoprotein NlpD [Photobacterium profundum 3TCK]
          Length = 306

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H D  ++ Y+H D   V++ Q V  G  I   G SG +   +
Sbjct: 227 VVYAGNALRGYGNLIIIKHSDDYLSAYAHNDKMLVKEQQTVKAGQKIASMGSSGTSS-VR 285

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L +K
Sbjct: 286 LHFEIRYKGKSVDPMRYLPKK 306


>gi|253575915|ref|ZP_04853249.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251844709|gb|EES72723.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 405

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (57%), Gaps = 2/80 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTP--YVQKGQKVSRGHTIGLSGKSGNAQH 59
           V+ V       GNT++I H D++ T+Y HI      V+KGQKV +G  I   G +GN+  
Sbjct: 326 VVIVAEWWSGYGNTVIIDHGDNVWTLYGHIRNGGIKVEKGQKVKKGEKIAEVGSTGNSTG 385

Query: 60  PQVHFELRKNAIAMDPIKFL 79
           P  HFE+R N   +DP+ +L
Sbjct: 386 PHCHFEVRINGNPVDPMPYL 405


>gi|124266447|ref|YP_001020451.1| peptidase [Methylibium petroleiphilum PM1]
 gi|124259222|gb|ABM94216.1| subfamily M23B unassigned peptidase [Methylibium petroleiphilum
           PM1]
          Length = 317

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++++H+ + +T Y+H  T  V++ Q V RG  I   G S +A+  Q
Sbjct: 238 VVYAGSGLRGYGNLVIVKHNTTYLTAYAHNQTLLVKEDQPVKRGQKIAEMG-STDAERVQ 296

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RK    +DP+K L
Sbjct: 297 LHFEIRKLGKPVDPVKLL 314


>gi|114567912|ref|YP_755066.1| peptidase M23B [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114338847|gb|ABI69695.1| peptidase M23B [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 283

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 44/68 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G TI+++H++   TVY+H++  YV+KGQ+V +G  IG  G SG    P +HFE+R     
Sbjct: 216 GQTIILKHENGKKTVYAHLEKIYVKKGQEVKQGKIIGTVGTSGRTTGPHLHFEIRVGDET 275

Query: 73  MDPIKFLE 80
           ++P++ L 
Sbjct: 276 INPLQLLR 283


>gi|695758|emb|CAA57297.1| NlpD [Salmonella enterica subsp. enterica serovar Typhi]
          Length = 119

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 40  VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 98

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 99  LHFEIRYKGKSVNPLRYLPQR 119


>gi|329120969|ref|ZP_08249600.1| peptidase M23B [Dialister micraerophilus DSM 19965]
 gi|327471131|gb|EGF16585.1| peptidase M23B [Dialister micraerophilus DSM 19965]
          Length = 382

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   GNT++I H ++I T+Y H  +  V  GQ VS+G  I  +G +GN+  P 
Sbjct: 306 VIYAGW-IDGYGNTVIIDHGNNITTLYGHNSSLAVSDGQSVSKGTVIAYAGSTGNSTGPH 364

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE++    A+DP+ +L
Sbjct: 365 CHFEVQVGGSAVDPMGYL 382


>gi|313891982|ref|ZP_07825583.1| peptidase, M23 family [Dialister microaerophilus UPII 345-E]
 gi|313119625|gb|EFR42816.1| peptidase, M23 family [Dialister microaerophilus UPII 345-E]
          Length = 382

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   GNT++I H ++I T+Y H  +  V  GQ VS+G  I  +G +GN+  P 
Sbjct: 306 VIYAGW-IDGYGNTVIIDHGNNITTLYGHNSSLAVSDGQSVSKGTVIAYAGSTGNSTGPH 364

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE++    A+DP+ +L
Sbjct: 365 CHFEVQVGGSAVDPMGYL 382


>gi|322831413|ref|YP_004211440.1| Peptidase M23 [Rahnella sp. Y9602]
 gi|321166614|gb|ADW72313.1| Peptidase M23 [Rahnella sp. Y9602]
          Length = 340

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 261 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVQAGQKIATMGSTGTSS-VR 319

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 320 LHFEIRYKGKSVNPLRYLPQR 340


>gi|296157775|ref|ZP_06840609.1| Peptidase M23 [Burkholderia sp. Ch1-1]
 gi|295892021|gb|EFG71805.1| Peptidase M23 [Burkholderia sp. Ch1-1]
          Length = 311

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H  +  V++G  V++G  I   G S ++    
Sbjct: 232 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRSLMVKEGDAVTKGQKIAEMGNS-DSDRVM 290

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 291 LHFEVRRQGKPVDPLKYL 308


>gi|300718098|ref|YP_003742901.1| Lipoprotein [Erwinia billingiae Eb661]
 gi|299063934|emb|CAX61054.1| Lipoprotein [Erwinia billingiae Eb661]
          Length = 388

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 309 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 367

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 368 LHFEIRYKGKSVNPLRYLPQR 388


>gi|323704329|ref|ZP_08115908.1| Peptidase M23 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323536395|gb|EGB26167.1| Peptidase M23 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 304

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  L   GN ++I H   I +VY H     V+ GQ V+RG  I  SG +G +  P
Sbjct: 225 IVTYAGW-LSGYGNVVMINHGYGITSVYGHNSQLLVRVGQTVNRGDVIAKSGSTGRSTGP 283

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+R N   +DP+K+L +
Sbjct: 284 HVHFEIRLNGNPVDPMKYLTK 304


>gi|262041490|ref|ZP_06014688.1| lipoprotein NlpD [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|259041149|gb|EEW42222.1| lipoprotein NlpD [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 331

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 252 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 310

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 311 LHFEIRYKGKSVNPLQYLPQR 331


>gi|291614605|ref|YP_003524762.1| peptidase M23 [Sideroxydans lithotrophicus ES-1]
 gi|291584717|gb|ADE12375.1| Peptidase M23 [Sideroxydans lithotrophicus ES-1]
          Length = 294

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 43/70 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T+ + H + ++T+Y H++   VQ G+ V +G  +GLSGK+G A  P +H+ +  N   
Sbjct: 214 GKTVFVDHGNGLITMYCHLERIDVQAGETVGKGQLLGLSGKTGRATGPHLHWSVVLNGTM 273

Query: 73  MDPIKFLEEK 82
           +DP  F+ EK
Sbjct: 274 VDPALFITEK 283


>gi|289641102|ref|ZP_06473270.1| Peptidase M23 [Frankia symbiont of Datisca glomerata]
 gi|289509043|gb|EFD29974.1| Peptidase M23 [Frankia symbiont of Datisca glomerata]
          Length = 229

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 4/83 (4%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G +    GN + +RH +++VT Y+H+    V+ GQ+V+ G  +GL G +G +  P 
Sbjct: 143 VIYAGWE-SGYGNFVQVRHANNVVTCYAHLSRISVRVGQQVATGQQVGLEGSTGFSTGPH 201

Query: 62  VHFELR---KNAIAMDPIKFLEE 81
           +HFE+R   +N   +DP+ +L +
Sbjct: 202 LHFEVRLGGQNGTKVDPLAWLAK 224


>gi|291618596|ref|YP_003521338.1| NlpD [Pantoea ananatis LMG 20103]
 gi|291153626|gb|ADD78210.1| NlpD [Pantoea ananatis LMG 20103]
 gi|327394976|dbj|BAK12398.1| lipoprotein NlpD precursor [Pantoea ananatis AJ13355]
          Length = 371

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 292 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 350

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 351 LHFEIRYKGKSVNPLRYLPQR 371


>gi|209966278|ref|YP_002299193.1| peptidase M23 [Rhodospirillum centenum SW]
 gi|209959744|gb|ACJ00381.1| peptidase M23 [Rhodospirillum centenum SW]
          Length = 474

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 48/79 (60%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G D    G  +L+ H   I T Y+H+D   V+ GQ +++G T+G  G +G +Q P 
Sbjct: 388 VVFAGWDSGGYGRMVLVDHGFGINTRYAHLDKLMVKAGQSINQGDTVGTLGNTGRSQGPH 447

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+  +   ++P++F+E
Sbjct: 448 LHYEVLVDGRPVNPLRFME 466


>gi|153855916|ref|ZP_01996878.1| hypothetical protein DORLON_02903 [Dorea longicatena DSM 13814]
 gi|149751819|gb|EDM61750.1| hypothetical protein DORLON_02903 [Dorea longicatena DSM 13814]
          Length = 388

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 4   YVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVH 63
           Y GN     GN ++I H + ++T Y H +  YV  GQKVSRG  +   G +GN+  P +H
Sbjct: 317 YAGN----AGNLLVISHGNGLLTYYMHCNAIYVSAGQKVSRGQNVAAVGTTGNSTGPHLH 372

Query: 64  FELRKNAIAMDPIKFL 79
           F++  N   ++P  +L
Sbjct: 373 FQVMLNGTPVNPANYL 388


>gi|158340041|ref|YP_001521211.1| peptidase M23 domain-containing protein [Acaryochloris marina
           MBIC11017]
 gi|158310282|gb|ABW31897.1| peptidase M23 domain protein [Acaryochloris marina MBIC11017]
          Length = 386

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GNT+++ H + + T+Y H    YV  GQ V RG TI   G +G +  P +HFE+R+    
Sbjct: 320 GNTVIVDHGNGLTTLYGHCSELYVTVGQGVQRGQTIAAIGSTGLSTGPHLHFEVRQQGEP 379

Query: 73  MDPIKFL 79
           +DP+ +L
Sbjct: 380 VDPLAYL 386


>gi|317049279|ref|YP_004116927.1| peptidase M23 [Pantoea sp. At-9b]
 gi|316950896|gb|ADU70371.1| Peptidase M23 [Pantoea sp. At-9b]
          Length = 362

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 283 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 341

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 342 LHFEIRYKGKSVNPLRYLPQR 362


>gi|329889965|ref|ZP_08268308.1| peptidase family M23 family protein [Brevundimonas diminuta ATCC
           11568]
 gi|328845266|gb|EGF94830.1| peptidase family M23 family protein [Brevundimonas diminuta ATCC
           11568]
          Length = 111

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 47/82 (57%), Gaps = 4/82 (4%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V YVG+D+V  G T+LI H D   TVY H+ +  V+ G +V  G  IG  G +     P 
Sbjct: 28  VAYVGDDIVGQGLTVLIVHRDGWRTVYGHLGSATVRDGAQVRAGQAIGTVGLTAGDGRPS 87

Query: 62  VHFELRK----NAIAMDPIKFL 79
           +H+E+R+    + +A+DP+  L
Sbjct: 88  IHYEVRQMRGDDPVALDPLTVL 109


>gi|312127171|ref|YP_003992045.1| peptidase M23 [Caldicellulosiruptor hydrothermalis 108]
 gi|311777190|gb|ADQ06676.1| Peptidase M23 [Caldicellulosiruptor hydrothermalis 108]
          Length = 379

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G TI+I +   I T+Y+H+ +  V  GQKV RG +IG  G +G A  P +HFE+R N   
Sbjct: 312 GKTIIIDNGSGISTLYAHLSSINVAVGQKVKRGESIGSVGATGYATGPHLHFEVRINGDV 371

Query: 73  MDPIKFL 79
            DP+ FL
Sbjct: 372 TDPLNFL 378


>gi|188534816|ref|YP_001908613.1| lipoprotein NlpD [Erwinia tasmaniensis Et1/99]
 gi|188029858|emb|CAO97742.1| Lipoprotein [Erwinia tasmaniensis Et1/99]
          Length = 365

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 286 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 344

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 345 LHFEIRYKGKSVNPLRYLPQR 365


>gi|330008321|ref|ZP_08306196.1| lipoprotein NlpD [Klebsiella sp. MS 92-3]
 gi|328535179|gb|EGF61680.1| lipoprotein NlpD [Klebsiella sp. MS 92-3]
          Length = 328

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 249 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 307

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 308 LHFEIRYKGKSVNPLQYLPQR 328


>gi|260881508|ref|ZP_05404577.2| peptidase, M23B family [Mitsuokella multacida DSM 20544]
 gi|260848619|gb|EEX68626.1| peptidase, M23B family [Mitsuokella multacida DSM 20544]
          Length = 378

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GNT++I H   I T+Y H  +  V  GQ VS+G  I   G +GN+  P  HFE+R+N   
Sbjct: 312 GNTVIINHGGGITTLYGHNQSLAVSAGQSVSQGQVISYCGSTGNSTGPHCHFEVRQNGEP 371

Query: 73  MDPIKFL 79
           + P  +L
Sbjct: 372 VSPYSYL 378


>gi|34498817|ref|NP_903032.1| lipoprotein [Chromobacterium violaceum ATCC 12472]
 gi|34104669|gb|AAQ61026.1| probable lipoprotein [Chromobacterium violaceum ATCC 12472]
          Length = 225

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  +   GN ++++H+++ +TVY+H     VQ+GQ+VS G  I   G SG A   +
Sbjct: 146 VVYAGKGIRAYGNLLIVKHNENTLTVYAHNQKLLVQEGQQVSAGQQIATMGDSG-ANRVK 204

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR     +DP  +L  +
Sbjct: 205 LHFELRLGTRVVDPAAYLPPR 225


>gi|319779694|ref|YP_004130607.1| Lipoprotein NlpD [Taylorella equigenitalis MCE9]
 gi|317109718|gb|ADU92464.1| Lipoprotein NlpD [Taylorella equigenitalis MCE9]
          Length = 229

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y GN +  LGN ILI H    ++ Y+H D   V++GQKV +G  I   G S +   P+
Sbjct: 152 VSYTGNGIRGLGNLILITHKKPFISAYAHTDKILVKEGQKVIKGQQIATLGSS-DTPSPK 210

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R++   ++P  +L
Sbjct: 211 LHFEIRRDGKPVNPASYL 228


>gi|295097323|emb|CBK86413.1| Membrane proteins related to metalloendopeptidases [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 374

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 295 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 353

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 354 LHFEIRYKGKSVNPLQYLPQR 374


>gi|288550339|ref|ZP_05970048.2| lipoprotein NlpD [Enterobacter cancerogenus ATCC 35316]
 gi|288315523|gb|EFC54461.1| lipoprotein NlpD [Enterobacter cancerogenus ATCC 35316]
          Length = 323

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 244 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 302

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 303 LHFEIRYKGKSVNPLQYLPQR 323


>gi|127512144|ref|YP_001093341.1| peptidase M23B [Shewanella loihica PV-4]
 gi|126637439|gb|ABO23082.1| peptidase M23B [Shewanella loihica PV-4]
          Length = 310

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H D  ++ Y+H D   V++ Q V+ G T+   G++G      
Sbjct: 231 VVYAGNALRGYGNLVIIKHSDDYLSAYAHADKILVKEKQFVTAGQTVAKMGQTGT-NRVM 289

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R +  ++DP+KFL +
Sbjct: 290 LHFEIRYHGKSVDPLKFLPK 309


>gi|271501816|ref|YP_003334842.1| Peptidase M23 [Dickeya dadantii Ech586]
 gi|270345371|gb|ACZ78136.1| Peptidase M23 [Dickeya dadantii Ech586]
          Length = 413

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H +T  V++ Q+V  G  I   G +G +   +
Sbjct: 334 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNETMLVREQQEVKAGQQIATMGSTGTSS-VR 392

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 393 LHFEIRYKGKSVNPLRFLPQR 413


>gi|237729724|ref|ZP_04560205.1| lipoprotein NlpD [Citrobacter sp. 30_2]
 gi|226908330|gb|EEH94248.1| lipoprotein NlpD [Citrobacter sp. 30_2]
          Length = 375

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q++  G  I   G +G +   +
Sbjct: 296 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEIKAGQKIATMGSTGTSST-R 354

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 355 LHFEIRYKGKSVNPLRYLPQR 375


>gi|146312854|ref|YP_001177928.1| lipoprotein NlpD [Enterobacter sp. 638]
 gi|145319730|gb|ABP61877.1| peptidase M23B [Enterobacter sp. 638]
          Length = 374

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q++  G  I   G +G +   +
Sbjct: 295 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEIKAGQKIATMGSTGTSS-TR 353

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 354 LHFEIRYKGKSVNPLQYLPQR 374


>gi|303241101|ref|ZP_07327610.1| Peptidase M23 [Acetivibrio cellulolyticus CD2]
 gi|302591361|gb|EFL61100.1| Peptidase M23 [Acetivibrio cellulolyticus CD2]
          Length = 314

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 43/67 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + ++H D + T+Y+H     V KGQKV +G  I   G +G A+ P +HFE+RK+  A
Sbjct: 243 GNYVKLKHIDGLTTLYAHCSKLLVSKGQKVKQGDIIAEVGSTGAAEGPHLHFEVRKDNTA 302

Query: 73  MDPIKFL 79
           ++P+ ++
Sbjct: 303 VNPLDYI 309


>gi|120612683|ref|YP_972361.1| peptidase M23B [Acidovorax citrulli AAC00-1]
 gi|120591147|gb|ABM34587.1| peptidase M23B [Acidovorax citrulli AAC00-1]
          Length = 453

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 41/69 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I IRH++  VTVY+H+    V+KGQ V +G TIG  G +G A    +HFE R N   
Sbjct: 347 GNVIYIRHNNQHVTVYAHLSRIDVRKGQTVVQGQTIGAVGATGWATASHLHFESRVNGQH 406

Query: 73  MDPIKFLEE 81
            DP+   ++
Sbjct: 407 QDPMVLAQQ 415


>gi|319761432|ref|YP_004125369.1| peptidase m23 [Alicycliphilus denitrificans BC]
 gi|330823296|ref|YP_004386599.1| peptidase M23 [Alicycliphilus denitrificans K601]
 gi|317115993|gb|ADU98481.1| Peptidase M23 [Alicycliphilus denitrificans BC]
 gi|329308668|gb|AEB83083.1| Peptidase M23 [Alicycliphilus denitrificans K601]
          Length = 460

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 39/69 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I ++H +  VTVY+H+    V+KGQ V +G  IG  G +G A  P +HFE R N   
Sbjct: 354 GNVIYVKHRNQHVTVYAHLSRIDVKKGQAVDQGQKIGAVGATGWATGPHLHFEFRVNGEH 413

Query: 73  MDPIKFLEE 81
            DP+    E
Sbjct: 414 RDPMTIARE 422


>gi|296104426|ref|YP_003614572.1| putative lipoprotein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295058885|gb|ADF63623.1| putative lipoprotein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 315

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 236 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSST-R 294

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 295 LHFEIRYKGKSVNPLQYLPQR 315


>gi|254393703|ref|ZP_05008826.1| peptidase [Streptomyces clavuligerus ATCC 27064]
 gi|294813212|ref|ZP_06771855.1| Peptidase [Streptomyces clavuligerus ATCC 27064]
 gi|197707313|gb|EDY53125.1| peptidase [Streptomyces clavuligerus ATCC 27064]
 gi|294325811|gb|EFG07454.1| Peptidase [Streptomyces clavuligerus ATCC 27064]
          Length = 220

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 3/80 (3%)

Query: 6   GNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFE 65
           G D    GN ++I+H ++  + Y+H+ T  V  GQ+VS G  I LSG +GN+  P +HFE
Sbjct: 137 GGDGPAYGNAVVIKHSNNTYSQYAHLSTIGVSVGQQVSGGQQIALSGNTGNSSGPHLHFE 196

Query: 66  LRKN---AIAMDPIKFLEEK 82
           +R       A+DP+  L  +
Sbjct: 197 IRTTPNYGSAVDPVAHLRAQ 216


>gi|218245506|ref|YP_002370877.1| peptidase M23 [Cyanothece sp. PCC 8801]
 gi|218165984|gb|ACK64721.1| Peptidase M23 [Cyanothece sp. PCC 8801]
          Length = 198

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G      G  I +RH D  +T Y H +   V++GQ+V +G  I   G +GN+  P
Sbjct: 96  VVIYAGWSPEGYGQLIKLRHPDGSLTFYGHNNRLLVRRGQQVEQGQQISEMGSTGNSTGP 155

Query: 61  QVHFELRKNAI-AMDPIKFLEEKI 83
            +HFE+    I A++PI FL E +
Sbjct: 156 HLHFEIHPQGIQAVNPIAFLPEPV 179


>gi|167569722|ref|ZP_02362596.1| lipoprotein NlpD, putative [Burkholderia oklahomensis C6786]
          Length = 289

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 210 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 268

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 269 LHFEVRRQGKPVDPLKYL 286


>gi|54310170|ref|YP_131190.1| lipoprotein NlpD [Photobacterium profundum SS9]
 gi|46914611|emb|CAG21388.1| hypothetical lipoprotein NlpD [Photobacterium profundum SS9]
          Length = 302

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H D  ++ Y+H D   V++ Q V  G  I   G SG +   +
Sbjct: 223 VVYAGNALRGYGNLIIIKHSDDYLSAYAHNDKVLVKEQQTVKAGQKIASMGSSGTSS-VR 281

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L +K
Sbjct: 282 LHFEIRYKGKSVDPMRYLPKK 302


>gi|257452436|ref|ZP_05617735.1| cell wall endopeptidase [Fusobacterium sp. 3_1_5R]
 gi|317058979|ref|ZP_07923464.1| cell wall endopeptidase family M23/M37 [Fusobacterium sp. 3_1_5R]
 gi|313684655|gb|EFS21490.1| cell wall endopeptidase family M23/M37 [Fusobacterium sp. 3_1_5R]
          Length = 382

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+I+HD+   T Y+H+     + G++V RG  IG +G +G    P
Sbjct: 305 VVTFAGN-MSGYGKIIIIKHDNGYETRYAHLSQISTRVGERVERGELIGKTGNTGRTTGP 363

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R++   ++P+K+L
Sbjct: 364 HLHFEIRRSGKTLNPMKYL 382


>gi|291086271|ref|ZP_06571439.1| lipoprotein NlpD [Citrobacter youngae ATCC 29220]
 gi|291068696|gb|EFE06805.1| lipoprotein NlpD [Citrobacter youngae ATCC 29220]
          Length = 325

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q++  G  I   G +G +   +
Sbjct: 246 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEIKAGQKIATMGSTGTSST-R 304

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 305 LHFEIRYKGKSVNPLRYLPQR 325


>gi|257466306|ref|ZP_05630617.1| cell wall endopeptidase [Fusobacterium gonidiaformans ATCC 25563]
 gi|315917463|ref|ZP_07913703.1| cell wall endopeptidase [Fusobacterium gonidiaformans ATCC 25563]
 gi|313691338|gb|EFS28173.1| cell wall endopeptidase [Fusobacterium gonidiaformans ATCC 25563]
          Length = 383

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+I+HD+   T Y+H+     + G++V RG  IG +G +G    P
Sbjct: 306 VVTFAGN-MSGYGKIIIIKHDNGYETRYAHLSQISTRVGERVERGELIGKTGNTGRTTGP 364

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R++   ++P+K+L
Sbjct: 365 HLHFEIRRSGKTLNPMKYL 383


>gi|170692343|ref|ZP_02883506.1| peptidase M23B [Burkholderia graminis C4D1M]
 gi|170142773|gb|EDT10938.1| peptidase M23B [Burkholderia graminis C4D1M]
          Length = 315

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H  +  V++G  V++G  I   G S ++    
Sbjct: 236 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRSLMVKEGDAVTKGQKIAEMGNS-DSDRVM 294

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 295 LHFEVRRQGKPVDPLKYL 312


>gi|167581695|ref|ZP_02374569.1| lipoprotein NlpD, putative [Burkholderia thailandensis TXDOH]
          Length = 296

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 217 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 275

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 276 LHFEVRRQGKPVDPLKYL 293


>gi|260774215|ref|ZP_05883130.1| cell wall endopeptidase family M23/M37 [Vibrio metschnikovii CIP
           69.14]
 gi|260611176|gb|EEX36380.1| cell wall endopeptidase family M23/M37 [Vibrio metschnikovii CIP
           69.14]
          Length = 437

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I I+H  + +T Y H+    VQKGQKV+RG  IGLSG +G    P +H+EL      
Sbjct: 327 GNYITIQHGSTYMTRYLHLSKILVQKGQKVTRGQRIGLSGATGRVTGPHIHYELIVRGRP 386

Query: 73  MDPIK 77
           +DP+K
Sbjct: 387 VDPMK 391


>gi|313200771|ref|YP_004039429.1| peptidase m23 [Methylovorus sp. MP688]
 gi|312440087|gb|ADQ84193.1| Peptidase M23 [Methylovorus sp. MP688]
          Length = 353

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 52/83 (62%), Gaps = 1/83 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G+DL   G  ++I+H+ + ++VY+H +   V++GQ+VSRG  I   G S +    +
Sbjct: 272 VIYSGSDLRGYGKLVIIKHNKTYLSVYAHNNQILVKEGQQVSRGQKIAEMGNS-DTDKVK 330

Query: 62  VHFELRKNAIAMDPIKFLEEKIP 84
           +HFE+R+   ++DP K+L    P
Sbjct: 331 LHFEIRQQGKSVDPAKYLPGSNP 353


>gi|120553861|ref|YP_958212.1| peptidase M23B [Marinobacter aquaeolei VT8]
 gi|120323710|gb|ABM18025.1| peptidase M23B [Marinobacter aquaeolei VT8]
          Length = 261

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L+  GN I++ H++  ++ Y+H     V++G+ V  G  I   G +G  + P+
Sbjct: 182 VVYAGNGLLGYGNLIIVNHNEHYLSAYAHNRKILVKEGEGVKAGQVIAELGNTGTDK-PK 240

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN   +DP ++L  +
Sbjct: 241 LHFEIRKNGNPVDPSRYLPRR 261


>gi|326386511|ref|ZP_08208134.1| peptidase M23B [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209172|gb|EGD59966.1| peptidase M23B [Novosphingobium nitrogenifigens DSM 19370]
          Length = 249

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G +    G  I+I H +   T Y+++    V++G+ V  G  I   G SG A  P 
Sbjct: 168 VIFAGTETERFGQLIIIDHGNGWATAYAYLGKVGVREGRLVKSGEVIARIGSSGEATAPT 227

Query: 62  VHFELRKNAIAMDPIKFLEEKI 83
           +HFELRKN + +DP+  L  ++
Sbjct: 228 LHFELRKNNLPVDPLSALPLRL 249


>gi|312792425|ref|YP_004025348.1| peptidase M23 [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312179565|gb|ADQ39735.1| Peptidase M23 [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 582

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+I H +   T Y H+    V  GQKV++G  I  SG +G +  P +HFE+RKN + 
Sbjct: 515 GKLIIINHQNGYQTYYGHLSRFLVSPGQKVAKGQLIAKSGSTGRSTGPHLHFEVRKNGVP 574

Query: 73  MDPIKFLE 80
            +P+++L+
Sbjct: 575 QNPLRYLQ 582


>gi|288800713|ref|ZP_06406170.1| M23/M37 peptidase domain protein [Prevotella sp. oral taxon 299
           str. F0039]
 gi|288332174|gb|EFC70655.1| M23/M37 peptidase domain protein [Prevotella sp. oral taxon 299
           str. F0039]
          Length = 214

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 41/64 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I+H + + T+YSH     V+ GQKV  G  IGL+G++G A  P +HFE++ N   
Sbjct: 122 GNCIVIKHAEGLETLYSHQSKNLVKVGQKVKAGELIGLTGRTGRATTPHLHFEVKWNGRH 181

Query: 73  MDPI 76
            +PI
Sbjct: 182 FNPI 185


>gi|284009101|emb|CBA76091.1| lipoprotein [Arsenophonus nasoniae]
          Length = 347

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V+  Q+V  G  I   G SG +   +
Sbjct: 268 VVYSGNALRGYGNLIIIKHNDDYLSAYAHNDTILVRDQQEVQAGQKIATMGSSGTSSV-R 326

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 327 LHFEIRYKGKSVNPLRYLSQR 347


>gi|146277890|ref|YP_001168049.1| peptidase M23B [Rhodobacter sphaeroides ATCC 17025]
 gi|145556131|gb|ABP70744.1| peptidase M23B [Rhodobacter sphaeroides ATCC 17025]
          Length = 446

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I IRHD  I TVY H+    V KGQ+VSRG  IG  G +G +    +H+E+R +   
Sbjct: 373 GRVIKIRHDFGIQTVYGHLSQIRVDKGQRVSRGDRIGDMGSTGRSTGTHLHYEVRVDGTP 432

Query: 73  MDPIKFLE 80
           ++P+ F++
Sbjct: 433 VNPMTFIK 440


>gi|187923826|ref|YP_001895468.1| peptidase M23 [Burkholderia phytofirmans PsJN]
 gi|187715020|gb|ACD16244.1| Peptidase M23 [Burkholderia phytofirmans PsJN]
          Length = 315

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H  +  V++G  V++G  I   G S ++    
Sbjct: 236 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRSLMVKEGDAVTKGQKIAEMGNS-DSDRVM 294

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 295 LHFEVRRQGKPVDPLKYL 312


>gi|154498150|ref|ZP_02036528.1| hypothetical protein BACCAP_02131 [Bacteroides capillosus ATCC
           29799]
 gi|150273140|gb|EDN00297.1| hypothetical protein BACCAP_02131 [Bacteroides capillosus ATCC
           29799]
          Length = 350

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y+G+  +  G    I H + + + Y+H     VQ+GQ VS G  I LSG +GN+  P
Sbjct: 270 VVDYIGDSPI-YGLYTQIDHGNGVTSFYAHCSELLVQQGQTVSMGDVIALSGDTGNSTGP 328

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFEL+K  I ++P+ ++
Sbjct: 329 HLHFELKKEGILLNPLYYI 347


>gi|302537387|ref|ZP_07289729.1| peptidase [Streptomyces sp. C]
 gi|302446282|gb|EFL18098.1| peptidase [Streptomyces sp. C]
          Length = 249

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 42/71 (59%), Gaps = 3/71 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA-- 70
           GN ++IRH+D   T Y H+ +  V  GQ V+ G  IGLSG +GN+  P +HFE R  A  
Sbjct: 173 GNNVVIRHNDGTYTQYGHLLSLSVSAGQTVTPGQQIGLSGSTGNSSGPHLHFEARTGATY 232

Query: 71  -IAMDPIKFLE 80
              ++P+ +L 
Sbjct: 233 GTDINPLTYLR 243


>gi|167752134|ref|ZP_02424261.1| hypothetical protein ALIPUT_00376 [Alistipes putredinis DSM 17216]
 gi|167660375|gb|EDS04505.1| hypothetical protein ALIPUT_00376 [Alistipes putredinis DSM 17216]
          Length = 372

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 39/68 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I++RHD+ + T Y H+    VQ G+ V  G  IGL G +G +  P +HFE R    A
Sbjct: 211 GNLIIVRHDNGLETYYGHLSERLVQSGEWVEAGQIIGLGGSTGRSTGPHLHFETRYYGQA 270

Query: 73  MDPIKFLE 80
            DP + ++
Sbjct: 271 FDPERLID 278


>gi|307132340|ref|YP_003884356.1| putative outer membrane lipoprotein [Dickeya dadantii 3937]
 gi|306529869|gb|ADM99799.1| predicted outer membrane lipoprotein [Dickeya dadantii 3937]
          Length = 408

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H +T  V++ Q+V  G  I   G +G +   +
Sbjct: 329 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNETMLVREQQEVKAGQQIATMGSTGTSS-VR 387

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 388 LHFEIRYKGKSVNPLRFLPQR 408


>gi|302870891|ref|YP_003839527.1| Peptidase M23 [Caldicellulosiruptor obsidiansis OB47]
 gi|302573750|gb|ADL41541.1| Peptidase M23 [Caldicellulosiruptor obsidiansis OB47]
          Length = 582

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+I H +   T Y H+    V  GQKV++G  I  SG +G +  P +HFE+RKN I 
Sbjct: 515 GKLIIINHQNGYKTYYGHLSRFLVSPGQKVAKGQLIAKSGSTGRSTGPHLHFEVRKNGIP 574

Query: 73  MDPIKFL 79
            +P+++L
Sbjct: 575 QNPLRYL 581


>gi|238750590|ref|ZP_04612090.1| hypothetical protein yrohd0001_4180 [Yersinia rohdei ATCC 43380]
 gi|238711238|gb|EEQ03456.1| hypothetical protein yrohd0001_4180 [Yersinia rohdei ATCC 43380]
          Length = 327

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 248 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 306

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 307 LHFEIRYKGKSVNPLRYLPQR 327


>gi|238898783|ref|YP_002924465.1| lipoprotein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|229466543|gb|ACQ68317.1| lipoprotein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 321

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H D  ++ Y+H D   V++ QKV  G  I   G SG A   +
Sbjct: 242 VVYAGNALRGYGNLIIIKHSDDYLSAYAHNDKILVREQQKVKAGQKIANMGSSG-ASSVK 300

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 301 LHFEIRYKGKSVNPLQYLSQR 321


>gi|226197348|ref|ZP_03792925.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|225930727|gb|EEH26737.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           Pakistan 9]
          Length = 296

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 217 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 275

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 276 LHFEVRRQGKPVDPLKYL 293


>gi|297190542|ref|ZP_06907940.1| secreted peptidase [Streptomyces pristinaespiralis ATCC 25486]
 gi|197717856|gb|EDY61764.1| secreted peptidase [Streptomyces pristinaespiralis ATCC 25486]
          Length = 304

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN ++I+H D   + Y+H+ +  V  GQ V+ G  IGLSG +GN+  P +HFE+R     
Sbjct: 228 GNEVVIQHTDGTYSQYAHLSSLAVSSGQSVTGGQQIGLSGSTGNSSGPHLHFEVRTGPSY 287

Query: 70  AIAMDPIKFLEE 81
              +DP+ +L E
Sbjct: 288 GSDIDPLAYLRE 299


>gi|114776317|ref|ZP_01451362.1| Membrane protein [Mariprofundus ferrooxydans PV-1]
 gi|114553147|gb|EAU55545.1| Membrane protein [Mariprofundus ferrooxydans PV-1]
          Length = 268

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y  + L   G  ++IRH +++ T Y+H     V+KG KV  G  I   G++G A  P 
Sbjct: 189 VVYSDSRLSGYGKLVIIRHGNNLFTAYAHNQRNLVRKGDKVRAGDVIARVGQTGRATGPH 248

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+ +  +DP+ +L
Sbjct: 249 LHFEVRQGSTPVDPLAYL 266


>gi|307729586|ref|YP_003906810.1| Peptidase M23 [Burkholderia sp. CCGE1003]
 gi|307584121|gb|ADN57519.1| Peptidase M23 [Burkholderia sp. CCGE1003]
          Length = 312

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 233 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 291

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 292 LHFEVRRQGKPVDPLKYL 309


>gi|251788477|ref|YP_003003198.1| peptidase M23 [Dickeya zeae Ech1591]
 gi|247537098|gb|ACT05719.1| Peptidase M23 [Dickeya zeae Ech1591]
          Length = 404

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H +T  V++ Q+V  G  I   G +G +   +
Sbjct: 325 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNETMLVREQQEVKAGQQIATMGSTGTSS-VR 383

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 384 LHFEIRYKGKSVNPLRFLPQR 404


>gi|238791264|ref|ZP_04634903.1| hypothetical protein yinte0001_30170 [Yersinia intermedia ATCC
           29909]
 gi|238729397|gb|EEQ20912.1| hypothetical protein yinte0001_30170 [Yersinia intermedia ATCC
           29909]
          Length = 321

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 242 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 300

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 301 LHFEIRYKGKSVNPLRYLPQR 321


>gi|121598281|ref|YP_993164.1| putative lipoprotein NlpD [Burkholderia mallei SAVP1]
 gi|124385128|ref|YP_001026061.1| putative lipoprotein NlpD [Burkholderia mallei NCTC 10229]
 gi|126441787|ref|YP_001059234.1| M23 family peptidase [Burkholderia pseudomallei 668]
 gi|126451107|ref|YP_001080671.1| putative lipoprotein NlpD [Burkholderia mallei NCTC 10247]
 gi|126454413|ref|YP_001066501.1| M23 family peptidase [Burkholderia pseudomallei 1106a]
 gi|134277130|ref|ZP_01763845.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           305]
 gi|167002253|ref|ZP_02268043.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei
           PRL-20]
 gi|167902386|ref|ZP_02489591.1| lipoprotein NlpD, putative [Burkholderia pseudomallei NCTC 13177]
 gi|167910628|ref|ZP_02497719.1| lipoprotein NlpD, putative [Burkholderia pseudomallei 112]
 gi|217421734|ref|ZP_03453238.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           576]
 gi|237812558|ref|YP_002897009.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           MSHR346]
 gi|238563550|ref|ZP_00438722.2| LysM domain/M23 peptidase domain protein [Burkholderia mallei GB8
           horse 4]
 gi|242315335|ref|ZP_04814351.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           1106b]
 gi|254177838|ref|ZP_04884493.1| putative lipoprotein NlpD [Burkholderia mallei ATCC 10399]
 gi|254189068|ref|ZP_04895579.1| peptidase, M23 family [Burkholderia pseudomallei Pasteur 52237]
 gi|254197841|ref|ZP_04904263.1| peptidase, M23 family [Burkholderia pseudomallei S13]
 gi|254199961|ref|ZP_04906327.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei FMH]
 gi|254206294|ref|ZP_04912646.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei JHU]
 gi|254260734|ref|ZP_04951788.1| peptidase, M23 family [Burkholderia pseudomallei 1710a]
 gi|254297418|ref|ZP_04964871.1| peptidase, M23 family [Burkholderia pseudomallei 406e]
 gi|254358291|ref|ZP_04974564.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei
           2002721280]
 gi|121227091|gb|ABM49609.1| putative lipoprotein NlpD [Burkholderia mallei SAVP1]
 gi|124293148|gb|ABN02417.1| putative lipoprotein NlpD [Burkholderia mallei NCTC 10229]
 gi|126221280|gb|ABN84786.1| peptidase, M23 family [Burkholderia pseudomallei 668]
 gi|126228055|gb|ABN91595.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           1106a]
 gi|126243977|gb|ABO07070.1| putative lipoprotein NlpD [Burkholderia mallei NCTC 10247]
 gi|134250780|gb|EBA50859.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           305]
 gi|147749557|gb|EDK56631.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei FMH]
 gi|147753737|gb|EDK60802.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei JHU]
 gi|148027418|gb|EDK85439.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei
           2002721280]
 gi|157806851|gb|EDO84021.1| peptidase, M23 family [Burkholderia pseudomallei 406e]
 gi|157936747|gb|EDO92417.1| peptidase, M23 family [Burkholderia pseudomallei Pasteur 52237]
 gi|160698877|gb|EDP88847.1| putative lipoprotein NlpD [Burkholderia mallei ATCC 10399]
 gi|169654582|gb|EDS87275.1| peptidase, M23 family [Burkholderia pseudomallei S13]
 gi|217395476|gb|EEC35494.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           576]
 gi|237505824|gb|ACQ98142.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           MSHR346]
 gi|238520505|gb|EEP83964.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei GB8
           horse 4]
 gi|242138574|gb|EES24976.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           1106b]
 gi|243062070|gb|EES44256.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei
           PRL-20]
 gi|254219423|gb|EET08807.1| peptidase, M23 family [Burkholderia pseudomallei 1710a]
          Length = 296

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 217 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 275

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 276 LHFEVRRQGKPVDPLKYL 293


>gi|53719138|ref|YP_108124.1| peptidase [Burkholderia pseudomallei K96243]
 gi|53723559|ref|YP_103015.1| lipoprotein NlpD [Burkholderia mallei ATCC 23344]
 gi|52209552|emb|CAH35505.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei
           K96243]
 gi|52426982|gb|AAU47575.1| lipoprotein NlpD, putative [Burkholderia mallei ATCC 23344]
          Length = 298

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 219 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 277

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 278 LHFEVRRQGKPVDPLKYL 295


>gi|332160358|ref|YP_004296935.1| lipoprotein NlpD [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318604408|emb|CBY25906.1| lipoprotein NlpD [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325664588|gb|ADZ41232.1| lipoprotein NlpD [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330859887|emb|CBX70218.1| lipoprotein nlpD [Yersinia enterocolitica W22703]
          Length = 321

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 242 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 300

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 301 LHFEIRYKGKSVNPLRYLPQR 321


>gi|238761663|ref|ZP_04622638.1| hypothetical protein ykris0001_11430 [Yersinia kristensenii ATCC
           33638]
 gi|238700177|gb|EEP92919.1| hypothetical protein ykris0001_11430 [Yersinia kristensenii ATCC
           33638]
          Length = 321

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 242 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 300

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 301 LHFEIRYKGKSVNPLRYLPQR 321


>gi|226951060|ref|YP_002806151.1| putative peptidase [Clostridium botulinum A2 str. Kyoto]
 gi|226843441|gb|ACO86107.1| putative peptidase [Clostridium botulinum A2 str. Kyoto]
          Length = 311

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I I+H   ++T+Y+H    YV+ GQ V +G  IG  G +G +  P VHFELRKN   
Sbjct: 244 GKVIKIQHSSELITIYAHCSNLYVKVGQYVKKGEKIGEVGSTGRSTGPHVHFELRKNNEP 303

Query: 73  MDPIKFLE 80
            +P+ +++
Sbjct: 304 CNPLIYIK 311


>gi|222529783|ref|YP_002573665.1| peptidase M23 [Caldicellulosiruptor bescii DSM 6725]
 gi|222456630|gb|ACM60892.1| Peptidase M23 [Caldicellulosiruptor bescii DSM 6725]
          Length = 379

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G TI+I +   I T+Y+H+ +  V  GQKV RG +IG  G +G A  P +HFE+R N   
Sbjct: 312 GKTIIIDNGSGISTLYAHLSSINVAVGQKVKRGESIGNVGATGYATGPHLHFEVRINGDV 371

Query: 73  MDPIKFL 79
            DP+ FL
Sbjct: 372 TDPLNFL 378


>gi|260892377|ref|YP_003238474.1| peptidase M23 [Ammonifex degensii KC4]
 gi|260864518|gb|ACX51624.1| Peptidase M23 [Ammonifex degensii KC4]
          Length = 372

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIYVG  L   G  +++ H   + T+Y+H+    V +GQ+V +G  IG  G +G A  P 
Sbjct: 296 VIYVGT-LRGYGLVVMVDHGGGLTTLYAHLSATAVSEGQEVKKGKPIGSVGATGLATGPH 354

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N +  DP  ++
Sbjct: 355 LHFEVRVNGVPQDPAGYV 372


>gi|288818541|ref|YP_003432889.1| lipoprotein [Hydrogenobacter thermophilus TK-6]
 gi|288787941|dbj|BAI69688.1| lipoprotein [Hydrogenobacter thermophilus TK-6]
 gi|308752131|gb|ADO45614.1| Peptidase M23 [Hydrogenobacter thermophilus TK-6]
          Length = 471

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 49/79 (62%), Gaps = 2/79 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G+DL   GN ++I H D  +++Y++     V++G+ VS+G  I  +G   N+    
Sbjct: 390 VIYSGDDLQAYGNMVIIEHGD-FISLYAYNSKNMVKRGETVSKGQQIATAGTKNNSGECM 448

Query: 62  VHFELR-KNAIAMDPIKFL 79
           +HFELR K+ + +DP ++L
Sbjct: 449 LHFELRTKDGVPLDPTEYL 467


>gi|167587039|ref|ZP_02379427.1| Peptidase M23B [Burkholderia ubonensis Bu]
          Length = 137

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 58  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 116

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 117 LHFEVRRQGKPVDPLKYL 134


>gi|242238322|ref|YP_002986503.1| peptidase M23 [Dickeya dadantii Ech703]
 gi|242130379|gb|ACS84681.1| Peptidase M23 [Dickeya dadantii Ech703]
          Length = 401

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H +T  V++ Q+V  G  I   G +G +   +
Sbjct: 322 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNETMLVREQQEVKAGQQIATMGSTGTSS-VR 380

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 381 LHFEIRYKGKSVNPLRFLPQR 401


>gi|170760060|ref|YP_001788950.1| putative peptidase [Clostridium botulinum A3 str. Loch Maree]
 gi|169407049|gb|ACA55460.1| putative peptidase [Clostridium botulinum A3 str. Loch Maree]
          Length = 311

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I I+H   ++T+Y+H    YV+ GQ V +G  IG  G +G +  P VHFELRKN   
Sbjct: 244 GKVIKIQHSSELITIYAHCSNLYVKVGQYVKKGEKIGEVGSTGRSTGPHVHFELRKNNEP 303

Query: 73  MDPIKFLE 80
            +P+ +++
Sbjct: 304 CNPLIYIK 311


>gi|168181075|ref|ZP_02615739.1| putative peptidase [Clostridium botulinum NCTC 2916]
 gi|182668083|gb|EDT80062.1| putative peptidase [Clostridium botulinum NCTC 2916]
          Length = 311

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I I+H   ++T+Y+H    YV+ GQ V +G  IG  G +G +  P VHFELRKN   
Sbjct: 244 GKVIKIQHSSELITIYAHCSNLYVKVGQYVKKGEKIGEVGSTGRSTGPHVHFELRKNNEP 303

Query: 73  MDPIKFLE 80
            +P+ +++
Sbjct: 304 CNPLIYIK 311


>gi|254384496|ref|ZP_04999837.1| peptidase [Streptomyces sp. Mg1]
 gi|194343382|gb|EDX24348.1| peptidase [Streptomyces sp. Mg1]
          Length = 264

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR---KN 69
           GN ++I+H+D   T Y H+ +  V  GQ+V+ G  IGLSG +GN+  P +HFE R   + 
Sbjct: 188 GNNVVIKHNDGTYTQYGHMSSLSVSVGQEVTAGQQIGLSGSTGNSSGPHLHFEARTGPQY 247

Query: 70  AIAMDPIKFL 79
              +DP+ +L
Sbjct: 248 GSDIDPVSYL 257


>gi|300779254|ref|ZP_07089112.1| cell wall endopeptidase family protein [Chryseobacterium gleum ATCC
           35910]
 gi|300504764|gb|EFK35904.1| cell wall endopeptidase family protein [Chryseobacterium gleum ATCC
           35910]
          Length = 285

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 47/83 (56%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G DL   GN I IRH +S +T Y H+   Y + G+ V  G  I  SG +GN+   
Sbjct: 183 VVIASGWDLGGGGNYIKIRHSNSFITSYLHLSEMYYKAGEFVKAGFIIAKSGNTGNSTGA 242

Query: 61  QVHFELRKNAIAMDPIKFLEEKI 83
            +HF + +N   ++PI+FL + I
Sbjct: 243 HLHFSVTENGKYINPIRFLNDLI 265


>gi|123441127|ref|YP_001005115.1| lipoprotein NlpD [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|122088088|emb|CAL10876.1| lipoprotein [Yersinia enterocolitica subsp. enterocolitica 8081]
          Length = 327

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 248 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 306

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 307 LHFEIRYKGKSVNPLRYLPQR 327


>gi|167753578|ref|ZP_02425705.1| hypothetical protein ALIPUT_01855 [Alistipes putredinis DSM 17216]
 gi|167658203|gb|EDS02333.1| hypothetical protein ALIPUT_01855 [Alistipes putredinis DSM 17216]
          Length = 315

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G TI+I H +   T YSH+    V++GQ+V RG  IGLSG +G +  P +H+E+R N + 
Sbjct: 225 GRTIVIDHGNGYETSYSHLLAVNVRRGQEVRRGDIIGLSGNTGLSIAPHLHYEVRHNGMR 284

Query: 73  MDPIKFL 79
           +DPI + 
Sbjct: 285 VDPIHYF 291


>gi|325522161|gb|EGD00815.1| peptidase M23B [Burkholderia sp. TJI49]
          Length = 240

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V ++G+     G  ++IRH+D   + Y+H+    P ++ G ++ RG  +G  G +G A 
Sbjct: 113 VVAFIGSAPRGFGKYVVIRHEDGYASYYAHLSAFEPTLRTGARIVRGQRVGAVGSTGTAT 172

Query: 59  HPQVHFELRKNAIAMDPIKFLE 80
            P +HFE+R++   +DPI  ++
Sbjct: 173 GPHLHFEVRRHGRLVDPIGLVQ 194


>gi|295676468|ref|YP_003604992.1| Peptidase M23 [Burkholderia sp. CCGE1002]
 gi|295436311|gb|ADG15481.1| Peptidase M23 [Burkholderia sp. CCGE1002]
          Length = 316

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 237 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 295

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 296 LHFEVRRQGKPVDPLKYL 313


>gi|262367054|gb|ACY63611.1| lipoprotein nlpD [Yersinia pestis D182038]
          Length = 205

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 126 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSSV-R 184

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 185 LHFEIRYKGKSVNPLRYLPQR 205


>gi|260599106|ref|YP_003211677.1| lipoprotein NlpD [Cronobacter turicensis z3032]
 gi|260218283|emb|CBA33242.1| Lipoprotein nlpD [Cronobacter turicensis z3032]
          Length = 297

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G SG +   +
Sbjct: 218 VVYAGSALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSSGTSST-R 276

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 277 LHFEIRYKGKSVNPLRYLPQR 297


>gi|163793027|ref|ZP_02187003.1| Peptidase M23B [alpha proteobacterium BAL199]
 gi|159181673|gb|EDP66185.1| Peptidase M23B [alpha proteobacterium BAL199]
          Length = 472

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 42/68 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H   ++T Y+H+    V++G+ V  G TIGL G SG +  P VH+E+R N  A
Sbjct: 394 GRVVEIDHGHGLMTRYAHLAKITVRRGEAVKLGRTIGLLGSSGRSSGPHVHYEVRYNGKA 453

Query: 73  MDPIKFLE 80
           ++P KFL+
Sbjct: 454 LNPAKFLK 461


>gi|257058542|ref|YP_003136430.1| peptidase M23 [Cyanothece sp. PCC 8802]
 gi|256588708|gb|ACU99594.1| Peptidase M23 [Cyanothece sp. PCC 8802]
          Length = 198

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G      G  I +RH D  +T Y H     V++GQ+V +G  I   G +GN+  P
Sbjct: 96  VVIYAGWSPEGYGQLIKLRHPDGSLTFYGHNSRLLVRRGQQVEQGQQISEMGSTGNSTGP 155

Query: 61  QVHFELRKNAI-AMDPIKFLEEKI 83
            +HFE+    I A++PI FL E +
Sbjct: 156 HLHFEIHPQGIQAVNPIAFLPEPV 179


>gi|292487250|ref|YP_003530122.1| lipoprotein nlpD/lppB [Erwinia amylovora CFBP1430]
 gi|291552669|emb|CBA19714.1| Lipoprotein nlpD/lppB homolog precursor [Erwinia amylovora
           CFBP1430]
 gi|312171352|emb|CBX79611.1| Lipoprotein nlpD/lppB homolog precursor [Erwinia amylovora ATCC
           BAA-2158]
          Length = 377

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSSV-R 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|292900378|ref|YP_003539747.1| lipoprotein [Erwinia amylovora ATCC 49946]
 gi|291200226|emb|CBJ47354.1| lipoprotein [Erwinia amylovora ATCC 49946]
          Length = 379

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSSV-R 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|56475839|ref|YP_157428.1| putative peptidase [Aromatoleum aromaticum EbN1]
 gi|56311882|emb|CAI06527.1| putative peptidase [Aromatoleum aromaticum EbN1]
          Length = 296

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+HD + +T Y+H     V++G+ V++G  I   G S +A  P+
Sbjct: 217 VVYSGSGLRGYGKLVIIKHDANYLTAYAHNQQLLVKEGESVTKGQRIAELG-STDADRPK 275

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK    +DP+K+L  +
Sbjct: 276 LHFEIRKQGRPVDPMKYLPAR 296


>gi|310766651|gb|ADP11601.1| lipoprotein NlpD [Erwinia sp. Ejp617]
          Length = 377

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSSV-R 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|192359906|ref|YP_001983376.1| peptidase [Cellvibrio japonicus Ueda107]
 gi|190686071|gb|ACE83749.1| peptidase [Cellvibrio japonicus Ueda107]
          Length = 309

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 40/69 (57%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           E GN + I+H   +VT Y+H  +  V+ G  V +G  I LSG +G +  P VHFE+ KN 
Sbjct: 236 EYGNLVEIKHGSGLVTRYAHNKSNQVKVGDVVKKGQVIALSGSTGRSTAPHVHFEVYKNG 295

Query: 71  IAMDPIKFL 79
             +DP  ++
Sbjct: 296 RVVDPASYI 304


>gi|134300902|ref|YP_001114398.1| peptidase M23B [Desulfotomaculum reducens MI-1]
 gi|134053602|gb|ABO51573.1| peptidase M23B [Desulfotomaculum reducens MI-1]
          Length = 374

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   G  ++I H   +V++Y H+    V KGQ V++G TI   G +G +  P 
Sbjct: 298 VIYSGT-MTGYGKVVMIDHGGDVVSLYGHLSAQLVSKGQVVTKGSTIAQVGSTGMSTGPH 356

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RKN  A+ P  +L
Sbjct: 357 LHFEVRKNGSAVSPHNYL 374


>gi|238786818|ref|ZP_04630619.1| hypothetical protein yfred0001_17880 [Yersinia frederiksenii ATCC
           33641]
 gi|238725186|gb|EEQ16825.1| hypothetical protein yfred0001_17880 [Yersinia frederiksenii ATCC
           33641]
          Length = 321

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 242 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 300

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 301 LHFEIRYKGKSVNPLRYLPQR 321


>gi|291448276|ref|ZP_06587666.1| peptidase [Streptomyces roseosporus NRRL 15998]
 gi|291351223|gb|EFE78127.1| peptidase [Streptomyces roseosporus NRRL 15998]
          Length = 243

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN I++R  D   T Y H+ +  V  GQ VS G  IGLSG +GN+  P +HFE R     
Sbjct: 167 GNNIVLRMADGTYTQYGHLSSIGVSVGQSVSSGQQIGLSGSTGNSTGPHLHFEARTTPDY 226

Query: 70  AIAMDPIKFLEE 81
              MDP+ +L  
Sbjct: 227 GSDMDPVAYLRS 238


>gi|289522334|ref|ZP_06439188.1| LysM domain/M23/M37 peptidase domain protein [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289504170|gb|EFD25334.1| LysM domain/M23/M37 peptidase domain protein [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 474

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T++I H     T+Y H ++  V++GQ+VS G  I   G +G A  P +HFE+RKN   
Sbjct: 407 GRTVVIDHGRGYRTLYGHCNSISVKRGQRVSAGQVIATVGATGRATGPHLHFEVRKNNSP 466

Query: 73  MDPIKFL 79
           ++P+K+L
Sbjct: 467 VNPLKYL 473


>gi|153938526|ref|YP_001392962.1| putative peptidase [Clostridium botulinum F str. Langeland]
 gi|152934422|gb|ABS39920.1| putative peptidase [Clostridium botulinum F str. Langeland]
 gi|295320939|gb|ADG01317.1| putative peptidase [Clostridium botulinum F str. 230613]
          Length = 311

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I I+H   ++T+Y+H    YV+ GQ V +G  IG  G +G +  P VHFELRKN   
Sbjct: 244 GKVIKIQHSSELITIYAHCSNLYVKVGQYVRKGEKIGEVGSTGRSTGPHVHFELRKNNEP 303

Query: 73  MDPIKFLE 80
            +P+ +++
Sbjct: 304 CNPLIYIK 311


>gi|304391528|ref|ZP_07373470.1| peptidase M23B [Ahrensia sp. R2A130]
 gi|303295757|gb|EFL90115.1| peptidase M23B [Ahrensia sp. R2A130]
          Length = 390

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H   I T Y+H+   +V+KGQK+ RG  IG  G +G +  P +H+E+R+    
Sbjct: 313 GKMVEIDHGGGITTRYAHLSRIHVKKGQKIKRGKRIGKVGSTGRSTGPHLHYEVRRKGRV 372

Query: 73  MDPIKFL 79
           +DPI ++
Sbjct: 373 LDPIHYV 379


>gi|262273682|ref|ZP_06051495.1| peptidase M23 [Grimontia hollisae CIP 101886]
 gi|262222097|gb|EEY73409.1| peptidase M23 [Grimontia hollisae CIP 101886]
          Length = 336

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D  +V + Q V +G  I   G SG     +
Sbjct: 257 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDRVFVSERQSVKKGQRIASMGSSG-TNSVR 315

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 316 LHFEIRYKGKSVNPLRYLPKR 336


>gi|268591357|ref|ZP_06125578.1| lipoprotein NlpD [Providencia rettgeri DSM 1131]
 gi|291313334|gb|EFE53787.1| lipoprotein NlpD [Providencia rettgeri DSM 1131]
          Length = 356

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V+  Q V+ G  I   G +G +   +
Sbjct: 277 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTLLVRDQQDVTAGQKIATMGSTGTSS-VR 335

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 336 LHFEIRYKGKSVNPLRYLPQR 356


>gi|259909442|ref|YP_002649798.1| lipoprotein NlpD [Erwinia pyrifoliae Ep1/96]
 gi|224965064|emb|CAX56596.1| lipoprotein NlpD [Erwinia pyrifoliae Ep1/96]
 gi|283479515|emb|CAY75431.1| Lipoprotein nlpD/lppB homolog precursor [Erwinia pyrifoliae DSM
           12163]
          Length = 377

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSSV-R 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|76810726|ref|YP_333761.1| peptidase [Burkholderia pseudomallei 1710b]
 gi|76580179|gb|ABA49654.1| similar to NlpD of Escherichia coli [Burkholderia pseudomallei
           1710b]
          Length = 292

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 213 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 271

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 272 LHFEVRRQGKPVDPLKYL 289


>gi|258591452|emb|CBE67753.1| putative Peptidase, M23/M37 family [NC10 bacterium 'Dutch
           sediment']
          Length = 321

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  L   GN + + H + I T Y+H+    V +GQ+V RG  IGL G +G    P
Sbjct: 228 VVTYTG-PLGGFGNVVSVNHGNKISTFYAHLQQHKVSQGQRVRRGDVIGLVGTTGRVTGP 286

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E++ N + +DP K++
Sbjct: 287 HLHYEIQVNEVPVDPTKYV 305


>gi|254230503|ref|ZP_04923876.1| M23 peptidase domain protein [Vibrio sp. Ex25]
 gi|262393288|ref|YP_003285142.1| membrane protein [Vibrio sp. Ex25]
 gi|151936975|gb|EDN55860.1| M23 peptidase domain protein [Vibrio sp. Ex25]
 gi|262336882|gb|ACY50677.1| membrane protein [Vibrio sp. Ex25]
          Length = 307

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A+  +
Sbjct: 230 VVYSGNALRGYGNLIIVKHNDNYLSAYAHNDKLLVSEGQSVKSGQKIATMGSSG-AKSVK 288

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 289 LHFEIRYQGKSVNPKRYL 306


>gi|89093835|ref|ZP_01166781.1| hypothetical protein MED92_05034 [Oceanospirillum sp. MED92]
 gi|89081965|gb|EAR61191.1| hypothetical protein MED92_05034 [Oceanospirillum sp. MED92]
          Length = 460

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I I+H  S  T Y H+   YV KGQ+V RG  I LSG SG +  P +HFEL KN   
Sbjct: 347 GLYIEIKHGQSYKTRYLHLKKSYVIKGQRVKRGQKIALSGNSGRSTGPHLHFELHKNG-- 404

Query: 73  MDPIKFLEEKIP 84
             P+  ++ KIP
Sbjct: 405 -RPVNAMKAKIP 415


>gi|91783465|ref|YP_558671.1| putative lipoprotein/metalloendopeptidase [Burkholderia xenovorans
           LB400]
 gi|91687419|gb|ABE30619.1| Putative lipoprotein/metalloendopeptidase [Burkholderia xenovorans
           LB400]
          Length = 311

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 232 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 290

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 291 LHFEVRRQGKPVDPLKYL 308


>gi|282866085|ref|ZP_06275133.1| Peptidase M23 [Streptomyces sp. ACTE]
 gi|282559124|gb|EFB64678.1| Peptidase M23 [Streptomyces sp. ACTE]
          Length = 306

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN I+I+H D + + Y+H+ +  V  GQ V+ G  IGLSG +GN+  P +HFE+R     
Sbjct: 230 GNEIVIQHSDGMYSQYAHLSSLGVSAGQTVTGGEQIGLSGSTGNSTGPHLHFEVRTGPSY 289

Query: 70  AIAMDPIKFL 79
              +DPI +L
Sbjct: 290 GSDVDPIAYL 299


>gi|269960388|ref|ZP_06174761.1| lipoprotein NlpD [Vibrio harveyi 1DA3]
 gi|269834815|gb|EEZ88901.1| lipoprotein NlpD [Vibrio harveyi 1DA3]
          Length = 307

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A+  +
Sbjct: 230 VVYSGNALRGYGNLIIVKHNDNYLSAYAHNDRLLVSEGQSVKSGQKIATMGSSG-AKSVK 288

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 289 LHFEIRYQGKSVNPKRYL 306


>gi|260219680|emb|CBA26525.1| Lipoprotein nlpD/lppB homolog [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 297

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+++H+++ +T Y+H  T  V++ Q V RG  I   G S +A   +
Sbjct: 218 VVYAGSGLRGYGNLIILKHNNTYLTAYAHNQTLLVKEDQTVKRGQKIAEMGNS-DADRVK 276

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK    +DP K+L  +
Sbjct: 277 LHFEVRKQGKPVDPTKYLPAR 297


>gi|238797131|ref|ZP_04640633.1| hypothetical protein ymoll0001_8390 [Yersinia mollaretii ATCC
           43969]
 gi|238718978|gb|EEQ10792.1| hypothetical protein ymoll0001_8390 [Yersinia mollaretii ATCC
           43969]
          Length = 309

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 230 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 288

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 289 LHFEIRYKGKSVNPLRYLPQR 309


>gi|170755374|ref|YP_001783243.1| putative peptidase [Clostridium botulinum B1 str. Okra]
 gi|169120586|gb|ACA44422.1| putative peptidase [Clostridium botulinum B1 str. Okra]
          Length = 311

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I I+H   ++T+Y+H    YV+ GQ V +G  IG  G +G +  P VHFELRKN   
Sbjct: 244 GKVIKIQHSSELITIYAHCSNLYVKVGQYVRKGEKIGEVGSTGRSTGPHVHFELRKNNEP 303

Query: 73  MDPIKFLE 80
            +P+ +++
Sbjct: 304 CNPLIYIK 311


>gi|37524719|ref|NP_928063.1| lipoprotein NlpD [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36784144|emb|CAE13013.1| Lipoprotein NlpD precursor [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 331

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q +  G  I   G +G +   +
Sbjct: 252 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQDIKAGQKIATMGSTGTSS-VR 310

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 311 LHFEIRYKGKSVNPLRYLPQR 331


>gi|331092154|ref|ZP_08340984.1| hypothetical protein HMPREF9477_01627 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330401926|gb|EGG81500.1| hypothetical protein HMPREF9477_01627 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 377

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  GN  V  GN ++IRH + + T Y H    +V KGQKVSRG  I   GK+G    P 
Sbjct: 300 VIRTGNQAVR-GNYVVIRHPNGLTTWYQHCTDIFVSKGQKVSRGQNIATVGKTGRVSGPH 358

Query: 62  VHFELRKNAIAM-DPIKFL 79
           +HF + + +  + DP K+L
Sbjct: 359 LHFIVEEASGELVDPRKYL 377


>gi|323526139|ref|YP_004228292.1| peptidase M23 [Burkholderia sp. CCGE1001]
 gi|323383141|gb|ADX55232.1| Peptidase M23 [Burkholderia sp. CCGE1001]
          Length = 315

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 236 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 294

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 295 LHFEVRRQGKPVDPLKYL 312


>gi|220931939|ref|YP_002508847.1| peptidase M23B [Halothermothrix orenii H 168]
 gi|219993249|gb|ACL69852.1| peptidase M23B [Halothermothrix orenii H 168]
          Length = 274

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 47/70 (67%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H D+ +T Y+H     V+KG++V +G  I LSG SG++  P +HFE+R     
Sbjct: 197 GNLVIIKHRDNKLTYYAHNLRLLVKKGERVKQGRIIALSGNSGDSTGPHLHFEIRVGNRV 256

Query: 73  MDPIKFLEEK 82
           ++P+++L ++
Sbjct: 257 VNPLQYLNKR 266


>gi|331006080|ref|ZP_08329416.1| Lipoprotein NlpD precursor [gamma proteobacterium IMCC1989]
 gi|330420117|gb|EGG94447.1| Lipoprotein NlpD precursor [gamma proteobacterium IMCC1989]
          Length = 307

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGN-AQHP 60
           ++Y G+ L   G  I+I+H+D  ++ Y+H     V++GQKV  G  I   G SG+ A  P
Sbjct: 224 IVYAGSGLRGYGQLIIIKHNDRYLSAYAHNSRIRVKEGQKVKVGQHIADIGSSGSRANIP 283

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
           ++HFE+R+N  +++P+ +L ++
Sbjct: 284 KLHFEIRRNGQSVNPLTYLPKR 305


>gi|304399207|ref|ZP_07381074.1| Peptidase M23 [Pantoea sp. aB]
 gi|304353261|gb|EFM17641.1| Peptidase M23 [Pantoea sp. aB]
          Length = 322

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 243 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSSV-R 301

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 302 LHFEIRYKGKSVNPLRYLPQR 322


>gi|238786007|ref|ZP_04629968.1| hypothetical protein yberc0001_11770 [Yersinia bercovieri ATCC
           43970]
 gi|238713068|gb|EEQ05119.1| hypothetical protein yberc0001_11770 [Yersinia bercovieri ATCC
           43970]
          Length = 309

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 230 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 288

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 289 LHFEIRYKGKSVNPLRYLPQR 309


>gi|294677087|ref|YP_003577702.1| M23 family peptidase [Rhodobacter capsulatus SB 1003]
 gi|294475907|gb|ADE85295.1| peptidase, M23B subfamily [Rhodobacter capsulatus SB 1003]
          Length = 436

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I +RH   + TVY H+    V+ GQKVSRG  IG +G +G +  P +H+E+R     
Sbjct: 363 GQVIKLRHKFGVSTVYGHLSKIRVKVGQKVSRGEIIGDTGNTGRSTGPHLHYEIRVGGAP 422

Query: 73  MDPIKFLE 80
           ++P+ F++
Sbjct: 423 INPMTFIK 430


>gi|297545599|ref|YP_003677901.1| peptidase M23 [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
 gi|296843374|gb|ADH61890.1| Peptidase M23 [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
          Length = 451

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H +  VT Y H     V+KG KV++G  I L G +G+A  P VHFE+RKN + 
Sbjct: 383 GYLVKIDHHNGYVTYYGHASKLLVKKGDKVAKGQKIALVGSTGHATGPHVHFEVRKNGVP 442

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 443 VNPLPYL 449


>gi|78066591|ref|YP_369360.1| peptidase M23B [Burkholderia sp. 383]
 gi|77967336|gb|ABB08716.1| Peptidase M23B [Burkholderia sp. 383]
          Length = 294

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 215 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 273

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 274 LHFEVRRQGKPVDPLKYL 291


>gi|320538976|ref|ZP_08038651.1| putative predicted outer membrane lipoprotein [Serratia symbiotica
           str. Tucson]
 gi|320030909|gb|EFW12913.1| putative predicted outer membrane lipoprotein [Serratia symbiotica
           str. Tucson]
          Length = 318

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  +   G +G +   +
Sbjct: 239 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKVATMGSTGTSS-VR 297

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+ +L ++
Sbjct: 298 LHFEIRYKGKSVNPLHYLPQR 318


>gi|313903601|ref|ZP_07836991.1| Peptidase M23 [Thermaerobacter subterraneus DSM 13965]
 gi|313466154|gb|EFR61678.1| Peptidase M23 [Thermaerobacter subterraneus DSM 13965]
          Length = 519

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GNTI+I HD++  T+Y H+   YV+ GQ V RG  IGL G +G +    +HF +  N   
Sbjct: 452 GNTIIIAHDETYSTLYGHLSRRYVEPGQVVRRGQVIGLMGTTGASTGTHLHFGVWVNGQP 511

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 512 VNPMPYL 518


>gi|294010607|ref|YP_003544067.1| peptidase M23B [Sphingobium japonicum UT26S]
 gi|292673937|dbj|BAI95455.1| peptidase M23B [Sphingobium japonicum UT26S]
          Length = 396

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 43/70 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + + H + I+T Y+H+     + GQ+V+RG  I   G +G +  P +HFE+R N  A
Sbjct: 306 GNVVEVTHGNGILTRYAHLSGFSARVGQQVARGGAIARMGSTGRSTGPHLHFEVRVNGNA 365

Query: 73  MDPIKFLEEK 82
           ++P +FLE +
Sbjct: 366 INPRRFLEAR 375


>gi|312876998|ref|ZP_07736972.1| Peptidase M23 [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796229|gb|EFR12584.1| Peptidase M23 [Caldicellulosiruptor lactoaceticus 6A]
          Length = 582

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+I H +   T Y H+    V  GQKV++G  I  SG +G +  P +HFE+RKN + 
Sbjct: 515 GKLIIINHQNGYQTYYGHLSRFLVNPGQKVAKGQLIAKSGSTGRSTGPHLHFEVRKNGVP 574

Query: 73  MDPIKFL 79
            +P+++L
Sbjct: 575 QNPLRYL 581


>gi|289579455|ref|YP_003478082.1| peptidase M23 [Thermoanaerobacter italicus Ab9]
 gi|289529168|gb|ADD03520.1| Peptidase M23 [Thermoanaerobacter italicus Ab9]
          Length = 451

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H +  VT Y H     V+KG KV++G  I L G +G+A  P VHFE+RKN + 
Sbjct: 383 GYLVKIDHHNGYVTYYGHASKLLVKKGDKVAKGQKIALVGSTGHATGPHVHFEVRKNGVP 442

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 443 VNPLPYL 449


>gi|152993704|ref|YP_001359425.1| M24/M37 family peptidase [Sulfurovum sp. NBC37-1]
 gi|151425565|dbj|BAF73068.1| peptidase, M23/M37 family [Sulfurovum sp. NBC37-1]
          Length = 429

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + IRH     + Y+H     V++GQKV +G  IG  G SG +  P +HF L+KN   
Sbjct: 289 GRVVQIRHGGGYESFYAHQSRMRVKRGQKVKKGQIIGYVGSSGRSTGPHLHFGLKKNGRW 348

Query: 73  MDPIKFLEEK 82
           +DP+K+L +K
Sbjct: 349 VDPMKYLRKK 358


>gi|182434748|ref|YP_001822467.1| M23 family secreted peptidase [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326775265|ref|ZP_08234530.1| Peptidase M23 [Streptomyces cf. griseus XylebKG-1]
 gi|178463264|dbj|BAG17784.1| putative M23-family secreted peptidase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326655598|gb|EGE40444.1| Peptidase M23 [Streptomyces cf. griseus XylebKG-1]
          Length = 317

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 48/84 (57%), Gaps = 4/84 (4%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
            V+  GN     GN ++I+H+D + + Y+H  +  V  GQ V+ G  IGLSG +GN+  P
Sbjct: 230 TVVSAGNSG-SYGNEVVIKHEDGMYSQYAHQSSLNVSVGQTVTGGQQIGLSGSTGNSTGP 288

Query: 61  QVHFELRKN---AIAMDPIKFLEE 81
            +HFE+R        +DPI +L +
Sbjct: 289 HLHFEVRTGPSYGSDVDPIAYLRQ 312


>gi|71891956|ref|YP_277686.1| lipoprotein NlpD precursor [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|71796062|gb|AAZ40813.1| lipoprotein NlpD precursor [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
          Length = 317

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y+GN L   GN I+I+HD++ ++ Y+H D   V + Q V  G  I   G SG     +
Sbjct: 238 VVYIGNTLKGYGNLIIIKHDNNYLSAYAHNDMILVNEQQTVKMGDKIATMGNSG-TNEVK 296

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+ +L+ +
Sbjct: 297 LHFEIRYKGKSVDPLFYLQNR 317


>gi|325672586|ref|ZP_08152282.1| M23 family cell wall peptidase [Rhodococcus equi ATCC 33707]
 gi|325556463|gb|EGD26129.1| M23 family cell wall peptidase [Rhodococcus equi ATCC 33707]
          Length = 214

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR-KNA 70
            G  I IRH+D  VT Y H D  +V+ GQ+VS G  IGL G  G +  P +HFE+     
Sbjct: 138 FGLWIRIRHNDGTVTTYGHNDVNFVKVGQRVSVGQQIGLVGSRGQSTGPHLHFEVDLPGW 197

Query: 71  IAMDPIKFLEEK 82
           I +DPI +L  +
Sbjct: 198 IKIDPIPWLAAR 209


>gi|28899328|ref|NP_798933.1| lipoprotein NlpD [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839202|ref|ZP_01991869.1| lipoprotein NlpD [Vibrio parahaemolyticus AQ3810]
 gi|260361830|ref|ZP_05774846.1| lipoprotein NlpD [Vibrio parahaemolyticus K5030]
 gi|260878981|ref|ZP_05891336.1| lipoprotein NlpD [Vibrio parahaemolyticus AN-5034]
 gi|260895454|ref|ZP_05903950.1| lipoprotein NlpD [Vibrio parahaemolyticus Peru-466]
 gi|260902363|ref|ZP_05910758.1| lipoprotein NlpD [Vibrio parahaemolyticus AQ4037]
 gi|28807552|dbj|BAC60817.1| lipoprotein NlpD [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747267|gb|EDM58253.1| lipoprotein NlpD [Vibrio parahaemolyticus AQ3810]
 gi|308088219|gb|EFO37914.1| lipoprotein NlpD [Vibrio parahaemolyticus Peru-466]
 gi|308090475|gb|EFO40170.1| lipoprotein NlpD [Vibrio parahaemolyticus AN-5034]
 gi|308110562|gb|EFO48102.1| lipoprotein NlpD [Vibrio parahaemolyticus AQ4037]
 gi|308114472|gb|EFO52012.1| lipoprotein NlpD [Vibrio parahaemolyticus K5030]
 gi|328474139|gb|EGF44944.1| lipoprotein NlpD [Vibrio parahaemolyticus 10329]
          Length = 307

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A+  +
Sbjct: 230 VVYSGNALRGYGNLIIVKHNDNYLSAYAHNDKLLVTEGQSVKSGQKIATMGSSG-AKSVK 288

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 289 LHFEIRYQGKSVNPKRYL 306


>gi|91227835|ref|ZP_01262008.1| lipoprotein NlpD [Vibrio alginolyticus 12G01]
 gi|91188345|gb|EAS74641.1| lipoprotein NlpD [Vibrio alginolyticus 12G01]
          Length = 307

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A+  +
Sbjct: 230 VVYSGNALRGYGNLIIVKHNDNYLSAYAHNDKLLVTEGQSVKSGQKIATMGSSG-AKSVK 288

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 289 LHFEIRYQGKSVNPKRYL 306


>gi|282600222|ref|ZP_06257515.1| lipoprotein NlpD [Providencia rustigianii DSM 4541]
 gi|282566346|gb|EFB71881.1| lipoprotein NlpD [Providencia rustigianii DSM 4541]
          Length = 267

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V+  Q V+ G  I   G +G +   +
Sbjct: 188 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTLLVRDQQDVAEGQKIATMGSTGTSS-VR 246

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 247 LHFEIRYKGKSVNPLRYLPQR 267


>gi|145284375|gb|ABP51954.1| lipoprotein NlpD [Vibrio alginolyticus]
          Length = 92

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2  VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
          V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A+  +
Sbjct: 15 VVYSGNALRGYGNLIIVKHNDNYLSAYAHNDKLLVTEGQSVKSGQKIATMGSSG-AKSVK 73

Query: 62 VHFELRKNAIAMDPIKFL 79
          +HFE+R    +++P ++L
Sbjct: 74 LHFEIRYQGKSVNPKRYL 91


>gi|241766104|ref|ZP_04764015.1| Peptidase M23 [Acidovorax delafieldii 2AN]
 gi|241363857|gb|EER59177.1| Peptidase M23 [Acidovorax delafieldii 2AN]
          Length = 496

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 7/78 (8%)

Query: 5   VGNDLVEL-------GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNA 57
           VG+ +VE        GN + ++H +   TVY+H+    V+KGQ V +G T+G  G +G A
Sbjct: 375 VGDGVVEFAGVQNGFGNVVFVKHRNQHETVYAHLSRIDVKKGQSVEQGQTLGAVGATGWA 434

Query: 58  QHPQVHFELRKNAIAMDP 75
             P +HFE R N    DP
Sbjct: 435 TGPHLHFEFRVNGQHQDP 452


>gi|319943747|ref|ZP_08018028.1| LysM domain/M23 peptidase domain protein [Lautropia mirabilis ATCC
           51599]
 gi|319742980|gb|EFV95386.1| LysM domain/M23 peptidase domain protein [Lautropia mirabilis ATCC
           51599]
          Length = 320

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GN I+I+H + +++VY+H  +  V++GQ+V+RG  I   G +GN Q P 
Sbjct: 241 VIFSGQGPRGYGNLIIIKHSNEMLSVYAHNRSLAVKEGQQVTRGQKIAELGDAGNGQ-PA 299

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP   L ++
Sbjct: 300 LHFEVRQGGKPVDPAGVLPKR 320


>gi|312139530|ref|YP_004006866.1| metallopeptidase [Rhodococcus equi 103S]
 gi|311888869|emb|CBH48182.1| putative secreted metallopeptidase [Rhodococcus equi 103S]
          Length = 202

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR-KNA 70
            G  I IRH+D  VT Y H D  +V+ GQ+VS G  IGL G  G +  P +HFE+     
Sbjct: 126 FGLWIRIRHNDGTVTTYGHNDVNFVKVGQRVSVGQQIGLVGSRGQSTGPHLHFEVDLPGW 185

Query: 71  IAMDPIKFLEEK 82
           I +DPI +L  +
Sbjct: 186 IKIDPIPWLAAR 197


>gi|251780122|ref|ZP_04823042.1| peptidase, M23/M37 family [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243084437|gb|EES50327.1| peptidase, M23/M37 family [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 395

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 43/68 (63%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I I+H+D + T+Y H+ +  V+KGQ++ +G  IG  G +G +  P +HFELR     
Sbjct: 326 GNMIKIKHEDGLETLYGHLSSINVKKGQEIKKGDVIGAVGSTGRSTGPHLHFELRSKGTP 385

Query: 73  MDPIKFLE 80
           ++P  +++
Sbjct: 386 INPETYIK 393


>gi|167619811|ref|ZP_02388442.1| lipoprotein NlpD, putative [Burkholderia thailandensis Bt4]
 gi|257138957|ref|ZP_05587219.1| lipoprotein NlpD, putative [Burkholderia thailandensis E264]
          Length = 296

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 217 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 275

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 276 LHFEVRRQGKPVDPLKYL 293


>gi|325280524|ref|YP_004253066.1| Peptidase M23 [Odoribacter splanchnicus DSM 20712]
 gi|324312333|gb|ADY32886.1| Peptidase M23 [Odoribacter splanchnicus DSM 20712]
          Length = 323

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 41/66 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  +LI H  +  T+Y+H+    V+ GQKV RG  IG  G +G +  P +H+E++KN I 
Sbjct: 233 GKCVLIDHGFNYQTLYAHMSAYNVKAGQKVKRGDIIGYMGNTGMSTGPHIHYEVKKNGIP 292

Query: 73  MDPIKF 78
           +DPI +
Sbjct: 293 VDPINY 298


>gi|170703619|ref|ZP_02894361.1| peptidase M23B [Burkholderia ambifaria IOP40-10]
 gi|170131476|gb|EDT00062.1| peptidase M23B [Burkholderia ambifaria IOP40-10]
          Length = 120

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 41  VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 99

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 100 LHFEVRRQGKPVDPLKYL 117


>gi|78776643|ref|YP_392958.1| peptidase M23B [Sulfurimonas denitrificans DSM 1251]
 gi|78497183|gb|ABB43723.1| Peptidase M23B [Sulfurimonas denitrificans DSM 1251]
          Length = 285

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 43/77 (55%)

Query: 3   IYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQV 62
           + +  D    G +ILI H D I T Y H+    V++GQ+V +G  +GLSG SG    P +
Sbjct: 200 VALAKDRFYSGMSILINHGDGIYTCYFHMSRFDVKEGQRVKKGELLGLSGDSGRVSGPHL 259

Query: 63  HFELRKNAIAMDPIKFL 79
           HF +R     +DP+ F+
Sbjct: 260 HFGVRVGGKQVDPLHFM 276


>gi|332298959|ref|YP_004440881.1| Peptidase M23 [Treponema brennaborense DSM 12168]
 gi|332182062|gb|AEE17750.1| Peptidase M23 [Treponema brennaborense DSM 12168]
          Length = 340

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ VG D    GN I+I+H   I T Y+H+DT  V+KGQ VS+G  IG  G +G    P 
Sbjct: 258 VVTVGYD-SGFGNYIIIKHKHGIYTRYAHMDTFRVKKGQFVSQGEVIGTIGNTGITTGPH 316

Query: 62  VHFELRKNAIAMDPIKFLEEKI 83
           +H+E+   +  +DP K++  K+
Sbjct: 317 LHYEVHIGSDVVDPAKYINVKL 338


>gi|302390227|ref|YP_003826048.1| Peptidase M23 [Thermosediminibacter oceani DSM 16646]
 gi|302200855|gb|ADL08425.1| Peptidase M23 [Thermosediminibacter oceani DSM 16646]
          Length = 382

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 42/67 (62%)

Query: 14  NTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAM 73
           NT+++ H   I T+Y+H+    V  G+KV RG  +GL G +G +  P +HFE+RKN   +
Sbjct: 316 NTVIVDHGGGISTLYAHLSKILVSDGEKVKRGDRVGLVGSTGYSTGPHLHFEVRKNGQHV 375

Query: 74  DPIKFLE 80
           +P  +L+
Sbjct: 376 NPWNWLK 382


>gi|212711365|ref|ZP_03319493.1| hypothetical protein PROVALCAL_02437 [Providencia alcalifaciens DSM
           30120]
 gi|212686094|gb|EEB45622.1| hypothetical protein PROVALCAL_02437 [Providencia alcalifaciens DSM
           30120]
          Length = 275

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V+  Q V+ G  I   G +G +   +
Sbjct: 196 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTLLVRDQQDVAEGQKIATMGSTGTSSV-R 254

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 255 LHFEIRYKGKSVNPLRYLPQR 275


>gi|195952544|ref|YP_002120834.1| Peptidase M23 [Hydrogenobaculum sp. Y04AAS1]
 gi|195932156|gb|ACG56856.1| Peptidase M23 [Hydrogenobaculum sp. Y04AAS1]
          Length = 353

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 2/80 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G+DLV  GN  ++     I+TVY++    +V+KGQ V++G TIGL G        
Sbjct: 273 IVVYSGDDLVAYGNMAIV-DGGGIITVYAYNQKLFVKKGQMVNKGQTIGLVGTKPGTSIC 331

Query: 61  QVHFELR-KNAIAMDPIKFL 79
           ++HFELR K+   +DPI + 
Sbjct: 332 ELHFELRSKDGTPIDPITYF 351


>gi|186475726|ref|YP_001857196.1| peptidase M23B [Burkholderia phymatum STM815]
 gi|184192185|gb|ACC70150.1| peptidase M23B [Burkholderia phymatum STM815]
          Length = 312

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 233 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 291

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 292 LHFEVRRQGKPVDPMKYL 309


>gi|188587871|ref|YP_001922686.1| peptidase, M23/M37 family [Clostridium botulinum E3 str. Alaska
           E43]
 gi|188498152|gb|ACD51288.1| peptidase, M23/M37 family [Clostridium botulinum E3 str. Alaska
           E43]
          Length = 377

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 43/68 (63%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I I+H+D + T+Y H+ +  V+KGQ++ +G  IG  G +G +  P +HFELR     
Sbjct: 309 GNMIKIKHEDGLETLYGHLSSINVKKGQEIKKGDVIGAVGSTGRSTGPHLHFELRSKGTP 368

Query: 73  MDPIKFLE 80
           ++P  +++
Sbjct: 369 INPETYIK 376


>gi|291544459|emb|CBL17568.1| Membrane proteins related to metalloendopeptidases [Ruminococcus
           sp. 18P13]
          Length = 587

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 42/78 (53%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G +    G  +++ H +  VTVY H    YV +GQ+VSRG  +   G +G +    
Sbjct: 505 VTYAGWNAGGYGYLVMVDHGNGYVTVYGHCSMIYVSEGQEVSRGQRMAAVGSTGRSTGNH 564

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N +  DP  FL
Sbjct: 565 LHFEVRYNGMYCDPTGFL 582


>gi|254386474|ref|ZP_05001777.1| peptidase [Streptomyces sp. Mg1]
 gi|194345322|gb|EDX26288.1| peptidase [Streptomyces sp. Mg1]
          Length = 247

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (58%), Gaps = 3/78 (3%)

Query: 6   GNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFE 65
           G D    GN I+++H ++  + Y+H+    V  GQKV++   I LSG +GN+  P +HFE
Sbjct: 164 GGDGPAYGNAIVVKHANNTYSQYAHLSKIKVNIGQKVAKNQLIALSGNTGNSSGPHLHFE 223

Query: 66  LRKNA---IAMDPIKFLE 80
           +R  A    A++P+ FL 
Sbjct: 224 IRTTANYGSAVNPVSFLR 241


>gi|82701688|ref|YP_411254.1| peptidase M23B [Nitrosospira multiformis ATCC 25196]
 gi|82409753|gb|ABB73862.1| Peptidase M23B [Nitrosospira multiformis ATCC 25196]
          Length = 457

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 13  GNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           GN I++ H+ S  TVY H+      ++KGQ+V +G+ IG  G +G A  P +HFE R N 
Sbjct: 351 GNFIILEHEGSYATVYGHLSAFAKGLRKGQRVRQGYVIGRVGATGLASGPHLHFEFRVNG 410

Query: 71  IAMDPIK 77
           I  DP+K
Sbjct: 411 IQRDPLK 417


>gi|302537974|ref|ZP_07290316.1| predicted protein [Streptomyces sp. C]
 gi|302446869|gb|EFL18685.1| predicted protein [Streptomyces sp. C]
          Length = 339

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN ++I+H D   + Y H+ +  V  GQ V+ G TIGLSG +GN   P +HFE+R     
Sbjct: 263 GNEVVIKHADGKYSQYGHLSSLSVSVGQSVTGGQTIGLSGATGNVTGPHLHFEIRTGPSY 322

Query: 70  AIAMDPIKFLEEK 82
              +DP+ +L  K
Sbjct: 323 GSDIDPLAYLRSK 335


>gi|319794528|ref|YP_004156168.1| peptidase m23 [Variovorax paradoxus EPS]
 gi|315596991|gb|ADU38057.1| Peptidase M23 [Variovorax paradoxus EPS]
          Length = 166

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 51/82 (62%), Gaps = 2/82 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVG++L   GN ++++H+++ +T Y+H  T  V++   V +G  I   G+  +    +
Sbjct: 85  VVYVGSELRSYGNMVIVKHNETFLTAYAHAQTILVKENAVVRQGEKIAEMGRDND--RVK 142

Query: 62  VHFELRKNAIAMDPIKFLEEKI 83
           +HFE+RKN  A+DP  +L  ++
Sbjct: 143 LHFEIRKNGTAVDPEPYLNGRL 164


>gi|312876760|ref|ZP_07736739.1| Peptidase M23 [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796491|gb|EFR12841.1| Peptidase M23 [Caldicellulosiruptor lactoaceticus 6A]
          Length = 379

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G TI+I +   I T+Y+H+ +  V  GQKV +G +IG  G +G A  P +HFE+R N   
Sbjct: 312 GKTIIIDNGSGISTLYAHLSSINVSVGQKVKKGESIGSVGATGYATGPHLHFEVRINGDV 371

Query: 73  MDPIKFL 79
            DP+ FL
Sbjct: 372 TDPLNFL 378


>gi|254293769|ref|YP_003059792.1| peptidase M23 [Hirschia baltica ATCC 49814]
 gi|254042300|gb|ACT59095.1| Peptidase M23 [Hirschia baltica ATCC 49814]
          Length = 620

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 46/81 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G++L   G  ILI H +  V+ Y+H +   V++ Q + +G  I   G++G+   PQ
Sbjct: 537 VVYAGSELPGFGLLILINHGNGWVSAYAHAEELLVEENQPIRQGQAIAKVGETGSVDRPQ 596

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HF+LR+    +DP   L  K
Sbjct: 597 LHFQLRRGKSPIDPASHLLPK 617


>gi|83721288|ref|YP_442746.1| lipoprotein NlpD [Burkholderia thailandensis E264]
 gi|83655113|gb|ABC39176.1| lipoprotein NlpD, putative [Burkholderia thailandensis E264]
          Length = 292

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 213 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 271

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 272 LHFEVRRQGKPVDPLKYL 289


>gi|297191594|ref|ZP_06908992.1| M23 family secreted peptidase [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197719334|gb|EDY63242.1| M23 family secreted peptidase [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 264

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA-- 70
           GN ++IR +D   T Y H+ +  V  GQ+V+ G  IGLSG +GN+  P +HFE R  A  
Sbjct: 188 GNNVVIRMNDGTYTQYGHLSSISVSVGQQVAPGRQIGLSGSTGNSTGPHLHFEARTTAEY 247

Query: 71  -IAMDPIKFL 79
              +DP+ +L
Sbjct: 248 GSDIDPVAYL 257


>gi|4929284|gb|AAD33932.1|AF144608_1 lipoprotein NlpD [Vibrio parahaemolyticus]
          Length = 203

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
            V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A+  
Sbjct: 125 TVVYSGNALRGYGNLIIVKHNDNYLSAYAHNDKLLVTEGQSVKSGQKIATMGSSG-AKSV 183

Query: 61  QVHFELRKNAIAMDPIKFL 79
           ++HFE+R    +++P ++L
Sbjct: 184 KLHFEIRYQGKSVNPKRYL 202


>gi|269965238|ref|ZP_06179372.1| lipoprotein NlpD [Vibrio alginolyticus 40B]
 gi|269830224|gb|EEZ84451.1| lipoprotein NlpD [Vibrio alginolyticus 40B]
          Length = 307

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A+  +
Sbjct: 230 VVYSGNALRGYGNLIIVKHNDNYLSAYAHNDKLLVTEGQSVKSGQKIATMGSSG-AKSVK 288

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 289 LHFEIRYQGKSVNPKRYL 306


>gi|254179541|ref|ZP_04886140.1| peptidase, M23 family [Burkholderia pseudomallei 1655]
 gi|184210081|gb|EDU07124.1| peptidase, M23 family [Burkholderia pseudomallei 1655]
          Length = 296

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 217 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 275

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 276 LHFEVRRQGKPVDPLKYL 293


>gi|88798285|ref|ZP_01113871.1| metalloendopeptidase-like membrane protein [Reinekea sp. MED297]
 gi|88779061|gb|EAR10250.1| metalloendopeptidase-like membrane protein [Reinekea sp. MED297]
          Length = 103

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y GN L   GN I++ H  S+++ Y+  D   V++  +V  G  I   GK G+   P
Sbjct: 24  VVVYAGNGLPGYGNLIILEHSGSLLSAYAFNDEMLVKEKDRVRSGQQIATMGKQGD--QP 81

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R+N   +DP+ +L ++
Sbjct: 82  GLHFEIRRNGKPVDPLTYLPDR 103


>gi|158522495|ref|YP_001530365.1| peptidase M23B [Desulfococcus oleovorans Hxd3]
 gi|158511321|gb|ABW68288.1| peptidase M23B [Desulfococcus oleovorans Hxd3]
          Length = 313

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 44/68 (64%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
           LGN ++I H + ++T Y H+   + ++G+ VSR   +G  G +G +  P +H+E+R N +
Sbjct: 244 LGNAVMIDHGNGVITRYGHLSECFKKRGETVSREDVVGAVGNTGISTGPHLHYEVRINGV 303

Query: 72  AMDPIKFL 79
           A++P K++
Sbjct: 304 AVNPEKYI 311


>gi|89899537|ref|YP_522008.1| peptidase M23B [Rhodoferax ferrireducens T118]
 gi|89344274|gb|ABD68477.1| peptidase M23B [Rhodoferax ferrireducens T118]
          Length = 465

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 41/71 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+++H ++  TVY+H+    V+KG+ VS+   IG  G +G A  P +HFE R N + 
Sbjct: 360 GNVIILQHRNNYKTVYAHLSRINVRKGESVSQSQNIGAVGATGWATGPHLHFEYRINGVY 419

Query: 73  MDPIKFLEEKI 83
            DP     E +
Sbjct: 420 TDPQNIARENV 430


>gi|307130893|ref|YP_003882909.1| putative peptidase [Dickeya dadantii 3937]
 gi|306528422|gb|ADM98352.1| predicted peptidase [Dickeya dadantii 3937]
          Length = 470

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           E GN + +RH     T Y H++   V+ GQK+ RG  IGLSG +G +  P +H+EL  N 
Sbjct: 373 EAGNFVAVRHGRQYTTRYMHMNRLLVKPGQKIKRGDRIGLSGNTGRSTGPHLHYELWVNQ 432

Query: 71  IAMDPIKFLEEKIP 84
            A++P   L  K+P
Sbjct: 433 QAVNP---LTAKLP 443


>gi|149378179|ref|ZP_01895896.1| Membrane protein [Marinobacter algicola DG893]
 gi|149357541|gb|EDM46046.1| Membrane protein [Marinobacter algicola DG893]
          Length = 251

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L+  GN I++ H++  ++ Y+H     VQ+G+ V  G  I   G SG    P+
Sbjct: 172 VVYAGSGLLGYGNLIIVNHNEHYLSAYAHNRKILVQEGEDVKAGQVIAELGNSG-TDRPK 230

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN   +DP  +L  +
Sbjct: 231 LHFEIRKNGNPVDPAHYLPAR 251


>gi|313500210|gb|ADR61576.1| Peptidase M23B [Pseudomonas putida BIRD-1]
          Length = 352

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 273 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 331

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 332 LHFEIRRQGKPVDPLQFLPRR 352


>gi|257057269|ref|YP_003135101.1| metalloendopeptidase-like membrane protein [Saccharomonospora
           viridis DSM 43017]
 gi|256587141|gb|ACU98274.1| metalloendopeptidase-like membrane protein [Saccharomonospora
           viridis DSM 43017]
          Length = 326

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            G  + ++HD+ ++TVY HI+   V  GQ+V  G  I   G  G +  P +HFE+ +N +
Sbjct: 252 FGLWVRVQHDNGLITVYGHINESLVSVGQRVEAGQQIATMGNRGQSTGPHLHFEVHENGV 311

Query: 72  AMDPIKFLE 80
            +DP+ +LE
Sbjct: 312 KIDPLPWLE 320


>gi|104783165|ref|YP_609663.1| peptidase M23B [Pseudomonas entomophila L48]
 gi|95112152|emb|CAK16879.1| putative Peptidase M23B [Pseudomonas entomophila L48]
          Length = 261

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 182 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 240

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 241 LHFEIRRQGKPVDPLQFLPRR 261


>gi|307546201|ref|YP_003898680.1| outer membrane lipoprotein [Halomonas elongata DSM 2581]
 gi|307218225|emb|CBV43495.1| predicted outer membrane lipoprotein [Halomonas elongata DSM 2581]
          Length = 368

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G+ +   GN IL++H+D  ++ Y+H DT  V++   V  G  I   G S +AQ  
Sbjct: 288 IVVYAGSGVRGYGNLILLKHNDEYLSAYAHNDTLRVKENDVVQAGEVIATMGDS-DAQDV 346

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
           ++HFE+RK+    DP+++L  +
Sbjct: 347 RLHFEVRKDGQPQDPLEYLPAR 368


>gi|294141939|ref|YP_003557917.1| lipoprotein NlpD [Shewanella violacea DSS12]
 gi|293328408|dbj|BAJ03139.1| lipoprotein NlpD [Shewanella violacea DSS12]
          Length = 327

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D+ ++ Y+H D   V++ Q VS G T+   G +G      
Sbjct: 248 VVYAGSALRGYGNLVIIKHSDNFLSAYAHADKILVKEKQFVSVGQTLATMGNTG-TDRVM 306

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  ++DP+K+L ++
Sbjct: 307 LHFEIRYHGKSVDPLKYLPKQ 327


>gi|304387121|ref|ZP_07369369.1| lipoprotein NlpD [Neisseria meningitidis ATCC 13091]
 gi|304338795|gb|EFM04901.1| lipoprotein NlpD [Neisseria meningitidis ATCC 13091]
          Length = 180

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 102 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 160

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 161 LHFEVRQNGKPVNPNSYI 178


>gi|310823412|ref|YP_003955770.1| M23 peptidase domain-containing protein [Stigmatella aurantiaca
           DW4/3-1]
 gi|309396484|gb|ADO73943.1| M23 peptidase domain protein [Stigmatella aurantiaca DW4/3-1]
          Length = 336

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 40/66 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H   + T Y H     V+ GQ+V+RG TI  SG +G +  P +H++L  +A A
Sbjct: 258 GKVLIIDHGRGVTTAYCHNSELLVRSGQRVARGETIARSGNTGRSTGPHLHYQLELSAQA 317

Query: 73  MDPIKF 78
           +DP++F
Sbjct: 318 VDPLRF 323


>gi|145225973|ref|YP_001136627.1| peptidase M23B [Mycobacterium gilvum PYR-GCK]
 gi|145218436|gb|ABP47839.1| peptidase M23B [Mycobacterium gilvum PYR-GCK]
          Length = 339

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            G  + IR  D  VT+Y HIDT  VQ GQ+V  G  I   G  GN+  P +HFE+ +N  
Sbjct: 263 FGMWVKIRAGDGTVTLYGHIDTTMVQTGQRVMAGDQIATMGNRGNSTGPHLHFEVHRNGT 322

Query: 72  -AMDPIKFLEEK 82
             +DP+ +L E+
Sbjct: 323 DKIDPMAWLGER 334


>gi|290968812|ref|ZP_06560349.1| peptidase, M23 family [Megasphaera genomosp. type_1 str. 28L]
 gi|290781108|gb|EFD93699.1| peptidase, M23 family [Megasphaera genomosp. type_1 str. 28L]
          Length = 415

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H   I T+Y+H  +  V  GQ V++G  +  SG +GN   P +HFE+R+N   
Sbjct: 349 GYAVIIDHGGGISTLYAHNSSLLVHAGQSVAKGQVVARSGATGNVTGPHIHFEVRRNGTP 408

Query: 73  MDPIKFL 79
           ++P+ FL
Sbjct: 409 VNPLSFL 415


>gi|251789851|ref|YP_003004572.1| hypothetical protein Dd1591_2250 [Dickeya zeae Ech1591]
 gi|247538472|gb|ACT07093.1| Peptidase M23 [Dickeya zeae Ech1591]
          Length = 470

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           E GN + +RH     T Y H++   V+ GQK+ RG  IGLSG +G +  P +H+EL  N 
Sbjct: 373 EAGNFVAVRHGRQYTTRYMHMNRLLVKPGQKIKRGDRIGLSGNTGRSTGPHLHYELWVNQ 432

Query: 71  IAMDPIKFLEEKIP 84
            A++P   L  K+P
Sbjct: 433 QAVNP---LTAKLP 443


>gi|291540818|emb|CBL13929.1| Membrane proteins related to metalloendopeptidases [Roseburia
           intestinalis XB6B4]
          Length = 520

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 42/67 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN+++I H D  +T Y+H     V+ GQKV +G  I LSG +G +  P VHFE+     A
Sbjct: 452 GNSVVISHADGRLTRYAHNSKLLVKVGQKVEQGEPIALSGSTGRSTGPHVHFEIYIGGAA 511

Query: 73  MDPIKFL 79
           ++P+K++
Sbjct: 512 VNPLKYI 518


>gi|188026336|ref|ZP_02997867.1| hypothetical protein PROSTU_03760 [Providencia stuartii ATCC 25827]
 gi|188022513|gb|EDU60553.1| hypothetical protein PROSTU_03760 [Providencia stuartii ATCC 25827]
          Length = 268

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V+  Q V+ G  I   G +G +   +
Sbjct: 189 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTLLVRDQQDVAAGQKIATMGSTGTSS-VR 247

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 248 LHFEIRYKGKSVNPLRYLPQR 268


>gi|46201598|ref|ZP_00208164.1| COG0739: Membrane proteins related to metalloendopeptidases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 399

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 43/67 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T+ + H + + T Y+H+    V++GQKV+R   +GL G +G +  P +H+E+R   +A
Sbjct: 323 GLTVDVNHGNGVTTRYAHMSRIKVKEGQKVTRTTVVGLLGNTGRSTGPHLHYEVRVADVA 382

Query: 73  MDPIKFL 79
            DP+KF+
Sbjct: 383 KDPLKFI 389


>gi|330959228|gb|EGH59488.1| lipoprotein [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 288

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 268 LHFEIRRQGKPVDPLEFLPRR 288


>gi|206890222|ref|YP_002247906.1| membrane protein [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206742160|gb|ACI21217.1| membrane protein [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 278

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H     TVY+H     V  GQKV RG  I +SG +G+   P +H+E+ KN   
Sbjct: 208 GNVVMIKHGYGFTTVYAHNKQNLVNVGQKVKRGDIIAISGNTGSTTGPHLHYEVWKNNSP 267

Query: 73  MDPIKFLEE 81
           + P+ +L+E
Sbjct: 268 VSPLSYLKE 276


>gi|17229854|ref|NP_486402.1| lipoprotein [Nostoc sp. PCC 7120]
 gi|17131454|dbj|BAB74061.1| lipoprotein [Nostoc sp. PCC 7120]
          Length = 77

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%)

Query: 13 GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
          G T++I H   I T+Y H    YV +GQ V RG  I   G +G +  P +HFE+R+N   
Sbjct: 11 GRTVIINHGGGITTLYGHASELYVSEGQTVQRGQAIASVGSTGLSTGPHLHFEVRRNGTP 70

Query: 73 MDPIKFL 79
          ++P  +L
Sbjct: 71 VNPADYL 77


>gi|126727186|ref|ZP_01743023.1| Peptidoglycan-binding LysM (possible peptidase) [Rhodobacterales
           bacterium HTCC2150]
 gi|126703614|gb|EBA02710.1| Peptidoglycan-binding LysM (possible peptidase) [Rhodobacterales
           bacterium HTCC2150]
          Length = 385

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 3/65 (4%)

Query: 16  ILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDP 75
           ++IRH D+I+TVY++ID   V KG K++RG T+ +  KS  A    VHFE+RK   ++DP
Sbjct: 324 LVIRHSDNILTVYANIDGIKVAKGDKITRGQTVAVVRKSNPA---FVHFEIRKGFESVDP 380

Query: 76  IKFLE 80
           + FL+
Sbjct: 381 LPFLQ 385


>gi|308187167|ref|YP_003931298.1| hypothetical protein Pvag_1661 [Pantoea vagans C9-1]
 gi|308057677|gb|ADO09849.1| hypothetical protein Pvag_1661 [Pantoea vagans C9-1]
          Length = 443

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH    +T Y H+    V+ GQKV RG  IGLSG +G +  P +HFE+  N  A
Sbjct: 348 GNYVAIRHGRQYMTRYMHMKKVLVKPGQKVKRGDRIGLSGNTGRSTGPHLHFEIWINNQA 407

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 408 VNP---LTAKLP 416


>gi|296272871|ref|YP_003655502.1| Peptidase M23 [Arcobacter nitrofigilis DSM 7299]
 gi|296097045|gb|ADG92995.1| Peptidase M23 [Arcobacter nitrofigilis DSM 7299]
          Length = 311

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN     GN+I+I H   I T Y H+    V+KGQKV R   IGLSG +G    P
Sbjct: 224 IVRFAGNRFYS-GNSIIIDHGQGIFTCYFHLSKILVKKGQKVKRDERIGLSGDTGRITGP 282

Query: 61  QVHFELRKNAIAMDP---IKFLEE 81
            +HF  R + I +DP    K L E
Sbjct: 283 HLHFGTRIHGILVDPQELFKLLNE 306


>gi|239944810|ref|ZP_04696747.1| M23 family secreted peptidase [Streptomyces roseosporus NRRL 15998]
 gi|239991275|ref|ZP_04711939.1| M23 family secreted peptidase [Streptomyces roseosporus NRRL 11379]
          Length = 271

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN I++R  D   T Y H+ +  V  GQ VS G  IGLSG +GN+  P +HFE R     
Sbjct: 195 GNNIVLRMADGTYTQYGHLSSIGVSVGQSVSSGQQIGLSGSTGNSTGPHLHFEARTTPDY 254

Query: 70  AIAMDPIKFL 79
              MDP+ +L
Sbjct: 255 GSDMDPVAYL 264


>gi|167719256|ref|ZP_02402492.1| lipoprotein NlpD, putative [Burkholderia pseudomallei DM98]
          Length = 135

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 56  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 114

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 115 LHFEVRRQGKPVDPLKYL 132


>gi|254671770|emb|CBA09616.1| putative peptidase [Neisseria meningitidis alpha153]
          Length = 228

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 150 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 208

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 209 LHFEVRQNGKPVNPNSYI 226


>gi|260773543|ref|ZP_05882459.1| lipoprotein NlpD [Vibrio metschnikovii CIP 69.14]
 gi|260612682|gb|EEX37885.1| lipoprotein NlpD [Vibrio metschnikovii CIP 69.14]
          Length = 322

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
            V+Y GN L   GN I+I+H+D  ++ Y+H D   VQ+GQ V+ G  I   G SG     
Sbjct: 244 TVVYSGNALRGYGNLIIIKHNDDYLSAYAHNDQLLVQEGQNVTAGQKIATMGSSGTTSV- 302

Query: 61  QVHFELRKNAIAMDPIKFL 79
           ++HFE+R     ++P ++L
Sbjct: 303 RLHFEIRYQGKPVNPQRYL 321


>gi|85372947|ref|YP_457009.1| membrane protein [Erythrobacter litoralis HTCC2594]
 gi|84786030|gb|ABC62212.1| membrane protein [Erythrobacter litoralis HTCC2594]
          Length = 260

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++   +    G  +LI H +   T Y H+    VQKG  V  G  IG++G +G A  P+
Sbjct: 178 VVFADEEKTRFGRQVLIDHGNGWQTSYGHLARITVQKGDVVKAGERIGIAGDAGKATRPE 237

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R++   +DP   L ++
Sbjct: 238 LHFEIRRDGKDVDPASKLPQR 258


>gi|167893936|ref|ZP_02481338.1| lipoprotein NlpD, putative [Burkholderia pseudomallei 7894]
          Length = 134

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 55  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 113

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 114 LHFEVRRQGKPVDPLKYL 131


>gi|120601199|ref|YP_965599.1| peptidase M23B [Desulfovibrio vulgaris DP4]
 gi|120561428|gb|ABM27172.1| peptidase M23B [Desulfovibrio vulgaris DP4]
 gi|311235284|gb|ADP88138.1| Peptidase M23 [Desulfovibrio vulgaris RCH1]
          Length = 301

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G D    GN ++++H   + T Y+H+    V++GQ + RG  IG  G SG    P 
Sbjct: 223 VTFAGTDGA-YGNCVILQHGAGLSTRYAHMQRFVVKEGQSIQRGDIIGYVGSSGRTTGPH 281

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N + ++P++++
Sbjct: 282 LHYEVRVNGVCVNPMRYI 299


>gi|167562538|ref|ZP_02355454.1| lipoprotein NlpD, putative [Burkholderia oklahomensis EO147]
          Length = 143

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 64  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 122

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 123 LHFEVRRQGKPVDPLKYL 140


>gi|298369341|ref|ZP_06980659.1| hypothetical protein HMPREF9016_01011 [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298283344|gb|EFI24831.1| hypothetical protein HMPREF9016_01011 [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 229

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G ++   G  ILI H+ + +T Y+H DT  VQKGQ V+ G  I   G S +    +
Sbjct: 150 VLYAGEEVRGYGKLILISHNTATITAYAHNDTILVQKGQTVTAGQQIATMGSS-DTDIFK 208

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R N  A++P+ +L +
Sbjct: 209 LHFEVRINGKAVNPVPYLTK 228


>gi|171058603|ref|YP_001790952.1| peptidase M23B [Leptothrix cholodnii SP-6]
 gi|170776048|gb|ACB34187.1| peptidase M23B [Leptothrix cholodnii SP-6]
          Length = 315

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+++ +T Y+H     V++ Q V RG  I   G S +A+  Q
Sbjct: 236 VVYAGSGLRGYGNLVIIKHNETYLTAYAHNQALLVREDQPVRRGQKIAEMG-STDAERVQ 294

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP + L  +
Sbjct: 295 LHFEIRRRGKPIDPARLLPAR 315


>gi|297159379|gb|ADI09091.1| peptidase [Streptomyces bingchenggensis BCW-1]
          Length = 295

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN I+I+H D+  + Y+H+    V  GQ V+ G  IGLSG +GN   P +HFE+R     
Sbjct: 219 GNAIVIKHADNTYSQYAHLSLVKVSVGQTVATGQEIGLSGNTGNTTGPHLHFEIRTTPNY 278

Query: 70  AIAMDPIKFLEE 81
             A++P+ FL  
Sbjct: 279 GSAVEPLAFLRS 290


>gi|261250228|ref|ZP_05942804.1| lipoprotein NlpD [Vibrio orientalis CIP 102891]
 gi|260939344|gb|EEX95330.1| lipoprotein NlpD [Vibrio orientalis CIP 102891]
          Length = 302

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+D+ ++ Y+H D   V++GQ V  G  I   G SG A   +
Sbjct: 225 VVYSGNALRGYGNLVIIKHNDNYLSAYAHNDRLLVREGQSVKAGQKIATMGSSG-ASSVR 283

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 284 LHFEIRYQGKSVNPKRYL 301


>gi|167815443|ref|ZP_02447123.1| lipoprotein NlpD, putative [Burkholderia pseudomallei 91]
          Length = 130

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 51  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 109

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 110 LHFEVRRQGKPVDPLKYL 127


>gi|46581642|ref|YP_012450.1| M24/M37 family peptidase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46451065|gb|AAS97710.1| peptidase, M23/M37 family [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 329

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G D    GN ++++H   + T Y+H+    V++GQ + RG  IG  G SG    P 
Sbjct: 251 VTFAGTDGA-YGNCVILQHGAGLSTRYAHMQRFVVKEGQSIQRGDIIGYVGSSGRTTGPH 309

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N + ++P++++
Sbjct: 310 LHYEVRVNGVCVNPMRYI 327


>gi|323493641|ref|ZP_08098762.1| membrane protein [Vibrio brasiliensis LMG 20546]
 gi|323312164|gb|EGA65307.1| membrane protein [Vibrio brasiliensis LMG 20546]
          Length = 303

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+D+ ++ Y+H D   V +GQ V  G  I   G SG A   +
Sbjct: 226 VVYSGNALRGYGNLVIIKHNDNYLSAYAHNDRLLVHEGQSVKAGQKIATMGSSG-ASSVR 284

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 285 LHFEIRYQGKSVNPKRYL 302


>gi|167738253|ref|ZP_02411027.1| lipoprotein NlpD, putative [Burkholderia pseudomallei 14]
          Length = 143

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 64  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 122

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 123 LHFEVRRQGKPVDPLKYL 140


>gi|325521808|gb|EGD00540.1| lipoprotein NlpD, putative [Burkholderia sp. TJI49]
          Length = 86

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2  VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
          V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 7  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 65

Query: 62 VHFELRKNAIAMDPIKFL 79
          +HFE+R+    +DP+K+L
Sbjct: 66 LHFEVRRQGKPVDPLKYL 83


>gi|91776178|ref|YP_545934.1| peptidase M23B [Methylobacillus flagellatus KT]
 gi|91710165|gb|ABE50093.1| peptidase M23B [Methylobacillus flagellatus KT]
          Length = 333

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 51/78 (65%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G+DL   G  ++I+H+++ ++VY+H     V++GQ+V+RG  I   G + +    +
Sbjct: 252 VIYSGSDLRGYGKLVIIKHNNTFLSVYAHNSNILVKEGQQVTRGQKIAEMGDT-DTDKVK 310

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+   ++DP K+L
Sbjct: 311 LHFEIRRQGKSVDPSKYL 328


>gi|325293234|ref|YP_004279098.1| membrane protein associated metalloendopeptidase [Agrobacterium sp.
           H13-3]
 gi|325061087|gb|ADY64778.1| membrane protein associated metalloendopeptidase [Agrobacterium sp.
           H13-3]
          Length = 438

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H   + T + H+ T  V+ G KV  G  +G +G +G +  P VH+E+R+N   
Sbjct: 361 GNMVEIDHGQGVSTRFGHLSTILVKAGDKVEAGDIVGRAGSTGRSTGPHVHYEVRRNDTP 420

Query: 73  MDPIKFL 79
           +DP++FL
Sbjct: 421 VDPMRFL 427


>gi|224369758|ref|YP_002603922.1| putative metalloendopeptidase; cell wall-binding protein associated
           metalloendopeptidase [Desulfobacterium autotrophicum
           HRM2]
 gi|223692475|gb|ACN15758.1| putative metalloendopeptidase; cell wall-binding protein associated
           metalloendopeptidase [Desulfobacterium autotrophicum
           HRM2]
          Length = 309

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G   + +G  ++I H   IVT + H+D  +V+KG +V+RG  IGL G +G +   
Sbjct: 230 VVAYAGEKRL-IGKMVMIDHGHGIVTKFGHMDKIFVKKGAEVNRGEVIGLMGNTGRSTGS 288

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VH+E+R N   ++P K++
Sbjct: 289 HVHYEVRINGTPVNPEKYI 307


>gi|242280056|ref|YP_002992185.1| peptidase M23 [Desulfovibrio salexigens DSM 2638]
 gi|242122950|gb|ACS80646.1| Peptidase M23 [Desulfovibrio salexigens DSM 2638]
          Length = 301

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 43/67 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H  ++ T Y H+  P V+KGQ+V+RG  IG +G +G +  P VH+E+R   + 
Sbjct: 233 GKLVKINHGANLSTRYGHMKQPIVKKGQEVTRGELIGYAGNTGRSTGPHVHYEVRLGGVP 292

Query: 73  MDPIKFL 79
           ++P++++
Sbjct: 293 VNPMRYI 299


>gi|303250315|ref|ZP_07336514.1| outer membrane antigenic lipoprotein B [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302650785|gb|EFL80942.1| outer membrane antigenic lipoprotein B [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 373

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G   + +
Sbjct: 294 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNSN-K 352

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 353 LHFEIRYKGKSVDPTRYLPRK 373


>gi|303251708|ref|ZP_07337879.1| outer membrane antigenic lipoprotein B [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302649138|gb|EFL79323.1| outer membrane antigenic lipoprotein B [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
          Length = 373

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G   + +
Sbjct: 294 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNSN-K 352

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 353 LHFEIRYKGKSVDPTRYLPRK 373


>gi|239945649|ref|ZP_04697586.1| M23 family secreted peptidase [Streptomyces roseosporus NRRL 15998]
 gi|239992119|ref|ZP_04712783.1| M23 family secreted peptidase [Streptomyces roseosporus NRRL 11379]
 gi|291449107|ref|ZP_06588497.1| secreted peptidase [Streptomyces roseosporus NRRL 15998]
 gi|291352054|gb|EFE78958.1| secreted peptidase [Streptomyces roseosporus NRRL 15998]
          Length = 323

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 4/84 (4%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
            V+  GN     GN ++I+H+D + + Y+H     V  GQ V+ G  IGLSG +GN+  P
Sbjct: 236 TVVSAGNS-GSYGNEVVIKHEDGMYSQYAHQSALNVSVGQTVTGGQQIGLSGSTGNSTGP 294

Query: 61  QVHFELRKN---AIAMDPIKFLEE 81
            +HFE+R        +DPI +L +
Sbjct: 295 HLHFEVRTGPSYGSDVDPIAYLRQ 318


>gi|88812405|ref|ZP_01127655.1| Peptidase M23B [Nitrococcus mobilis Nb-231]
 gi|88790412|gb|EAR21529.1| Peptidase M23B [Nitrococcus mobilis Nb-231]
          Length = 255

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+ + +T Y +     V++G KV  G  I   G  G A  P 
Sbjct: 176 VVYSGNGLRGYGNLIIVKHNGTYITAYGYNRELLVREGDKVRVGQIIARMG-LGPAHQPA 234

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R+N   +DP+++L
Sbjct: 235 AHFEIRRNGKPVDPLRYL 252


>gi|167836383|ref|ZP_02463266.1| lipoprotein NlpD, putative [Burkholderia thailandensis MSMB43]
          Length = 163

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 84  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 142

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 143 LHFEVRRQGKPVDPLKYL 160


>gi|115351255|ref|YP_773094.1| peptidase M23B [Burkholderia ambifaria AMMD]
 gi|115281243|gb|ABI86760.1| peptidase M23B [Burkholderia ambifaria AMMD]
          Length = 230

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+   +T Y+H     V++GQ V++G TI   G S ++    
Sbjct: 151 VVYAGNGLRGYGNLIILKHNADYLTAYAHNRALLVKEGQSVTQGQTIAEMGNS-DSDRVA 209

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 210 LHFELRYGGRSIDPARYLPAR 230


>gi|170697979|ref|ZP_02889062.1| peptidase M23B [Burkholderia ambifaria IOP40-10]
 gi|170137145|gb|EDT05390.1| peptidase M23B [Burkholderia ambifaria IOP40-10]
          Length = 230

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+   +T Y+H     V++GQ V++G TI   G S ++    
Sbjct: 151 VVYAGNGLRGYGNLIILKHNADYLTAYAHNRALLVKEGQSVTQGQTIAEMGNS-DSDRVA 209

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 210 LHFELRYGGRSIDPARYLPAR 230


>gi|172060283|ref|YP_001807935.1| peptidase M23 [Burkholderia ambifaria MC40-6]
 gi|171992800|gb|ACB63719.1| Peptidase M23 [Burkholderia ambifaria MC40-6]
          Length = 230

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+   +T Y+H     V++GQ V++G TI   G S ++    
Sbjct: 151 VVYAGNGLRGYGNLIILKHNADYLTAYAHNRALLVKEGQSVTQGQTIAEMGNS-DSDRVA 209

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 210 LHFELRYGGRSIDPARYLPAR 230


>gi|320007249|gb|ADW02099.1| Peptidase M23 [Streptomyces flavogriseus ATCC 33331]
          Length = 300

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN ++I+H D + + Y+H+ +  V  GQ V+ G  IGLSG +GN+  P +HFE+R     
Sbjct: 224 GNEVVIQHSDGMYSQYAHLSSLEVTTGQTVTGGQQIGLSGSTGNSTGPHLHFEVRTGPSY 283

Query: 70  AIAMDPIKFL 79
              +DPI +L
Sbjct: 284 GSDVDPIAYL 293


>gi|223984246|ref|ZP_03634392.1| hypothetical protein HOLDEFILI_01686 [Holdemania filiformis DSM
           12042]
 gi|223963777|gb|EEF68143.1| hypothetical protein HOLDEFILI_01686 [Holdemania filiformis DSM
           12042]
          Length = 574

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 39/68 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I++ H D I + Y H+    V++G  V +G TIG+ G +G A  P VHF L +N  A
Sbjct: 507 GNYIILDHVDGIQSFYGHLGEIQVEEGDAVEQGQTIGIMGMTGRATGPHVHFYLIQNETA 566

Query: 73  MDPIKFLE 80
           +DP    +
Sbjct: 567 LDPSSLFQ 574


>gi|171322651|ref|ZP_02911415.1| peptidase M23B [Burkholderia ambifaria MEX-5]
 gi|171092006|gb|EDT37450.1| peptidase M23B [Burkholderia ambifaria MEX-5]
          Length = 230

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+   +T Y+H     V++GQ V++G TI   G S ++    
Sbjct: 151 VVYAGNGLRGYGNLIILKHNADYLTAYAHNRALLVKEGQSVTQGQTIAEMGNS-DSDRVA 209

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 210 LHFELRYGGRSIDPARYLPAR 230


>gi|269215024|ref|ZP_06158991.1| LysM domain/M23 peptidase domain protein [Neisseria lactamica ATCC
           23970]
 gi|269208515|gb|EEZ74970.1| LysM domain/M23 peptidase domain protein [Neisseria lactamica ATCC
           23970]
          Length = 338

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 260 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 318

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 319 LHFEVRQNGKPVNPNSYI 336


>gi|302554639|ref|ZP_07306981.1| peptidase [Streptomyces viridochromogenes DSM 40736]
 gi|302472257|gb|EFL35350.1| peptidase [Streptomyces viridochromogenes DSM 40736]
          Length = 261

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN I+I+ +D   T Y H+ +  V  GQKV+ G  IGLSG +GN   P +HFE R +   
Sbjct: 185 GNNIVIKMNDGTYTQYGHLSSIGVSVGQKVTPGQQIGLSGATGNVTGPHLHFEARTSPEY 244

Query: 70  AIAMDPIKFLEE 81
              MDP+ +L  
Sbjct: 245 GSDMDPVAYLRS 256


>gi|134295390|ref|YP_001119125.1| peptidase M23B [Burkholderia vietnamiensis G4]
 gi|134138547|gb|ABO54290.1| peptidase M23B [Burkholderia vietnamiensis G4]
          Length = 232

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+   +T Y+H     V++GQ V++G TI   G S ++    
Sbjct: 153 VVYAGNGLRGYGNLIILKHNADYLTAYAHNRALLVREGQSVTQGQTIAEMGSS-DSDRVA 211

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 212 LHFELRYGGRSIDPARYLPAR 232


>gi|307262433|ref|ZP_07544078.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 12 str.
           1096]
 gi|306867810|gb|EFM99641.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 12 str.
           1096]
          Length = 288

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G   + +
Sbjct: 209 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNSN-K 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 268 LHFEIRYKGKSVDPTRYLPRK 288


>gi|222148398|ref|YP_002549355.1| membrane protein associated metalloendopeptidase [Agrobacterium
           vitis S4]
 gi|221735386|gb|ACM36349.1| membrane protein associated metalloendopeptidase [Agrobacterium
           vitis S4]
          Length = 430

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H   + T Y H+    V+ G+K+  G  IGLSG +G +  P +H+E+RKN   
Sbjct: 353 GNMVEIDHGQGLSTRYGHMSKILVRPGEKIEVGQLIGLSGSTGRSTGPHLHYEIRKNGNP 412

Query: 73  MDPIKFL 79
           ++P+ FL
Sbjct: 413 INPMSFL 419


>gi|167855930|ref|ZP_02478678.1| Outer membrane antigenic lipoprotein B precursor [Haemophilus
           parasuis 29755]
 gi|167852924|gb|EDS24190.1| Outer membrane antigenic lipoprotein B precursor [Haemophilus
           parasuis 29755]
          Length = 391

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V++   V  G TI   G +G   + +
Sbjct: 312 VVYAGNALQGYGNLIIIKHNDDFLSAYAHNDSIKVEEQDNVKAGETIATLGSTGTNSN-K 370

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  +
Sbjct: 371 LHFEIRYQGKSVDPARYLPRQ 391


>gi|186681531|ref|YP_001864727.1| peptidase M23B [Nostoc punctiforme PCC 73102]
 gi|186463983|gb|ACC79784.1| peptidase M23B [Nostoc punctiforme PCC 73102]
          Length = 303

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G D   LGN I I+H D   TVY H     V K Q+V +G  I   G +GN+  P 
Sbjct: 88  VVKAGWDNWGLGNAITIKHLDGSTTVYGHNRRLLVSKNQQVIQGQIIAEMGSTGNSTAPH 147

Query: 62  VHFELRKNA-IAMDPIKFL 79
           +HFE+  N  IA+DP++ L
Sbjct: 148 LHFEVHPNGRIAVDPLRLL 166


>gi|322832705|ref|YP_004212732.1| Peptidase M23 [Rahnella sp. Y9602]
 gi|321167906|gb|ADW73605.1| Peptidase M23 [Rahnella sp. Y9602]
          Length = 444

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH    +T Y H+    V+ GQKV RG  I LSG +G +  P +HFE+  N +A
Sbjct: 349 GNYVAIRHGRQYMTRYMHLRKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHFEMWINQLA 408

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 409 VNP---LTAKLP 417


>gi|260913451|ref|ZP_05919929.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
 gi|260632391|gb|EEX50564.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
          Length = 475

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H ++  V+  Q+VS G  I   G SG     +
Sbjct: 396 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNESILVKDQQEVSAGQQIAKMGSSGTNSV-K 454

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L ++
Sbjct: 455 LHFEIRYKGKSVDPMRYLPKR 475


>gi|319760577|ref|YP_004124515.1| peptidase [Candidatus Blochmannia vafer str. BVAF]
 gi|318039291|gb|ADV33841.1| peptidase [Candidatus Blochmannia vafer str. BVAF]
          Length = 458

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 41/64 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+HD   +T Y H+    V+ GQ+VSRG +I LSG +G +  P +HFE+  N   
Sbjct: 363 GNYVVIKHDFQCITRYMHLKKILVKSGQRVSRGDSIALSGNTGRSTGPHLHFEVWINRQP 422

Query: 73  MDPI 76
           ++P+
Sbjct: 423 VNPL 426


>gi|307253623|ref|ZP_07535490.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306858859|gb|EFM90905.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
          Length = 412

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G   + +
Sbjct: 333 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNSN-K 391

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 392 LHFEIRYKGKSVDPTRYLPRK 412


>gi|307251204|ref|ZP_07533125.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306856720|gb|EFM88855.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 4 str. M62]
          Length = 412

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G   + +
Sbjct: 333 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNSN-K 391

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 392 LHFEIRYKGKSVDPTRYLPRK 412


>gi|167823854|ref|ZP_02455325.1| lipoprotein NlpD, putative [Burkholderia pseudomallei 9]
          Length = 164

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 85  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 143

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 144 LHFEVRRQGKPVDPLKYL 161


>gi|302872245|ref|YP_003840881.1| Peptidase M23 [Caldicellulosiruptor obsidiansis OB47]
 gi|302575104|gb|ADL42895.1| Peptidase M23 [Caldicellulosiruptor obsidiansis OB47]
          Length = 379

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G TI+I +   I T+Y+H+ +  V  GQKV +G +IG  G +G A  P +HFE+R N   
Sbjct: 312 GKTIIIDNGSGISTLYAHLSSINVAVGQKVKKGESIGNVGATGYATGPHLHFEVRINGDV 371

Query: 73  MDPIKFL 79
            DP+ FL
Sbjct: 372 TDPLNFL 378


>gi|261364767|ref|ZP_05977650.1| LysM domain/M23 peptidase domain protein [Neisseria mucosa ATCC
           25996]
 gi|288567075|gb|EFC88635.1| LysM domain/M23 peptidase domain protein [Neisseria mucosa ATCC
           25996]
          Length = 298

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S ++ Y H     V +GQ V RG TI   G + +A   Q
Sbjct: 220 VVYAGSGLRGYGNLVIIQHNSSFLSAYGHNQRLLVNEGQNVKRGQTIAQMGNT-DANRTQ 278

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 279 LHFEVRQNGKPVNPATYI 296


>gi|190151289|ref|YP_001969814.1| outer membrane antigenic lipoprotein B precursor [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307264642|ref|ZP_07546222.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
 gi|189916420|gb|ACE62672.1| Outer membrane antigenic lipoprotein B precursor [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306869954|gb|EFN01718.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
          Length = 412

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G   + +
Sbjct: 333 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNSN-K 391

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 392 LHFEIRYKGKSVDPTRYLPRK 412


>gi|307246869|ref|ZP_07528934.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|307255851|ref|ZP_07537652.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307260304|ref|ZP_07542011.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 11 str.
           56153]
 gi|306852154|gb|EFM84394.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|306861119|gb|EFM93112.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306865555|gb|EFM97436.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 11 str.
           56153]
          Length = 412

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G   + +
Sbjct: 333 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNSN-K 391

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 392 LHFEIRYKGKSVDPTRYLPRK 412


>gi|254674283|emb|CBA10067.1| putative peptidase [Neisseria meningitidis alpha275]
          Length = 265

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 187 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 245

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 246 LHFEVRQNGKPVNPNSYI 263


>gi|170723214|ref|YP_001750902.1| peptidase M23B [Pseudomonas putida W619]
 gi|169761217|gb|ACA74533.1| peptidase M23B [Pseudomonas putida W619]
          Length = 285

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 206 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 264

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 265 LHFEIRRQGKPVDPLQFLPRR 285


>gi|227824550|ref|ZP_03989382.1| peptidase M23B [Acidaminococcus sp. D21]
 gi|226905049|gb|EEH90967.1| peptidase M23B [Acidaminococcus sp. D21]
          Length = 377

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   GN ++I H   +VT+Y H  +  V  G+ VS+G TI L+G +GN+  P 
Sbjct: 300 VIYAGW-MGGYGNAVMIDHGGGLVTLYGHNSSLTVGVGENVSKGQTIALAGSTGNSTGPH 358

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R +     P+ +L
Sbjct: 359 CHFEVRIHGEVTSPLNYL 376


>gi|296314082|ref|ZP_06864023.1| LysM domain/M23 peptidase domain protein [Neisseria polysaccharea
           ATCC 43768]
 gi|296839338|gb|EFH23276.1| LysM domain/M23 peptidase domain protein [Neisseria polysaccharea
           ATCC 43768]
          Length = 338

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 260 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 318

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 319 LHFEVRQNGKPVNPNSYI 336


>gi|59801427|ref|YP_208139.1| hypothetical protein NGO1056 [Neisseria gonorrhoeae FA 1090]
 gi|268594562|ref|ZP_06128729.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268597110|ref|ZP_06131277.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268603385|ref|ZP_06137552.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268684081|ref|ZP_06150943.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268686336|ref|ZP_06153198.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|293399285|ref|ZP_06643450.1| lipoprotein NlpD [Neisseria gonorrhoeae F62]
 gi|59718322|gb|AAW89727.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|268547951|gb|EEZ43369.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02]
 gi|268550898|gb|EEZ45917.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268587516|gb|EEZ52192.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268624365|gb|EEZ56765.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679]
 gi|268626620|gb|EEZ59020.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291610699|gb|EFF39809.1| lipoprotein NlpD [Neisseria gonorrhoeae F62]
          Length = 403

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 325 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 383

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 384 LHFEVRQNGKPVNPNSYI 401


>gi|325142672|gb|EGC65058.1| lipoprotein nlpD precursor [Neisseria meningitidis 961-5945]
          Length = 310

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 232 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 290

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 291 LHFEVRQNGKPVNPNSYI 308


>gi|168028139|ref|XP_001766586.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162682231|gb|EDQ68651.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 618

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I+H+   VT Y H    + + GQ+V +G  I   G +G A  P +HFE+RKN  A
Sbjct: 550 GYLVTIQHEGGFVTRYGHCCAIHSRVGQQVVKGQQIAAVGATGRATGPHLHFEVRKNGEA 609

Query: 73  MDPIKFLE 80
           +DP+K+++
Sbjct: 610 LDPLKWVQ 617


>gi|257462251|ref|ZP_05626668.1| cell wall endopeptidase [Fusobacterium sp. D12]
 gi|317059920|ref|ZP_07924405.1| cell wall endopeptidase [Fusobacterium sp. D12]
 gi|313685596|gb|EFS22431.1| cell wall endopeptidase [Fusobacterium sp. D12]
          Length = 381

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+I+HD+   T Y+H+     + G+ V RG  IG +G +G    P
Sbjct: 304 VVSFAGN-MSGYGKIIIIKHDNGFETRYAHLSQISTRVGEHVERGELIGKTGNTGRTTGP 362

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R++   ++P+K+L
Sbjct: 363 HLHFEIRRSGKTLNPMKYL 381


>gi|254493503|ref|ZP_05106674.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
 gi|226512543|gb|EEH61888.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291]
          Length = 403

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 325 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 383

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 384 LHFEVRQNGKPVNPNSYI 401


>gi|225375826|ref|ZP_03753047.1| hypothetical protein ROSEINA2194_01458 [Roseburia inulinivorans DSM
           16841]
 gi|225212261|gb|EEG94615.1| hypothetical protein ROSEINA2194_01458 [Roseburia inulinivorans DSM
           16841]
          Length = 518

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H D  +T Y+H     V  GQ V +G +I LSG +G +  P VHFE+  N +A
Sbjct: 450 GNNVVISHPDGRMTRYAHNSKLLVSAGQWVEQGQSIALSGSTGRSTGPHVHFEIYINGVA 509

Query: 73  MDPIKFL 79
           ++P+ ++
Sbjct: 510 VNPLNYI 516


>gi|219871841|ref|YP_002476216.1| outer membrane antigenic lipoprotein B [Haemophilus parasuis
           SH0165]
 gi|219692045|gb|ACL33268.1| outer membrane antigenic lipoprotein B precursor [Haemophilus
           parasuis SH0165]
          Length = 391

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V++   V  G TI   G +G   + +
Sbjct: 312 VVYAGNALQGYGNLIIIKHNDDFLSAYAHNDSIKVEEQDNVKAGETIATLGSTGTNSN-K 370

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  +
Sbjct: 371 LHFEIRYQGKSVDPARYLPRQ 391


>gi|253988172|ref|YP_003039528.1| lipoprotein NlpD [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253779622|emb|CAQ82783.1| lipoprotein nlpd [Photorhabdus asymbiotica]
          Length = 345

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V + Q +  G  I   G +G +   +
Sbjct: 266 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVSEQQDIKAGQKIATMGSTGTSS-VR 324

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 325 LHFEIRYKGKSVNPLRYLPQR 345


>gi|326204859|ref|ZP_08194712.1| Peptidase M23 [Clostridium papyrosolvens DSM 2782]
 gi|325984908|gb|EGD45751.1| Peptidase M23 [Clostridium papyrosolvens DSM 2782]
          Length = 283

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 42/72 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H +   TVY H     V+ GQ V +G  I L G +G +  P +HFE+R    A
Sbjct: 210 GNHVIVDHGNGFKTVYGHSSKLLVKAGQIVKKGQKIALVGSTGRSTGPHLHFEIRIADTA 269

Query: 73  MDPIKFLEEKIP 84
           +DP+K++E K P
Sbjct: 270 VDPVKYVEFKPP 281


>gi|226315345|ref|YP_002775241.1| regulatory protein [Brevibacillus brevis NBRC 100599]
 gi|226098295|dbj|BAH46737.1| putative regulatory protein [Brevibacillus brevis NBRC 100599]
          Length = 477

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H     TVYSH++   V  G  V++G  IGL G +G +  P + F++ +N I 
Sbjct: 404 GNQVILEHAGGYQTVYSHLEKLEVTAGTTVTQGQLIGLLGSTGRSTGPHLAFQVLENGIP 463

Query: 73  MDPIKFLE 80
           +DP+K LE
Sbjct: 464 VDPMKLLE 471


>gi|167918656|ref|ZP_02505747.1| lipoprotein NlpD, putative [Burkholderia pseudomallei BCC215]
          Length = 177

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 98  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 156

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+K+L  +
Sbjct: 157 LHFEVRRQGKPVDPLKYLPPQ 177


>gi|32490866|ref|NP_871120.1| hypothetical protein WGLp117 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166072|dbj|BAC24263.1| yebA [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 441

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I+H    +T Y H+    V+ GQKV RG+ IG+SG +G +  P +HFE+  N  A
Sbjct: 346 GNYIVIKHGHQYITRYMHLKKSLVKAGQKVYRGNKIGISGNTGRSTGPHLHFEIWINRQA 405

Query: 73  MDPIKFLEEKIP 84
           ++P   L  KIP
Sbjct: 406 VNP---LTIKIP 414


>gi|325131208|gb|EGC53921.1| lysM domain protein [Neisseria meningitidis M6190]
          Length = 335

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 257 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 315

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 316 LHFEVRQNGKPVNPNSYI 333


>gi|307249007|ref|ZP_07531015.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
 gi|307258036|ref|ZP_07539788.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|306854465|gb|EFM86660.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
 gi|306863399|gb|EFM95330.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
          Length = 412

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G   + +
Sbjct: 333 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNSN-K 391

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 392 LHFEIRYKGKSVDPTRYLPRK 412


>gi|238027062|ref|YP_002911293.1| peptidoglycan-binding LysM [Burkholderia glumae BGR1]
 gi|237876256|gb|ACR28589.1| Peptidoglycan-binding LysM [Burkholderia glumae BGR1]
          Length = 302

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 223 VVYAGNGLRGYGNLIIVKHDATYLTAYAHNRALMVKEGDSVTKGQKIAEMGNS-DSDRVM 281

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K+L
Sbjct: 282 LHFEVRRQGKPVDPLKYL 299


>gi|134094483|ref|YP_001099558.1| lipoprotein precursor [Herminiimonas arsenicoxydans]
 gi|133738386|emb|CAL61431.1| putative Peptidase M23B [Herminiimonas arsenicoxydans]
          Length = 304

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ +   GN ++++H  ++++ Y+H    +V++GQ VS+G  I   G S +A   +
Sbjct: 225 VMYAGSGIRGYGNLVIVKHTSTLLSAYAHNKIIHVKEGQSVSKGQKIADMGDS-DADSVK 283

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP KFL  +
Sbjct: 284 LHFEIRQQGKPVDPSKFLPSR 304


>gi|53729042|ref|ZP_00134335.2| COG0739: Membrane proteins related to metalloendopeptidases
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126209390|ref|YP_001054615.1| Outer membrane antigenic lipoprotein B precursor [Actinobacillus
           pleuropneumoniae L20]
 gi|126098182|gb|ABN75010.1| Outer membrane antigenic lipoprotein B precursor [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
          Length = 412

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G   + +
Sbjct: 333 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNSN-K 391

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 392 LHFEIRYKGKSVDPTRYLPRK 412


>gi|238927951|ref|ZP_04659711.1| peptidase M23B [Selenomonas flueggei ATCC 43531]
 gi|238884186|gb|EEQ47824.1| peptidase M23B [Selenomonas flueggei ATCC 43531]
          Length = 371

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H   I T+Y H  +  V  G+ VS+G  I   G +GN+  P  HFE+R+N   
Sbjct: 305 GNAVIINHGGGISTLYGHCQSLNVSVGESVSQGDVIAYCGSTGNSTGPHCHFEVRENGEP 364

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 365 VNPLSYL 371


>gi|116668482|gb|ABK15513.1| lipoprotein [Pseudomonas alkylphenolia]
          Length = 293

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 214 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKVGQTIAEMGSTG-TDRVK 272

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 273 LHFEIRRQGKPVDPLQFLPRR 293


>gi|288939903|ref|YP_003442143.1| peptidase M23 [Allochromatium vinosum DSM 180]
 gi|288895275|gb|ADC61111.1| Peptidase M23 [Allochromatium vinosum DSM 180]
          Length = 300

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 41/70 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH D +VT Y+H     V++G  + +G  I   G +G A  P VHFE+ +N  A
Sbjct: 219 GNLVDIRHRDGLVTRYAHNTANLVREGDLIRQGQQIATVGSTGTATGPHVHFEVIRNGRA 278

Query: 73  MDPIKFLEEK 82
           +DP+ +L  +
Sbjct: 279 VDPMPYLRSQ 288


>gi|240144347|ref|ZP_04742948.1| membrane protein metalloendopeptidase [Roseburia intestinalis
           L1-82]
 gi|257203595|gb|EEV01880.1| membrane protein  metalloendopeptidase [Roseburia intestinalis
           L1-82]
 gi|291535577|emb|CBL08689.1| Membrane proteins related to metalloendopeptidases [Roseburia
           intestinalis M50/1]
          Length = 520

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H D  +T Y+H     V+ GQKV +G  I LSG +G +  P VHFE+     A
Sbjct: 452 GNNVVISHADGRLTRYAHNSKLLVKVGQKVEQGEPIALSGSTGRSTGPHVHFEIYIGGAA 511

Query: 73  MDPIKFL 79
           ++P+K++
Sbjct: 512 VNPLKYI 518


>gi|187933752|ref|YP_001887703.1| peptidase, M23/M37 family [Clostridium botulinum B str. Eklund 17B]
 gi|187721905|gb|ACD23126.1| peptidase, M23/M37 family [Clostridium botulinum B str. Eklund 17B]
          Length = 395

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 40/63 (63%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I I+H+D + T+Y H+ +  V+KGQ++ +G  IG  G +G +  P +HFELR     
Sbjct: 326 GNMIKIKHEDGLETLYGHLSSINVKKGQEIKKGDVIGEVGSTGRSTGPHLHFELRSKGTP 385

Query: 73  MDP 75
           ++P
Sbjct: 386 INP 388


>gi|115372811|ref|ZP_01460117.1| peptidase M23B [Stigmatella aurantiaca DW4/3-1]
 gi|115370292|gb|EAU69221.1| peptidase M23B [Stigmatella aurantiaca DW4/3-1]
          Length = 281

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 40/66 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H   + T Y H     V+ GQ+V+RG TI  SG +G +  P +H++L  +A A
Sbjct: 203 GKVLIIDHGRGVTTAYCHNSELLVRSGQRVARGETIARSGNTGRSTGPHLHYQLELSAQA 262

Query: 73  MDPIKF 78
           +DP++F
Sbjct: 263 VDPLRF 268


>gi|209522221|ref|ZP_03270858.1| Peptidase M23 [Burkholderia sp. H160]
 gi|209497350|gb|EDZ97568.1| Peptidase M23 [Burkholderia sp. H160]
          Length = 244

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 165 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 223

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+K+L  +
Sbjct: 224 LHFEVRRQGKPVDPLKYLPPQ 244


>gi|7416822|dbj|BAA94071.1| nlpD [Rubrivivax gelatinosus]
          Length = 314

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+++H+ + ++ Y+H  T  V++ Q V RG  I   G S +A   Q
Sbjct: 235 VVYAGSGLRGYGNLIIVKHNATFLSAYAHNQTLLVKEDQAVRRGQKIAEMGAS-DADRVQ 293

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP K L  +
Sbjct: 294 LHFEIRRQGKPVDPAKLLPSR 314


>gi|309378351|emb|CBX23048.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 346

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 268 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 326

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 327 LHFEVRQNGKPVNPNSYI 344


>gi|237800175|ref|ZP_04588636.1| lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331023032|gb|EGI03089.1| lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 288

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|26988354|ref|NP_743779.1| peptidase M23B [Pseudomonas putida KT2440]
 gi|24983105|gb|AAN67243.1|AE016351_5 lipoprotein NlpD [Pseudomonas putida KT2440]
          Length = 262

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 183 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 241

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 242 LHFEIRRQGKPVDPLQFLPRR 262


>gi|317062139|ref|ZP_07926624.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
 gi|313687815|gb|EFS24650.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
          Length = 360

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 42/70 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+++H +   T Y+H+D   V+ GQ V++G  IG +G SG    P +HFE+RKN   
Sbjct: 291 GKIIILKHSNGYETRYAHLDKIGVKVGQNVNKGELIGKTGMSGRVTGPHLHFEVRKNGKT 350

Query: 73  MDPIKFLEEK 82
            +P+ +L  K
Sbjct: 351 ENPMSYLTRK 360


>gi|261392263|emb|CAX49783.1| putative metallopeptidase [Neisseria meningitidis 8013]
          Length = 415

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|148549361|ref|YP_001269463.1| peptidase M23B [Pseudomonas putida F1]
 gi|148513419|gb|ABQ80279.1| peptidase M23B [Pseudomonas putida F1]
          Length = 262

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 183 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 241

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 242 LHFEIRRQGKPVDPLQFLPRR 262


>gi|91792561|ref|YP_562212.1| peptidase M23B [Shewanella denitrificans OS217]
 gi|91714563|gb|ABE54489.1| peptidase M23B [Shewanella denitrificans OS217]
          Length = 311

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+D  ++ Y+H +T  V++ Q V+ G  +   G SG A    
Sbjct: 232 VVYAGDALRGYGNLVIIKHNDDFLSAYAHAETILVKEKQLVAAGQAVAKMGNSG-ANQVM 290

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+K+L ++
Sbjct: 291 LHFEIRYHGKSVNPLKYLPKQ 311


>gi|312623409|ref|YP_004025022.1| peptidase M23 [Caldicellulosiruptor kronotskyensis 2002]
 gi|312203876|gb|ADQ47203.1| Peptidase M23 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 600

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+I H +   T Y H+    V  GQKV++G  I  SG +G +  P +HFE+RKN + 
Sbjct: 533 GKLIIINHQNGYKTYYGHLSRFLVSPGQKVAKGQLIAKSGSTGRSTGPHLHFEVRKNGVP 592

Query: 73  MDPIKFL 79
            +P+ +L
Sbjct: 593 QNPLAYL 599


>gi|165977377|ref|YP_001652970.1| outer membrane antigenic lipoprotein B [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|165877478|gb|ABY70526.1| outer membrane antigenic lipoprotein B [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
          Length = 398

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G   + +
Sbjct: 319 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNSN-K 377

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 378 LHFEIRYKGKSVDPTRYLPRK 398


>gi|325924515|ref|ZP_08186034.1| metalloendopeptidase-like membrane protein [Xanthomonas gardneri
           ATCC 19865]
 gi|325545010|gb|EGD16345.1| metalloendopeptidase-like membrane protein [Xanthomonas gardneri
           ATCC 19865]
          Length = 257

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A+  
Sbjct: 177 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSGAARD- 235

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 236 MLHFEIRYNGKPVDPLLYLPKK 257


>gi|297539065|ref|YP_003674834.1| peptidase M23 [Methylotenera sp. 301]
 gi|297258412|gb|ADI30257.1| Peptidase M23 [Methylotenera sp. 301]
          Length = 352

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 51/78 (65%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G+DL   G  ++I+H+ + ++VY+H     V++GQ+VSRG  I   G + ++   +
Sbjct: 273 VIYSGSDLRGYGKLVIIKHNANYLSVYAHNSLILVKEGQQVSRGQKIAEMGNT-DSNSVK 331

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+   ++DP K+L
Sbjct: 332 LHFEIRRQGKSVDPSKYL 349


>gi|89894351|ref|YP_517838.1| hypothetical protein DSY1605 [Desulfitobacterium hafniense Y51]
 gi|89333799|dbj|BAE83394.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 440

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ILI H + + T Y+H     V  GQ++S+G +IGL G +G +  P +HFE+  N   
Sbjct: 373 GNMILIDHGNGVATRYAHASKVSVSNGQQISKGESIGLVGSTGRSTGPHLHFEVIINGDT 432

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 433 VNPLNYL 439


>gi|77463532|ref|YP_353036.1| putative metalopeptidase [Rhodobacter sphaeroides 2.4.1]
 gi|126462388|ref|YP_001043502.1| peptidase M23B [Rhodobacter sphaeroides ATCC 17029]
 gi|77387950|gb|ABA79135.1| Putative metalopeptidase [Rhodobacter sphaeroides 2.4.1]
 gi|126104052|gb|ABN76730.1| peptidase M23B [Rhodobacter sphaeroides ATCC 17029]
          Length = 447

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 42/68 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I IRH+  I TVY H+    V+KGQ+VSRG  IG  G +G +    +H+E+R +   
Sbjct: 374 GKVIKIRHEFGIQTVYGHLSRIRVEKGQRVSRGDRIGDMGSTGRSTGTHLHYEVRVDGSP 433

Query: 73  MDPIKFLE 80
           ++P+ F++
Sbjct: 434 VNPMTFIK 441


>gi|75812867|ref|YP_320484.1| peptidase M23B [Anabaena variabilis ATCC 29413]
 gi|75705623|gb|ABA25295.1| Peptidase M23B [Anabaena variabilis ATCC 29413]
          Length = 216

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I+H  S+ T+Y H    YVQ+GQ V RG  I   G +G +  P +HFE+  N +A
Sbjct: 143 GKAVIIQHQGSLSTLYGHASQLYVQQGQLVVRGQMIAAVGSTGFSTGPHLHFEVHVNGVA 202

Query: 73  MDPIKFLEEKI 83
            +P  +L E +
Sbjct: 203 QNPRPYLHEYL 213


>gi|219668778|ref|YP_002459213.1| peptidase M23 [Desulfitobacterium hafniense DCB-2]
 gi|219539038|gb|ACL20777.1| Peptidase M23 [Desulfitobacterium hafniense DCB-2]
          Length = 482

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ILI H + + T Y+H     V  GQ++S+G +IGL G +G +  P +HFE+  N   
Sbjct: 415 GNMILIDHGNGVATRYAHASKVSVSNGQQISKGESIGLVGSTGRSTGPHLHFEVIINGDT 474

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 475 VNPLNYL 481


>gi|319942887|ref|ZP_08017170.1| peptidase M23B [Lautropia mirabilis ATCC 51599]
 gi|319743429|gb|EFV95833.1| peptidase M23B [Lautropia mirabilis ATCC 51599]
          Length = 466

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 2/74 (2%)

Query: 13  GNTILIRHDDSIVTVYSHID--TPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           GN I+++HDD   T+Y+H+   +P ++ G K+ +G  IG  G++G A  P +HFE + N 
Sbjct: 360 GNVIIVKHDDVQRTLYAHMSRFSPKLRLGDKIKQGQVIGEVGQTGWATGPHLHFEFQVNG 419

Query: 71  IAMDPIKFLEEKIP 84
             +DP   L +  P
Sbjct: 420 QQIDPNTMLPQPAP 433


>gi|119511326|ref|ZP_01630440.1| Peptidase M23B [Nodularia spumigena CCY9414]
 gi|119464032|gb|EAW44955.1| Peptidase  M23B [Nodularia spumigena CCY9414]
          Length = 394

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T++I H     T+Y+H    YV +GQ V RG  I   G +G +  P +HFE+R+N   
Sbjct: 328 GRTVIIDHGQDKTTLYAHASELYVSEGQSVERGQAIASVGSTGLSTGPHLHFEVRRNGTP 387

Query: 73  MDPIKFL 79
           ++P  +L
Sbjct: 388 VNPADYL 394


>gi|153835749|ref|ZP_01988416.1| lipoprotein NlpD [Vibrio harveyi HY01]
 gi|148867580|gb|EDL66894.1| lipoprotein NlpD [Vibrio harveyi HY01]
          Length = 307

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG ++  +
Sbjct: 230 VVYSGNALRGYGNLIIVKHNDNYLSAYAHNDRLLVSEGQSVKSGQKIATMGSSG-SKSVK 288

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 289 LHFEIRYQGKSVNPKRYL 306


>gi|297618030|ref|YP_003703189.1| peptidase M23 [Syntrophothermus lipocalidus DSM 12680]
 gi|297145867|gb|ADI02624.1| Peptidase M23 [Syntrophothermus lipocalidus DSM 12680]
          Length = 377

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   GNTI++ H   + T+Y+H+       G +V +G TIGL G +G +    
Sbjct: 301 VIYTGR-MGGYGNTIVVDHGGGVSTLYAHLSAYRTSTGARVDKGDTIGLVGSTGWSTGAH 359

Query: 62  VHFELRKNAIAMDP 75
           +HFE+RKN   +DP
Sbjct: 360 LHFEVRKNGTPVDP 373


>gi|170692686|ref|ZP_02883848.1| peptidase M23B [Burkholderia graminis C4D1M]
 gi|170142342|gb|EDT10508.1| peptidase M23B [Burkholderia graminis C4D1M]
          Length = 266

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ +   G  I+I+HDDS++T Y    T  V++G  V++G TIG  G  G      
Sbjct: 185 VVYAGSGIEAYGPLIIIKHDDSLITAYGQNSTLLVKEGDAVAQGQTIGEVGVDGRGVG-S 243

Query: 62  VHFELRKNAIAMDPIKFL 79
           V FE+R+N   +DP+ +L
Sbjct: 244 VQFEVRQNGQPVDPLAWL 261


>gi|221639395|ref|YP_002525657.1| peptidase M23B [Rhodobacter sphaeroides KD131]
 gi|221160176|gb|ACM01156.1| Peptidase M23B [Rhodobacter sphaeroides KD131]
          Length = 447

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 42/68 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I IRH+  I TVY H+    V+KGQ+VSRG  IG  G +G +    +H+E+R +   
Sbjct: 374 GKVIKIRHEFGIQTVYGHLSRIRVEKGQRVSRGDRIGDMGSTGRSTGTHLHYEVRVDGSP 433

Query: 73  MDPIKFLE 80
           ++P+ F++
Sbjct: 434 VNPMTFIK 441


>gi|84624462|ref|YP_451834.1| lipoprotein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|84368402|dbj|BAE69560.1| lipoprotein [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 257

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 177 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 235

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 236 MLHFEIRYNGKPVDPLLYLPKK 257


>gi|257467850|ref|ZP_05631946.1| cell wall endopeptidase [Fusobacterium ulcerans ATCC 49185]
          Length = 351

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 42/70 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+++H +   T Y+H+D   V+ GQ V++G  IG +G SG    P +HFE+RKN   
Sbjct: 282 GKIIILKHSNGYETRYAHLDKIGVKVGQNVNKGELIGKTGMSGRVTGPHLHFEVRKNGKT 341

Query: 73  MDPIKFLEEK 82
            +P+ +L  K
Sbjct: 342 ENPMSYLTRK 351


>gi|188575908|ref|YP_001912837.1| lipoprotein [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188520360|gb|ACD58305.1| lipoprotein [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 263

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 183 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 241

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 242 MLHFEIRYNGKPVDPLLYLPKK 263


>gi|116669360|ref|YP_830293.1| peptidase M23B [Arthrobacter sp. FB24]
 gi|116609469|gb|ABK02193.1| peptidase M23B [Arthrobacter sp. FB24]
          Length = 253

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 42/67 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H + + T Y+H+ +  VQ GQKV+RG  + LSG +G +    +HFE+  N   
Sbjct: 187 GNRVVIDHGNGLETTYNHLSSSSVQVGQKVNRGDVVALSGTTGASTGCHLHFEVMVNGEV 246

Query: 73  MDPIKFL 79
           +DP+ +L
Sbjct: 247 VDPLGWL 253


>gi|58582576|ref|YP_201592.1| lipoprotein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|58427170|gb|AAW76207.1| lipoprotein [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 266

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 186 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 244

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 245 MLHFEIRYNGKPVDPLLYLPKK 266


>gi|108759235|ref|YP_632620.1| cell wall endopeptidase [Myxococcus xanthus DK 1622]
 gi|108463115|gb|ABF88300.1| cell wall peptidase, M23 family [Myxococcus xanthus DK 1622]
          Length = 311

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G      GN +++ H + ++T+Y+H     V+ GQKV R   I   G+SG    P 
Sbjct: 229 VLYAGEQR-GYGNIVIVEHTNKLITLYAHNRDLRVRTGQKVRREQVIATVGESGRTSGPH 287

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R +   +DP+ FL
Sbjct: 288 LHFEVRLDGKPVDPLDFL 305


>gi|21231162|ref|NP_637079.1| lipoprotein [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66768830|ref|YP_243592.1| lipoprotein [Xanthomonas campestris pv. campestris str. 8004]
 gi|21112801|gb|AAM41003.1| lipoprotein [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66574162|gb|AAY49572.1| lipoprotein [Xanthomonas campestris pv. campestris str. 8004]
          Length = 266

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A+  
Sbjct: 186 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSGAARD- 244

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 245 MLHFEIRYNGKPVDPLLYLPKK 266


>gi|17229354|ref|NP_485902.1| hypothetical protein all1862 [Nostoc sp. PCC 7120]
 gi|17130952|dbj|BAB73561.1| all1862 [Nostoc sp. PCC 7120]
          Length = 333

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 33/79 (41%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ VG D   LGN I I+H +  VTVY H     V KGQ+V +G  I   G +GN+  P 
Sbjct: 99  VVKVGWDEWGLGNAIEIKHPNGSVTVYGHNRRLLVSKGQQVKQGQIIAEMGSTGNSTAPH 158

Query: 62  VHFELRKNA-IAMDPIKFL 79
           +HFE   N  +A++P+  L
Sbjct: 159 LHFEYYPNGKVAVNPMTVL 177


>gi|125974261|ref|YP_001038171.1| peptidase M23B [Clostridium thermocellum ATCC 27405]
 gi|256003522|ref|ZP_05428512.1| Peptidase M23 [Clostridium thermocellum DSM 2360]
 gi|281418314|ref|ZP_06249334.1| Peptidase M23 [Clostridium thermocellum JW20]
 gi|125714486|gb|ABN52978.1| peptidase M23B [Clostridium thermocellum ATCC 27405]
 gi|255992546|gb|EEU02638.1| Peptidase M23 [Clostridium thermocellum DSM 2360]
 gi|281409716|gb|EFB39974.1| Peptidase M23 [Clostridium thermocellum JW20]
 gi|316941410|gb|ADU75444.1| Peptidase M23 [Clostridium thermocellum DSM 1313]
          Length = 309

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 42/70 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H   + T+Y H  T  V++GQ V +G  I   G +G +  P +HFE+R N + 
Sbjct: 240 GKCVIIDHGYGLSTLYGHCQTLLVKEGQTVKKGDKIATVGSTGRSTGPHLHFEVRLNGVP 299

Query: 73  MDPIKFLEEK 82
           +DP+++L+ K
Sbjct: 300 VDPLQYLDNK 309


>gi|330817176|ref|YP_004360881.1| Peptidoglycan-binding LysM [Burkholderia gladioli BSR3]
 gi|327369569|gb|AEA60925.1| Peptidoglycan-binding LysM [Burkholderia gladioli BSR3]
          Length = 310

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 231 VVYAGNGLRGYGNLIIVKHDATYLTAYAHNRALMVKEGDSVTKGQKIAEMGNS-DSDRVM 289

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+K+L  +
Sbjct: 290 LHFEVRRQGKPVDPLKYLPPQ 310


>gi|325916045|ref|ZP_08178335.1| metalloendopeptidase-like membrane protein [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325537721|gb|EGD09427.1| metalloendopeptidase-like membrane protein [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 258

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A+  
Sbjct: 178 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSGAARD- 236

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 237 MLHFEIRYNGKPVDPLLYLPKK 258


>gi|302542021|ref|ZP_07294363.1| putative peptidase [Streptomyces hygroscopicus ATCC 53653]
 gi|302459639|gb|EFL22732.1| putative peptidase [Streptomyces himastatinicus ATCC 53653]
          Length = 264

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA-- 70
           GN ++I+ +D   T Y H+ +  V  G+KV+ G  IGLSG +GN   P +HFE R  A  
Sbjct: 188 GNNVVIKMNDGTYTQYGHLSSIGVSVGEKVTPGQQIGLSGATGNVTGPHLHFEARTTAEY 247

Query: 71  -IAMDPIKFLEE 81
              MDP+ +L  
Sbjct: 248 GSDMDPLSYLRS 259


>gi|85375471|ref|YP_459533.1| peptidase M23/M37 [Erythrobacter litoralis HTCC2594]
 gi|84788554|gb|ABC64736.1| Peptidase M23/M37 [Erythrobacter litoralis HTCC2594]
          Length = 377

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T+ I H + ++T Y+H+     ++GQKV  G  IG  G +G +  P +HFE+R N  A
Sbjct: 290 GKTVEIDHGNGLMTRYAHMSRFVAKRGQKVDAGSPIGAIGSTGRSTGPHLHFEVRINERA 349

Query: 73  MDPIKFLE 80
           ++P  FLE
Sbjct: 350 VNPRPFLE 357


>gi|332558412|ref|ZP_08412734.1| peptidase M23B [Rhodobacter sphaeroides WS8N]
 gi|332276124|gb|EGJ21439.1| peptidase M23B [Rhodobacter sphaeroides WS8N]
          Length = 447

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 42/68 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I IRH+  I TVY H+    V+KGQ+VSRG  IG  G +G +    +H+E+R +   
Sbjct: 374 GKVIKIRHEFGIQTVYGHLSRIRVEKGQRVSRGDRIGDMGSTGRSTGTHLHYEVRVDGSP 433

Query: 73  MDPIKFLE 80
           ++P+ F++
Sbjct: 434 VNPMTFIK 441


>gi|312793086|ref|YP_004026009.1| peptidase M23 [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312180226|gb|ADQ40396.1| Peptidase M23 [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 379

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T++I +   I T+Y+H+ +  V  GQKV +G +IG  G +G A  P +HFE+R N   
Sbjct: 312 GKTVIIDNGSGISTLYAHLSSINVSVGQKVKKGESIGNVGATGYATGPHLHFEVRINGDV 371

Query: 73  MDPIKFL 79
            DP+ FL
Sbjct: 372 TDPLNFL 378


>gi|156975774|ref|YP_001446681.1| hypothetical protein VIBHAR_03518 [Vibrio harveyi ATCC BAA-1116]
 gi|156527368|gb|ABU72454.1| hypothetical protein VIBHAR_03518 [Vibrio harveyi ATCC BAA-1116]
          Length = 307

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG ++  +
Sbjct: 230 VVYSGNALRGYGNLIIVKHNDNYLSAYAHNDRLLVSEGQSVKSGQKIATMGSSG-SKSVK 288

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 289 LHFEIRYQGKSVNPKRYL 306


>gi|325128559|gb|EGC51432.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           N1568]
          Length = 415

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|312131865|ref|YP_003999205.1| peptidase m23 [Leadbetterella byssophila DSM 17132]
 gi|311908411|gb|ADQ18852.1| Peptidase M23 [Leadbetterella byssophila DSM 17132]
          Length = 198

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G+D   LGN + I+H     ++Y H+     +KGQ+V +G  IGL G +G    P
Sbjct: 116 LVTETGHD-ENLGNFVRIKHKYGFESLYGHLSKITAKKGQRVEKGTKIGLVGSTGKVTGP 174

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+ L+KN   +DP  FL
Sbjct: 175 HLHYTLKKNGQYLDPFDFL 193


>gi|312134198|ref|YP_004001536.1| peptidase M23 [Caldicellulosiruptor owensensis OL]
 gi|311774249|gb|ADQ03736.1| Peptidase M23 [Caldicellulosiruptor owensensis OL]
          Length = 583

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 40/69 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+I H +   T Y H+    V  GQKV++G  I  SG +G +  P +HFE+RKN + 
Sbjct: 515 GKLIIINHQNGYKTYYGHLSRFLVSPGQKVAKGQLIAKSGSTGRSTGPHLHFEVRKNGVP 574

Query: 73  MDPIKFLEE 81
            +P+ +L +
Sbjct: 575 QNPLVYLRQ 583


>gi|289675303|ref|ZP_06496193.1| peptidoglycan-binding LysM:peptidase M23B [Pseudomonas syringae pv.
           syringae FF5]
 gi|330975367|gb|EGH75433.1| peptidoglycan-binding LysM:peptidase M23B [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 288

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|221636052|ref|YP_002523928.1| lytic transglycosylase, catalytic [Thermomicrobium roseum DSM 5159]
 gi|221157769|gb|ACM06887.1| lytic transglycosylase, catalytic [Thermomicrobium roseum DSM 5159]
          Length = 327

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VGN     G  I + H + + T+Y H+    V+ GQ+V RG  IG SG +G +  P 
Sbjct: 106 VRFVGNT-DGYGLRIEVDHGNGVTTLYGHLSAADVRPGQRVQRGQVIGKSGNTGLSTGPH 164

Query: 62  VHFELRKNAIAMDP 75
           +H+E+R+N  A+DP
Sbjct: 165 LHYEIRQNGRAVDP 178


>gi|71734830|ref|YP_275948.1| lipoprotein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257487050|ref|ZP_05641091.1| lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289626004|ref|ZP_06458958.1| lipoprotein [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289651480|ref|ZP_06482823.1| lipoprotein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298488361|ref|ZP_07006393.1| Lipoprotein nlpD precursor [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|71555383|gb|AAZ34594.1| lipoprotein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298157183|gb|EFH98271.1| Lipoprotein nlpD precursor [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320323090|gb|EFW79179.1| lipoprotein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320329638|gb|EFW85627.1| lipoprotein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330868572|gb|EGH03281.1| lipoprotein [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330894624|gb|EGH27285.1| lipoprotein [Pseudomonas syringae pv. mori str. 301020]
 gi|331009311|gb|EGH89367.1| lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 288

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|109900162|ref|YP_663417.1| peptidase M23B [Pseudoalteromonas atlantica T6c]
 gi|109702443|gb|ABG42363.1| peptidase M23B [Pseudoalteromonas atlantica T6c]
          Length = 272

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++++H DS ++ Y+H D+  V++ Q V  G  I   GKSG +   +
Sbjct: 193 VVYTGDALRGYGKLVIVKHSDSFLSAYAHNDSILVKEQQWVRAGQKIATMGKSG-SDTVK 251

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L ++
Sbjct: 252 LHFEVRYKGQSIDPLRYLPKR 272


>gi|330985140|gb|EGH83243.1| lipoprotein [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 288

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|332284224|ref|YP_004416135.1| putative peptidase [Pusillimonas sp. T7-7]
 gi|330428177|gb|AEC19511.1| putative peptidase [Pusillimonas sp. T7-7]
          Length = 263

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +  LGN IL+ H +  +T Y+H  +  V+ GQ++ +G  I   G++ +   P+
Sbjct: 184 VMYAGNGVRGLGNLILLGHGNGFITAYAHNQSLLVKTGQEIKKGAKIAAIGQT-DTTSPR 242

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    ++P+ +L  +
Sbjct: 243 LHFEIRRKGTPVNPLSYLPAR 263


>gi|325205762|gb|ADZ01215.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           M04-240196]
          Length = 415

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|325204466|gb|ADY99919.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           M01-240355]
          Length = 415

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|188991945|ref|YP_001903955.1| Outer membrane lipoprotein [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167733705|emb|CAP51910.1| Outer membrane lipoprotein [Xanthomonas campestris pv. campestris]
          Length = 255

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A+  
Sbjct: 175 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQNVKAGQQIAEMGRSGAARD- 233

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 234 MLHFEIRYNGKPVDPLLYLPKK 255


>gi|161870350|ref|YP_001599520.1| lipoprotein NlpD, putative [Neisseria meningitidis 053442]
 gi|161595903|gb|ABX73563.1| lipoprotein NlpD, putative [Neisseria meningitidis 053442]
 gi|308389118|gb|ADO31438.1| putative lipoprotein NlpD [Neisseria meningitidis alpha710]
 gi|325130557|gb|EGC53309.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           OX99.30304]
 gi|325136624|gb|EGC59225.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           M0579]
          Length = 415

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|15677336|ref|NP_274491.1| putative lipoprotein NlpD [Neisseria meningitidis MC58]
 gi|7226723|gb|AAF41839.1| putative lipoprotein NlpD [Neisseria meningitidis MC58]
 gi|325140580|gb|EGC63100.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           CU385]
 gi|325199909|gb|ADY95364.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           H44/76]
          Length = 415

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|330950647|gb|EGH50907.1| peptidoglycan-binding LysM:peptidase M23B [Pseudomonas syringae Cit
           7]
          Length = 288

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|330936785|gb|EGH40945.1| peptidoglycan-binding LysM:peptidase M23B [Pseudomonas syringae pv.
           pisi str. 1704B]
          Length = 288

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|325201826|gb|ADY97280.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           M01-240149]
 gi|325208422|gb|ADZ03874.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           NZ-05/33]
          Length = 415

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|325144776|gb|EGC67068.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           M01-240013]
          Length = 415

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|319941519|ref|ZP_08015846.1| peptidase M23B [Sutterella wadsworthensis 3_1_45B]
 gi|319804993|gb|EFW01832.1| peptidase M23B [Sutterella wadsworthensis 3_1_45B]
          Length = 277

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+VG+ +   G  +++RH  ++VT Y H     VQ G KV  G  I  SG +  A+ P 
Sbjct: 196 VIFVGSGVKGYGQLVIVRHTPTLVTAYGHNSKIVVQTGDKVKAGQKIAESGNT-EAERPM 254

Query: 62  VHFELRKNAIAMDPIKFL 79
           + FE+R     +DP+KFL
Sbjct: 255 LRFEVRDRGQPVDPMKFL 272


>gi|254805258|ref|YP_003083479.1| putative membrane peptidase [Neisseria meningitidis alpha14]
 gi|254668800|emb|CBA06762.1| putative membrane peptidase [Neisseria meningitidis alpha14]
 gi|325198613|gb|ADY94069.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           G2136]
          Length = 415

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|239998713|ref|ZP_04718637.1| hypothetical protein Ngon3_04430 [Neisseria gonorrhoeae 35/02]
 gi|240080999|ref|ZP_04725542.1| hypothetical protein NgonF_06767 [Neisseria gonorrhoeae FA19]
 gi|240117685|ref|ZP_04731747.1| hypothetical protein NgonPID_04356 [Neisseria gonorrhoeae PID1]
 gi|240125491|ref|ZP_04738377.1| hypothetical protein NgonSK_04622 [Neisseria gonorrhoeae SK-92-679]
 gi|240127943|ref|ZP_04740604.1| hypothetical protein NgonS_04771 [Neisseria gonorrhoeae SK-93-1035]
 gi|317164005|gb|ADV07546.1| hypothetical protein NGTW08_0574 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 376

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 298 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 356

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 357 LHFEVRQNGKPVNPNSYI 374


>gi|239927452|ref|ZP_04684405.1| secreted peptidase [Streptomyces ghanaensis ATCC 14672]
 gi|291435794|ref|ZP_06575184.1| secreted peptidase [Streptomyces ghanaensis ATCC 14672]
 gi|291338689|gb|EFE65645.1| secreted peptidase [Streptomyces ghanaensis ATCC 14672]
          Length = 316

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 43/73 (58%), Gaps = 3/73 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN ++I+ +D     Y+H+ +  V  GQ VS G  +GLSG +GN+  P +HFE+R +   
Sbjct: 240 GNQVVIKLNDGYYAQYAHLSSLSVSAGQAVSAGQQVGLSGSTGNSTGPHLHFEIRTSPNY 299

Query: 70  AIAMDPIKFLEEK 82
              +DP+ +L  K
Sbjct: 300 GSDVDPVSYLRSK 312


>gi|66044621|ref|YP_234462.1| peptidoglycan-binding LysM:peptidase M23B [Pseudomonas syringae pv.
           syringae B728a]
 gi|63255328|gb|AAY36424.1| Peptidoglycan-binding LysM:Peptidase M23B [Pseudomonas syringae pv.
           syringae B728a]
 gi|330968928|gb|EGH68994.1| peptidoglycan-binding LysM:peptidase M23B [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 288

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|312959423|ref|ZP_07773940.1| lipoprotein NlpD [Pseudomonas fluorescens WH6]
 gi|311286140|gb|EFQ64704.1| lipoprotein NlpD [Pseudomonas fluorescens WH6]
          Length = 278

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 199 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKVGQTIAEMGSTG-TDRVK 257

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 258 LHFEIRRQGKPVDPLQFLPRR 278


>gi|302187928|ref|ZP_07264601.1| peptidoglycan-binding LysM:peptidase M23B [Pseudomonas syringae pv.
           syringae 642]
          Length = 288

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|325134601|gb|EGC57244.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           M13399]
          Length = 415

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|291513843|emb|CBK63053.1| Membrane proteins related to metalloendopeptidases [Alistipes
           shahii WAL 8301]
          Length = 316

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T++I H +   T YSH+    V+KGQ V RG  I LSG +G +  P +H+E+R + + 
Sbjct: 226 GQTVVIDHGNGYETSYSHLSKINVRKGQTVRRGDIIALSGDTGLSLAPHLHYEVRLDGMR 285

Query: 73  MDPIKFL 79
           +DPI + 
Sbjct: 286 VDPIHYF 292


>gi|21242477|ref|NP_642059.1| lipoprotein [Xanthomonas axonopodis pv. citri str. 306]
 gi|21107924|gb|AAM36595.1| lipoprotein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 259

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 179 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 237

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 238 MLHFEIRYNGKPVDPLLYLPKK 259


>gi|121635163|ref|YP_975408.1| putative membrane peptidase [Neisseria meningitidis FAM18]
 gi|120866869|emb|CAM10628.1| putative membrane peptidase [Neisseria meningitidis FAM18]
          Length = 415

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|332290486|ref|YP_004421338.1| Peptidase family M23 [Gallibacterium anatis UMN179]
 gi|330433382|gb|AEC18441.1| Peptidase family M23 [Gallibacterium anatis UMN179]
          Length = 486

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  +++RH     TVY H+  P V+ GQ V +G  I LSG +G +  P +H+E   N +A
Sbjct: 391 GRYVMLRHGREYQTVYMHLSRPLVKPGQSVKKGQRIALSGNTGRSTGPHLHYEFHINGVA 450

Query: 73  MDPIK 77
           ++P+K
Sbjct: 451 VNPMK 455


>gi|332526106|ref|ZP_08402244.1| peptidase m23 [Rubrivivax benzoatilyticus JA2]
 gi|332109949|gb|EGJ10577.1| peptidase m23 [Rubrivivax benzoatilyticus JA2]
          Length = 295

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+++H+ + ++ Y+H  T  V++ Q V RG  I   G S +A   Q
Sbjct: 216 VVYAGSGLRGYGNLIIVKHNATFLSAYAHNQTLLVKEDQVVRRGQKIAEMGSS-DADRVQ 274

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP K L  +
Sbjct: 275 LHFEIRRQGKPVDPAKLLPSR 295


>gi|326390699|ref|ZP_08212253.1| Peptidase M23 [Thermoanaerobacter ethanolicus JW 200]
 gi|325993236|gb|EGD51674.1| Peptidase M23 [Thermoanaerobacter ethanolicus JW 200]
          Length = 301

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  L   GN ++I H   I +VY H     V+ GQ V RG  I  SG +G +  P
Sbjct: 220 VVTYAGW-LSGYGNVVIIDHGYGIQSVYGHNSQILVKVGQSVKRGDIIAKSGNTGRSTGP 278

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+R N   +DP+K+L +
Sbjct: 279 HVHFEIRVNGNPVDPMKYLAK 299


>gi|294626640|ref|ZP_06705237.1| lipoprotein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|294665643|ref|ZP_06730920.1| lipoprotein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|292599060|gb|EFF43200.1| lipoprotein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292604589|gb|EFF47963.1| lipoprotein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 259

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A+  
Sbjct: 179 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSGAARD- 237

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 238 MLHFEIRYNGKPVDPLLYLPKK 259


>gi|254509212|ref|ZP_05121309.1| lipoprotein NlpD [Vibrio parahaemolyticus 16]
 gi|219547870|gb|EED24898.1| lipoprotein NlpD [Vibrio parahaemolyticus 16]
          Length = 301

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A   +
Sbjct: 224 VVYSGNALRGYGNLVIVKHNDNYLSAYAHNDRLLVHEGQSVKAGQKIATMGSSG-ANSVR 282

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 283 LHFEIRYQGKSVNPKRYL 300


>gi|325928788|ref|ZP_08189957.1| metalloendopeptidase-like membrane protein [Xanthomonas perforans
           91-118]
 gi|325540869|gb|EGD12442.1| metalloendopeptidase-like membrane protein [Xanthomonas perforans
           91-118]
          Length = 259

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 179 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 237

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 238 MLHFEIRYNGKPVDPLLYLPKK 259


>gi|271500727|ref|YP_003333752.1| Peptidase M23 [Dickeya dadantii Ech586]
 gi|270344282|gb|ACZ77047.1| Peptidase M23 [Dickeya dadantii Ech586]
          Length = 472

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 42/74 (56%), Gaps = 3/74 (4%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           E GN + +RH     T Y H+    V+ GQKV RG  IGLSG +G +  P +H+EL  N 
Sbjct: 375 EAGNFVALRHGRQYTTRYMHMTRLLVKPGQKVKRGDRIGLSGNTGRSTGPHLHYELWINQ 434

Query: 71  IAMDPIKFLEEKIP 84
            A++P   L  K+P
Sbjct: 435 QAVNP---LTAKLP 445


>gi|226328648|ref|ZP_03804166.1| hypothetical protein PROPEN_02543 [Proteus penneri ATCC 35198]
 gi|225203381|gb|EEG85735.1| hypothetical protein PROPEN_02543 [Proteus penneri ATCC 35198]
          Length = 385

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+D  ++ Y+H DT  V++ Q V+ G  I   G SG +   +
Sbjct: 306 VVYAGSALRGYGNLVIIKHNDEYLSAYAHNDTILVREQQNVNAGQQIATMGSSGTSSV-R 364

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+ +L +K
Sbjct: 365 LHFEIRYKEKSLNPMSYLPKK 385


>gi|239817634|ref|YP_002946544.1| peptidase M23 [Variovorax paradoxus S110]
 gi|239804211|gb|ACS21278.1| Peptidase M23 [Variovorax paradoxus S110]
          Length = 446

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 40/69 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H ++  T Y+H+    V+ G+ +++G TIG  G +G A  P +HFE R N   
Sbjct: 342 GNIVIIKHRNNQQTAYAHLSRINVKAGESITQGQTIGAVGSTGWATGPHLHFEFRVNGEY 401

Query: 73  MDPIKFLEE 81
            DP    +E
Sbjct: 402 QDPTSIAQE 410


>gi|328886850|emb|CCA60089.1| putative secreted protein [Streptomyces venezuelae ATCC 10712]
          Length = 471

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 43/73 (58%), Gaps = 3/73 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           G  I++RHDD   + Y H+    V++GQ+V+ G  IG SG +GN+  P +HFE+R     
Sbjct: 395 GYQIVLRHDDGRYSQYGHLSALAVREGQRVTAGQRIGRSGSTGNSSGPHLHFEVRTGPGY 454

Query: 70  AIAMDPIKFLEEK 82
              +DP+ +L  +
Sbjct: 455 GSDIDPLAYLRAR 467


>gi|148469867|gb|ABQ65862.1| lipoprotein [Pseudomonas fluorescens]
          Length = 281

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 202 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKVGQTIAEMGSTG-TDRVK 260

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 261 LHFEIRRQGKPVDPLQFLPRR 281


>gi|78047317|ref|YP_363492.1| outer membrane lipoprotein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78035747|emb|CAJ23438.1| outer membrane lipoprotein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 259

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 179 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 237

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 238 MLHFEIRYNGKPVDPLLYLPKK 259


>gi|290956916|ref|YP_003488098.1| peptidase [Streptomyces scabiei 87.22]
 gi|260646442|emb|CBG69539.1| putative secreted peptidase [Streptomyces scabiei 87.22]
          Length = 262

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA-- 70
           GN I+IR  D   T Y H+ +  V  GQ V+ G  IGLSG +GN   P +HFE R  A  
Sbjct: 186 GNNIVIRMTDGTYTQYGHLSSIGVSVGQTVTPGQQIGLSGATGNVTGPHLHFEARTTAEY 245

Query: 71  -IAMDPIKFL 79
              MDP+ +L
Sbjct: 246 GSDMDPVSYL 255


>gi|325138518|gb|EGC61083.1| lipoprotein nlpD precursor [Neisseria meningitidis ES14902]
          Length = 353

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 275 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 333

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 334 LHFEVRQNGKPVNPNSYI 351


>gi|297162426|gb|ADI12138.1| hypothetical protein SBI_09020 [Streptomyces bingchenggensis BCW-1]
          Length = 389

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 43/73 (58%), Gaps = 3/73 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR---KN 69
           G  ++IRH D + T Y+H+ +  V+ GQ V  G  IG SG +GNA  P +HFE+R   + 
Sbjct: 313 GYEVVIRHSDGLYTQYAHLSSLAVRPGQTVDAGLRIGRSGATGNATGPHLHFEVRTGPRY 372

Query: 70  AIAMDPIKFLEEK 82
              +DP+ +L  +
Sbjct: 373 GSDIDPVAYLRSR 385


>gi|48727550|gb|AAT46074.1| lipoprotein [Pseudomonas chlororaphis]
          Length = 294

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 215 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKVGQTIAEMGSTG-TDRVK 273

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 274 LHFEIRRQGKPVDPLQFLPRR 294


>gi|167032189|ref|YP_001667420.1| peptidase M23B [Pseudomonas putida GB-1]
 gi|166858677|gb|ABY97084.1| peptidase M23B [Pseudomonas putida GB-1]
          Length = 285

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 206 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 264

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 265 LHFEIRRQGKPVDPLQFLPRR 285


>gi|110834032|ref|YP_692891.1| lipoprotein NlpD [Alcanivorax borkumensis SK2]
 gi|110647143|emb|CAL16619.1| lipoprotein NlpD, putative [Alcanivorax borkumensis SK2]
          Length = 253

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H +  ++ Y+H D   V++G  V  G  +   G SG  +  Q
Sbjct: 174 VVYRGSGLTGYGNLLIIKHSERWLSAYAHNDKMMVKEGDAVKAGQQVATMGASGTFR-TQ 232

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK+   +DP+ +L ++
Sbjct: 233 LHFEIRKDGKPVDPMGYLPKR 253


>gi|302559269|ref|ZP_07311611.1| peptidase [Streptomyces griseoflavus Tu4000]
 gi|302476887|gb|EFL39980.1| peptidase [Streptomyces griseoflavus Tu4000]
          Length = 207

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 8   DLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR 67
           D    GN ++I+H +   + Y+H+    V+ GQ V  G  I LSG +GN+  P +HFE+R
Sbjct: 126 DGPAYGNAVVIKHGNGTYSQYAHLSQVDVKVGQVVKTGQKIALSGNTGNSSGPHLHFEIR 185

Query: 68  KN---AIAMDPIKFLEE 81
                  A+DP+KFL  
Sbjct: 186 TTPNYGSAVDPVKFLRA 202


>gi|261377562|ref|ZP_05982135.1| LysM domain/M23 peptidase domain protein [Neisseria cinerea ATCC
           14685]
 gi|269146303|gb|EEZ72721.1| LysM domain/M23 peptidase domain protein [Neisseria cinerea ATCC
           14685]
          Length = 365

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++++H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 287 VVYAGSGLRGYGNLVIVQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 345

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 346 LHFEVRQNGKPVNPNSYI 363


>gi|152990092|ref|YP_001355814.1| M24/M37 family peptidase [Nitratiruptor sp. SB155-2]
 gi|151421953|dbj|BAF69457.1| peptidase, M23/M37 family [Nitratiruptor sp. SB155-2]
          Length = 417

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I H D   T+Y+H+    V++G++V +G  IGL G +G +  P +HF L KN  A
Sbjct: 281 GNVIIIAHADGYRTLYAHLQKRLVRRGRRVKQGSLIGLVGNTGLSTGPHLHFGLYKNGRA 340

Query: 73  MDPIK 77
           ++P++
Sbjct: 341 INPLR 345


>gi|332285198|ref|YP_004417109.1| putative peptidoglycan-binding LysM/M23B peptidase [Pusillimonas
           sp. T7-7]
 gi|330429151|gb|AEC20485.1| putative peptidoglycan-binding LysM/M23B peptidase [Pusillimonas
           sp. T7-7]
          Length = 239

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN +++ HD + ++VY+H     V++G +V +G TI   G S  +   Q
Sbjct: 161 VVYAGNGLRGYGNMLIVNHDANFLSVYAHNKDLLVKEGMQVKQGQTIATMG-STESNAVQ 219

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           ++FELR N  A+D +++L +
Sbjct: 220 LYFELRYNGKAVDALRYLPK 239


>gi|313668127|ref|YP_004048411.1| membrane peptidase [Neisseria lactamica ST-640]
 gi|313005589|emb|CBN87025.1| putative membrane peptidase [Neisseria lactamica 020-06]
          Length = 337

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 259 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASKTQ 317

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 318 LHFEVRQNGKPVNPNSYI 335


>gi|92112181|ref|YP_572109.1| peptidase M23B [Chromohalobacter salexigens DSM 3043]
 gi|91795271|gb|ABE57410.1| peptidase M23B [Chromohalobacter salexigens DSM 3043]
          Length = 387

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 40/64 (62%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            GN ++I H D+I+T+Y+H+    V  G++V RG TI   G SG    P ++FE+R+N  
Sbjct: 317 FGNLVIIDHGDNIMTLYAHLQRFAVGVGEQVERGATIAAVGDSGGRDTPALYFEVRENGD 376

Query: 72  AMDP 75
            +DP
Sbjct: 377 PIDP 380


>gi|261867083|ref|YP_003255005.1| outer membrane antigenic lipoprotein B [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412415|gb|ACX81786.1| outer membrane antigenic lipoprotein B [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 389

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V+  Q++  G  I   G +G     +
Sbjct: 310 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDSILVKDQQEIKAGQQIAKMGSTG-TNGVK 368

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 369 LHFEIRYKGKSVDPLRYLPRR 389


>gi|330878043|gb|EGH12192.1| lipoprotein [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 217

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 138 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTGT-DRVK 196

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 197 LHFEIRRQGKPVDPLGFLPRR 217


>gi|298493154|ref|YP_003723331.1| peptidase M23 ['Nostoc azollae' 0708]
 gi|298235072|gb|ADI66208.1| Peptidase M23 ['Nostoc azollae' 0708]
          Length = 404

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 37/67 (55%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H   I T+Y H    YV +GQ V +G  I   G +G +  P +HFE+R+N   
Sbjct: 335 GKAVIISHGKGITTLYGHTSELYVTEGQSVQKGLAIAAVGFTGLSTGPHLHFEVRRNGTP 394

Query: 73  MDPIKFL 79
           +DP  +L
Sbjct: 395 VDPANYL 401


>gi|52426323|ref|YP_089460.1| NlpD protein [Mannheimia succiniciproducens MBEL55E]
 gi|52308375|gb|AAU38875.1| NlpD protein [Mannheimia succiniciproducens MBEL55E]
          Length = 270

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V   Q+V  G  I   G SG     +
Sbjct: 191 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDSISVNDQQEVKAGQQIAKMGSSG-TNSTK 249

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP  +L  +
Sbjct: 250 LHFEIRYKGKSVDPTSYLPRR 270


>gi|307294968|ref|ZP_07574810.1| Peptidase M23 [Sphingobium chlorophenolicum L-1]
 gi|306879442|gb|EFN10660.1| Peptidase M23 [Sphingobium chlorophenolicum L-1]
          Length = 392

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 42/70 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + + H + ++T Y+H+     + GQ V+RG  I   G +G +  P +HFE+R N  A
Sbjct: 302 GNVVEVTHGNGLMTRYAHLSRFDARIGQSVARGEKIARMGSTGRSTGPHLHFEVRVNGNA 361

Query: 73  MDPIKFLEEK 82
           ++P +FLE +
Sbjct: 362 INPRRFLEAR 371


>gi|37680993|ref|NP_935602.1| membrane protein [Vibrio vulnificus YJ016]
 gi|37199743|dbj|BAC95573.1| membrane protein [Vibrio vulnificus YJ016]
          Length = 308

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A+   
Sbjct: 231 VVYSGNALRGYGNLIIVKHNDNYLSAYAHNDRLLVSEGQSVKAGQQIATMGSSG-AKTVM 289

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 290 LHFEIRYQGKSVNPKRYL 307


>gi|289662666|ref|ZP_06484247.1| lipoprotein [Xanthomonas campestris pv. vasculorum NCPPB702]
          Length = 257

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 177 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 235

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 236 MLHFEIRYNGKPVDPLLYLPKK 257


>gi|304405928|ref|ZP_07387586.1| Peptidase M23 [Paenibacillus curdlanolyticus YK9]
 gi|304345171|gb|EFM11007.1| Peptidase M23 [Paenibacillus curdlanolyticus YK9]
          Length = 520

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 44/67 (65%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H +   T+Y H+ +  V++GQ V +G  +G+ G +G++    +HFE++KN + 
Sbjct: 454 GNCVIINHKNGYKTLYGHMSSIAVKQGQVVEKGDKVGVMGNTGHSTGTHLHFEIQKNGVV 513

Query: 73  MDPIKFL 79
            +P+K+L
Sbjct: 514 QNPLKYL 520


>gi|94499591|ref|ZP_01306128.1| Peptidase M23B [Oceanobacter sp. RED65]
 gi|94428345|gb|EAT13318.1| Peptidase M23B [Oceanobacter sp. RED65]
          Length = 232

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           +IY G  +  LGN IL++H D+++TVY +  + YV++G KV  G  I  +G+    +   
Sbjct: 154 IIYSGKGIQHLGNLILVKHKDNLITVYGNNYSNYVKQGHKVKAGDLIAAAGER-KGRKSG 212

Query: 62  VHFELRKNAIAMDPIKFLE 80
           ++FE+R N  A DP  +L+
Sbjct: 213 LYFEVRHNGEAQDPFLYLK 231


>gi|260655325|ref|ZP_05860813.1| M23/M37, cell wall endopeptidase family [Jonquetella anthropi E3_33
           E1]
 gi|260629773|gb|EEX47967.1| M23/M37, cell wall endopeptidase family [Jonquetella anthropi E3_33
           E1]
          Length = 473

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++ RHD    T+Y+H  T  V KGQ+VS G  I   G SG +  P +HFE+R N   
Sbjct: 406 GRVVVTRHDSVSSTLYAHAQTLKVCKGQQVSAGQVIATVGTSGRSTGPHLHFEIRLNNKP 465

Query: 73  MDPIKFL 79
            +P+ +L
Sbjct: 466 TNPMSYL 472


>gi|172036729|ref|YP_001803230.1| peptidoglycan-binding M23B family peptidase [Cyanothece sp. ATCC
           51142]
 gi|171698183|gb|ACB51164.1| putative peptidoglycan-binding peptidase, M23B family [Cyanothece
           sp. ATCC 51142]
          Length = 192

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G     LG  + IRH D  V+VY H     V  GQ V RG  I   G +G +  P
Sbjct: 96  VVVFAGWSNKGLGYQVSIRHPDGNVSVYGHNQRLLVTSGQTVERGQQIAEMGSTGFSTGP 155

Query: 61  QVHFELRKNA-IAMDPIKFLEEKIP 84
            +HFE+R N   A++PI FL  + P
Sbjct: 156 HLHFEIRPNGKKAVNPIAFLPGQRP 180


>gi|126659783|ref|ZP_01730910.1| lipoprotein; NlpD [Cyanothece sp. CCY0110]
 gi|126618935|gb|EAZ89677.1| lipoprotein; NlpD [Cyanothece sp. CCY0110]
          Length = 192

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G     LG  + IRH D  V+VY H     V  GQ V RG  I   G +G +  P
Sbjct: 96  VVVFAGWSNKGLGYQVSIRHPDGNVSVYGHNQRLLVTSGQTVERGQQIAEMGSTGFSTGP 155

Query: 61  QVHFELRKNA-IAMDPIKFLEEKIP 84
            +HFE+R N   A++PI FL  + P
Sbjct: 156 HLHFEIRPNGRKAVNPIAFLPGQRP 180


>gi|146308042|ref|YP_001188507.1| peptidase M23B [Pseudomonas mendocina ymp]
 gi|145576243|gb|ABP85775.1| peptidase M23B [Pseudomonas mendocina ymp]
          Length = 293

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G A   +
Sbjct: 214 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-ADRVK 272

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 273 LHFEIRRQGKPVDPLQYLPRR 293


>gi|302553200|ref|ZP_07305542.1| peptidase [Streptomyces viridochromogenes DSM 40736]
 gi|302470818|gb|EFL33911.1| peptidase [Streptomyces viridochromogenes DSM 40736]
          Length = 200

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 3/78 (3%)

Query: 8   DLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR 67
           D    GN I+I+H +   + Y+H+    V+ GQ V  G  I  SG +GN+  P +HFE+R
Sbjct: 119 DGPAYGNAIVIKHGNGTYSQYAHLSKIEVRIGQVVKTGQEIARSGNTGNSSGPHLHFEIR 178

Query: 68  KN---AIAMDPIKFLEEK 82
                  A+DP+KFL  K
Sbjct: 179 TTPNYGSAVDPVKFLRAK 196


>gi|292488533|ref|YP_003531417.1| metalloprotease YebA [Erwinia amylovora CFBP1430]
 gi|292899709|ref|YP_003539078.1| peptidase [Erwinia amylovora ATCC 49946]
 gi|291199557|emb|CBJ46674.1| putative peptidase [Erwinia amylovora ATCC 49946]
 gi|291553964|emb|CBA21009.1| Uncharacterized metalloprotease yebA precursor [Erwinia amylovora
           CFBP1430]
          Length = 441

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH    +T Y H+ T  V+ GQKV RG  I LSG +G +  P VHFE+  N  A
Sbjct: 346 GNYVAIRHGRQYMTRYMHLKTLLVKPGQKVKRGDRIALSGNTGRSTGPHVHFEVWINNQA 405

Query: 73  MDPI 76
           ++P+
Sbjct: 406 VNPL 409


>gi|75906408|ref|YP_320704.1| peptidase M23B [Anabaena variabilis ATCC 29413]
 gi|75700133|gb|ABA19809.1| Peptidase M23B [Anabaena variabilis ATCC 29413]
          Length = 400

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 37/67 (55%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H   I T+Y H    YV +GQ V RG  I   G +G +  P +HFE+R+N   
Sbjct: 334 GRAVIINHGGGITTLYGHASELYVAEGQPVQRGQAIAAVGSTGLSTGPHLHFEVRRNGTP 393

Query: 73  MDPIKFL 79
           ++P  +L
Sbjct: 394 VNPGDYL 400


>gi|320155342|ref|YP_004187721.1| lipoprotein NlpD [Vibrio vulnificus MO6-24/O]
 gi|319930654|gb|ADV85518.1| lipoprotein NlpD [Vibrio vulnificus MO6-24/O]
          Length = 298

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A+   
Sbjct: 221 VVYSGNALRGYGNLIIVKHNDNYLSAYAHNDRLLVSEGQSVKAGQQIATMGSSG-AKTVM 279

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 280 LHFEIRYQGKSVNPKRYL 297


>gi|298368538|ref|ZP_06979856.1| LysM domain/M23 peptidase domain protein [Neisseria sp. oral taxon
           014 str. F0314]
 gi|298282541|gb|EFI24028.1| LysM domain/M23 peptidase domain protein [Neisseria sp. oral taxon
           014 str. F0314]
          Length = 315

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H  + ++ Y H  +  V +GQ V RG TI   G S +A   Q
Sbjct: 237 VVYAGSGLRGYGNLVIIQHSPTFLSAYGHNQSLLVNEGQTVKRGQTIAKMGNS-DASRTQ 295

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 296 LHFEVRQNGKPVNPANYV 313


>gi|326776116|ref|ZP_08235381.1| Peptidase M23 [Streptomyces cf. griseus XylebKG-1]
 gi|326656449|gb|EGE41295.1| Peptidase M23 [Streptomyces cf. griseus XylebKG-1]
          Length = 271

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN I++R  D   T Y H+ +  V  GQ VS G  IGLSG +GN+  P +HFE R     
Sbjct: 195 GNNIVLRMTDGTYTQYGHLSSIGVSVGQSVSSGQQIGLSGSTGNSTGPHLHFEARTTPDY 254

Query: 70  AIAMDPIKFL 79
              MDP+ +L
Sbjct: 255 GSDMDPVGYL 264


>gi|229588833|ref|YP_002870952.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
 gi|229360699|emb|CAY47557.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
          Length = 278

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 199 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKVGQTIAEMGSTG-TDRVK 257

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 258 LHFEIRRQGKPVDPLQFLPRR 278


>gi|228471805|ref|ZP_04056578.1| peptidase, family M23 [Capnocytophaga gingivalis ATCC 33624]
 gi|228276958|gb|EEK15653.1| peptidase, family M23 [Capnocytophaga gingivalis ATCC 33624]
          Length = 433

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRHD +  T Y H+     +KGQ VS+G  IGL G +G A  P V +   KN + 
Sbjct: 313 GNYVKIRHDKTYETQYLHMSKIIARKGQHVSQGDVIGLVGSTGLATGPHVCYRFWKNGVQ 372

Query: 73  MDPIKFLEEKIP 84
           +DP+K   EK+P
Sbjct: 373 IDPLK---EKLP 381


>gi|218887381|ref|YP_002436702.1| peptidase M23 [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758335|gb|ACL09234.1| Peptidase M23 [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 300

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 44/67 (65%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++++H   + T Y+H+    +++GQ ++RG  IG  G SG +  P +H+E+R N + 
Sbjct: 232 GNCVVLQHGGGLATRYAHMQRFVLKEGQTINRGDLIGYIGNSGRSTGPHLHYEVRLNGVC 291

Query: 73  MDPIKFL 79
           ++P++++
Sbjct: 292 VNPMRYI 298


>gi|182435479|ref|YP_001823198.1| M23 family secreted peptidase [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178463995|dbj|BAG18515.1| putative M23-family secreted peptidase [Streptomyces griseus subsp.
           griseus NBRC 13350]
          Length = 271

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN I++R  D   T Y H+ +  V  GQ VS G  IGLSG +GN+  P +HFE R     
Sbjct: 195 GNNIVLRMTDGTYTQYGHLSSIGVSVGQSVSSGQQIGLSGSTGNSTGPHLHFEARTTPDY 254

Query: 70  AIAMDPIKFL 79
              MDP+ +L
Sbjct: 255 GSDMDPVGYL 264


>gi|289669629|ref|ZP_06490704.1| lipoprotein [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 257

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 177 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 235

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 236 MLHFEIRYNGKPVDPLLYLPKK 257


>gi|188533636|ref|YP_001907433.1| hypothetical protein ETA_14940 [Erwinia tasmaniensis Et1/99]
 gi|188028678|emb|CAO96540.1| Conserved hypothetical protein YebA [Erwinia tasmaniensis Et1/99]
          Length = 441

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH    +T Y H+ T  V+ GQKV RG  I LSG +G +  P VHFE+  N  A
Sbjct: 346 GNYVAIRHGRQYMTRYMHLKTLLVKPGQKVKRGDRIALSGNTGRSTGPHVHFEVWINNQA 405

Query: 73  MDPI 76
           ++P+
Sbjct: 406 VNPL 409


>gi|254180176|ref|ZP_04886775.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1655]
 gi|184210716|gb|EDU07759.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1655]
          Length = 233

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++HD   +T Y+H     V++GQ V++G  I   G + N     
Sbjct: 154 VVYAGNGLRGYGNLLIVKHDADFLTTYAHNRALLVKEGQTVAQGQKIAEMGDTDN-NRVA 212

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 213 LHFELRYGGRSIDPARYLPSR 233


>gi|323495850|ref|ZP_08100918.1| membrane protein [Vibrio sinaloensis DSM 21326]
 gi|323319066|gb|EGA72009.1| membrane protein [Vibrio sinaloensis DSM 21326]
          Length = 310

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A   +
Sbjct: 233 VVYSGNALRGYGNLVIVKHNDNYLSAYAHNDRLLVHEGQSVKAGQKIATMGSSG-ANSVR 291

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 292 LHFEIRYQGKSVNPKRYL 309


>gi|145223404|ref|YP_001134082.1| peptidase M23B [Mycobacterium gilvum PYR-GCK]
 gi|145215890|gb|ABP45294.1| peptidase M23B [Mycobacterium gilvum PYR-GCK]
          Length = 339

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/62 (43%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 22  DSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN-AIAMDPIKFLE 80
           D  VT+Y HIDT  VQ GQ+V  G  I   G  GN+  P +HFE+ +N ++  DP+ +L 
Sbjct: 273 DGTVTLYGHIDTTMVQTGQRVMAGDQIATMGNRGNSTGPHLHFEVHRNGSVKTDPMAWLG 332

Query: 81  EK 82
           E+
Sbjct: 333 ER 334


>gi|268608724|ref|ZP_06142451.1| peptidase M23B [Ruminococcus flavefaciens FD-1]
          Length = 645

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 36/67 (53%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H D   TVY+H+   Y   G  V RG  IG  G +G++  P  HFE+R   I 
Sbjct: 497 GYFVMIDHLDGYQTVYAHMSQVYATTGTPVKRGQLIGAVGSTGDSTGPHCHFEVRYMGIC 556

Query: 73  MDPIKFL 79
            DP KF+
Sbjct: 557 YDPAKFM 563


>gi|121609598|ref|YP_997405.1| peptidase M23B [Verminephrobacter eiseniae EF01-2]
 gi|121554238|gb|ABM58387.1| peptidase M23B [Verminephrobacter eiseniae EF01-2]
          Length = 462

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + ++H +  VTVY+H+    V+ GQ + +G T+G  G +G A  P +HFE R N   
Sbjct: 356 GNVVFVKHRNQHVTVYAHLSRIDVRPGQSIEQGQTLGAVGATGWATGPHLHFEFRVNGHY 415

Query: 73  MDP 75
            DP
Sbjct: 416 QDP 418


>gi|24415300|gb|AAN59885.1| lipoprotein [Pseudomonas syringae pv. aptata]
          Length = 95

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2  VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
          V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 16 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTGT-DRVK 74

Query: 62 VHFELRKNAIAMDPIKFLEEK 82
          +HFE+R+    +DP+ FL  +
Sbjct: 75 LHFEIRRQGKPVDPLGFLPRR 95


>gi|114563620|ref|YP_751133.1| peptidase M23B [Shewanella frigidimarina NCIMB 400]
 gi|114334913|gb|ABI72295.1| peptidase M23B [Shewanella frigidimarina NCIMB 400]
          Length = 428

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 41/65 (63%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I HD+ + T Y H+    V++GQ+V+RG  IGLSG +G +  P +H+E   N   
Sbjct: 333 GNYIVIDHDNKVRTRYLHLSRFLVKRGQRVTRGQVIGLSGNTGASTGPHLHYEFIVNGRP 392

Query: 73  MDPIK 77
           +D +K
Sbjct: 393 IDAMK 397


>gi|317130726|ref|YP_004097008.1| peptidase M23 [Bacillus cellulosilyticus DSM 2522]
 gi|315475674|gb|ADU32277.1| Peptidase M23 [Bacillus cellulosilyticus DSM 2522]
          Length = 265

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 2/72 (2%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKS-GNAQHP-QVHFELRKN 69
            G  + I HD+ IVT+Y  +D   V+ GQ V +G  IG +G++  NA     VHFELRK 
Sbjct: 163 FGQVVHIEHDEDIVTIYQSLDGSLVEAGQTVKQGDVIGRAGRNLYNADAGVHVHFELRKQ 222

Query: 70  AIAMDPIKFLEE 81
            I ++P+ F+E+
Sbjct: 223 GIPVNPLDFMEQ 234


>gi|255746096|ref|ZP_05420043.1| cell wall endopeptidase family M23/M37 [Vibrio cholera CIRS 101]
 gi|262162066|ref|ZP_06031081.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae INDRE 91/1]
 gi|262169004|ref|ZP_06036698.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae RC27]
 gi|255735850|gb|EET91248.1| cell wall endopeptidase family M23/M37 [Vibrio cholera CIRS 101]
 gi|262022703|gb|EEY41410.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae RC27]
 gi|262028141|gb|EEY46799.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae INDRE 91/1]
          Length = 362

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H ++ +T Y H+    V+KGQKVSRG  IGLSG +G    P +H+EL    + 
Sbjct: 260 GNYVVIQHGNTYMTRYLHLSKILVKKGQKVSRGQRIGLSGNTGRVTGPHLHYEL---IVR 316

Query: 73  MDPIKFLEEKIP 84
             P+  ++  IP
Sbjct: 317 GRPVNAMKANIP 328


>gi|27364955|ref|NP_760483.1| membrane protein [Vibrio vulnificus CMCP6]
 gi|27361101|gb|AAO10010.1| Membrane protein [Vibrio vulnificus CMCP6]
          Length = 298

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A+   
Sbjct: 221 VVYSGNALRGYGNLIIVKHNDNYLSAYAHNDRLLVSEGQSVKAGQQIATMGSSG-AKTVM 279

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 280 LHFEIRYQGKSVNPKRYL 297


>gi|293391442|ref|ZP_06635776.1| outer membrane antigenic lipoprotein B [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951976|gb|EFE02095.1| outer membrane antigenic lipoprotein B [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 389

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V+  Q++  G  I   G +G     +
Sbjct: 310 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDSILVKDQQEIKAGQQIAKMGSTG-TNGVK 368

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 369 LHFEIRYKGKSVDPLRYLPRR 389


>gi|254225852|ref|ZP_04919455.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|125621579|gb|EAZ49910.1| conserved hypothetical protein [Vibrio cholerae V51]
          Length = 430

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H ++ +T Y H+    V+KGQKVSRG  IGLSG +G    P +H+EL    + 
Sbjct: 328 GNYVVIQHGNTYMTRYLHLSKILVKKGQKVSRGQRIGLSGNTGRVTGPHLHYEL---IVR 384

Query: 73  MDPIKFLEEKIP 84
             P+  ++  IP
Sbjct: 385 GRPVNAMKANIP 396


>gi|76810588|ref|YP_333112.1| peptidase [Burkholderia pseudomallei 1710b]
 gi|238562786|ref|ZP_00439880.2| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei GB8 horse 4]
 gi|251767629|ref|ZP_02267936.2| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei PRL-20]
 gi|262193298|ref|YP_001080170.2| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei NCTC 10247]
 gi|76580041|gb|ABA49516.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei
           1710b]
 gi|238521956|gb|EEP85404.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei GB8 horse 4]
 gi|243062132|gb|EES44318.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei PRL-20]
 gi|261826011|gb|ABN03374.2| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei NCTC 10229]
 gi|261835051|gb|ABO05114.2| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei NCTC 10247]
          Length = 296

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++HD   +T Y+H     V++GQ V++G  I   G + N     
Sbjct: 217 VVYAGNGLRGYGNLLIVKHDADFLTTYAHNRALLVKEGQTVAQGQKIAEMGDTDN-DRVA 275

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 276 LHFELRYGGRSIDPARYLPSR 296


>gi|322513813|ref|ZP_08066899.1| outer membrane antigenic lipoprotein B [Actinobacillus ureae ATCC
           25976]
 gi|322120381|gb|EFX92311.1| outer membrane antigenic lipoprotein B [Actinobacillus ureae ATCC
           25976]
          Length = 412

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H D  ++ Y+H D+  V +   V+ G TI   G +G   + +
Sbjct: 333 VVYAGNALEGYGNLIIIKHSDDFLSAYAHNDSIKVDEQDTVNAGETIAKMGSTGTNSN-K 391

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L ++
Sbjct: 392 LHFEIRYKGKSVDPTRYLPKR 412


>gi|153825752|ref|ZP_01978419.1| hypothetical metalloprotease YebA [Vibrio cholerae MZO-2]
 gi|149740591|gb|EDM54702.1| hypothetical metalloprotease YebA [Vibrio cholerae MZO-2]
          Length = 362

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H ++ +T Y H+    V+KGQKVSRG  IGLSG +G    P +H+EL    + 
Sbjct: 260 GNYVVIQHGNTYMTRYLHLSKILVKKGQKVSRGQRIGLSGNTGRVTGPHLHYEL---IVR 316

Query: 73  MDPIKFLEEKIP 84
             P+  ++  IP
Sbjct: 317 GRPVNAMKANIP 328


>gi|15600850|ref|NP_232480.1| hypothetical protein VCA0079 [Vibrio cholerae O1 biovar eltor str.
           N16961]
 gi|121590628|ref|ZP_01677963.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121726969|ref|ZP_01680165.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147671781|ref|YP_001214901.1| hypothetical protein VC0395_0060 [Vibrio cholerae O395]
 gi|153212880|ref|ZP_01948497.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|153801204|ref|ZP_01955790.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|153819236|ref|ZP_01971903.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153823630|ref|ZP_01976297.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|227811706|ref|YP_002811716.1| hypothetical protein VCM66_A0077 [Vibrio cholerae M66-2]
 gi|254284804|ref|ZP_04959771.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|254850344|ref|ZP_05239694.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|297579785|ref|ZP_06941712.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298499943|ref|ZP_07009749.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9657464|gb|AAF95993.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121547521|gb|EAX57626.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|121630603|gb|EAX62992.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|124116258|gb|EAY35078.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|124123222|gb|EAY41965.1| conserved hypothetical protein [Vibrio cholerae MZO-3]
 gi|126510228|gb|EAZ72822.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|126518850|gb|EAZ76073.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|146314164|gb|ABQ18704.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|150425589|gb|EDN17365.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|227010848|gb|ACP07059.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|227014711|gb|ACP10920.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|254846049|gb|EET24463.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|297535431|gb|EFH74265.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297541924|gb|EFH77975.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 430

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H ++ +T Y H+    V+KGQKVSRG  IGLSG +G    P +H+EL    + 
Sbjct: 328 GNYVVIQHGNTYMTRYLHLSKILVKKGQKVSRGQRIGLSGNTGRVTGPHLHYEL---IVR 384

Query: 73  MDPIKFLEEKIP 84
             P+  ++  IP
Sbjct: 385 GRPVNAMKANIP 396


>gi|302538164|ref|ZP_07290506.1| peptidase [Streptomyces sp. C]
 gi|302447059|gb|EFL18875.1| peptidase [Streptomyces sp. C]
          Length = 101

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (58%), Gaps = 3/73 (4%)

Query: 13 GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
          G  ++I+H D   + Y+H+    V+ GQ+VS G  IG SG +GN+  P +HFE+R     
Sbjct: 25 GYQVVIKHSDGRYSQYAHLSALGVKAGQQVSGGQRIGRSGSTGNSSGPHLHFEMRSAPGY 84

Query: 70 AIAMDPIKFLEEK 82
             +DP+K+L  K
Sbjct: 85 GSDIDPLKYLRNK 97


>gi|258646389|ref|ZP_05733858.1| peptidase, M23/M37 family [Dialister invisus DSM 15470]
 gi|260403791|gb|EEW97338.1| peptidase, M23/M37 family [Dialister invisus DSM 15470]
          Length = 311

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + ++H D IVT Y H     V +GQ V +G  I L G +GN+  P  H+E+R N  A
Sbjct: 241 GYLVEVKHADGIVTRYGHNSAVLVYEGQHVDQGSMIALMGSTGNSTGPHCHYEVRINGEA 300

Query: 73  MDPIKFL 79
           +DP+ FL
Sbjct: 301 VDPMYFL 307


>gi|24415297|gb|AAN59883.1| lipoprotein [Pseudomonas syringae pv. aptata]
          Length = 94

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2  VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
          V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 15 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTGT-DRVK 73

Query: 62 VHFELRKNAIAMDPIKFLEEK 82
          +HFE+R+    +DP+ FL  +
Sbjct: 74 LHFEIRRQGKPVDPLGFLPRR 94


>gi|119855058|ref|YP_935663.1| peptidase M23B [Mycobacterium sp. KMS]
 gi|145225939|ref|YP_001136593.1| peptidase M23B [Mycobacterium gilvum PYR-GCK]
 gi|119697776|gb|ABL94848.1| peptidase M23B [Mycobacterium sp. KMS]
 gi|145218402|gb|ABP47805.1| peptidase M23B [Mycobacterium gilvum PYR-GCK]
          Length = 340

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            G  + IR  D  VT+Y HIDT  VQ GQ+V  G  I   G  GN+  P +HFE+  N  
Sbjct: 264 FGMWVKIRAADGTVTLYGHIDTTMVQTGQRVMAGDQIATMGNRGNSTGPHLHFEVHLNGT 323

Query: 72  -AMDPIKFLEEK 82
             +DP+ +L E+
Sbjct: 324 DKIDPMAWLGER 335


>gi|330872697|gb|EGH06846.1| lipoprotein NlpD [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 288

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|312172676|emb|CBX80932.1| Uncharacterized metalloprotease yebA precursor [Erwinia amylovora
           ATCC BAA-2158]
          Length = 441

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH    +T Y H+ T  V+ GQKV RG  I LSG +G +  P VHFE+  N  A
Sbjct: 346 GNYVAIRHGRQYMTRYMHLKTLLVKPGQKVKRGDRIALSGNTGRSTGPHVHFEVWINNQA 405

Query: 73  MDPI 76
           ++P+
Sbjct: 406 VNPL 409


>gi|163801203|ref|ZP_02195102.1| hypothetical protein 1103602000598_AND4_10059 [Vibrio sp. AND4]
 gi|159174692|gb|EDP59492.1| hypothetical protein AND4_10059 [Vibrio sp. AND4]
          Length = 428

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H     T Y H+    V+KGQKVSRG  IGLSGK+G    P +H+EL +    
Sbjct: 328 GNYVVIEHGSKYKTRYLHLSKILVKKGQKVSRGQRIGLSGKTGRVTGPHLHYELIEYG-- 385

Query: 73  MDPIKFLEEKIP 84
             P+  +  KIP
Sbjct: 386 -RPVNAMRAKIP 396


>gi|28868770|ref|NP_791389.1| lipoprotein NlpD [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213969148|ref|ZP_03397287.1| lipoprotein NlpD [Pseudomonas syringae pv. tomato T1]
 gi|301383957|ref|ZP_07232375.1| lipoprotein NlpD, putative [Pseudomonas syringae pv. tomato Max13]
 gi|302064157|ref|ZP_07255698.1| lipoprotein NlpD, putative [Pseudomonas syringae pv. tomato K40]
 gi|302134084|ref|ZP_07260074.1| lipoprotein NlpD, putative [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|28852009|gb|AAO55084.1| lipoprotein NlpD, putative [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213926146|gb|EEB59702.1| lipoprotein NlpD [Pseudomonas syringae pv. tomato T1]
 gi|331016397|gb|EGH96453.1| lipoprotein NlpD, putative [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 288

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|33593857|ref|NP_881501.1| putative lipoprotein [Bordetella pertussis Tohama I]
 gi|33563930|emb|CAE43191.1| putative lipoprotein [Bordetella pertussis Tohama I]
 gi|332383276|gb|AEE68123.1| putative lipoprotein [Bordetella pertussis CS]
          Length = 247

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y  N L   GN +++RHD S +T+Y+H     V++GQ+VS+G  I   G + ++Q   
Sbjct: 168 VAYASNGLRGYGNLVIVRHDGSFLTIYAHNRKLLVKQGQRVSQGQRIAEMGDTDSSQV-N 226

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           ++FELR++  A++P   L  +
Sbjct: 227 LYFELRRDGKAVNPAGALPRR 247


>gi|319763721|ref|YP_004127658.1| peptidase m23 [Alicycliphilus denitrificans BC]
 gi|330824016|ref|YP_004387319.1| peptidase M23 [Alicycliphilus denitrificans K601]
 gi|317118282|gb|ADV00771.1| Peptidase M23 [Alicycliphilus denitrificans BC]
 gi|329309388|gb|AEB83803.1| Peptidase M23 [Alicycliphilus denitrificans K601]
          Length = 300

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN ++++H+++ +T Y+H  T  V++ Q V RG  I   G S +A   +
Sbjct: 221 VVYAGAGLRGYGNLVILKHNNTFLTAYAHNQTLLVKEDQNVRRGQKIAEMG-STDADRVK 279

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 280 LHFEIRRQGKPVDPARYLPAR 300


>gi|229514587|ref|ZP_04404048.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae TMA 21]
 gi|229348567|gb|EEO13525.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae TMA 21]
          Length = 423

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H ++ +T Y H+    V+KGQKVSRG  IGLSG +G    P +H+EL    + 
Sbjct: 321 GNYVVIQHGNTYMTRYLHLSKILVKKGQKVSRGQRIGLSGNTGRVTGPHLHYEL---IVR 377

Query: 73  MDPIKFLEEKIP 84
             P+  ++  IP
Sbjct: 378 GRPVNAMKANIP 389


>gi|229526287|ref|ZP_04415691.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae bv.
           albensis VL426]
 gi|229336445|gb|EEO01463.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae bv.
           albensis VL426]
          Length = 423

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H ++ +T Y H+    V+KGQKVSRG  IGLSG +G    P +H+EL    + 
Sbjct: 321 GNYVVIQHGNTYMTRYLHLSKILVKKGQKVSRGQRIGLSGNTGRVTGPHLHYEL---IVR 377

Query: 73  MDPIKFLEEKIP 84
             P+  ++  IP
Sbjct: 378 GRPVNAMKANIP 389


>gi|229527935|ref|ZP_04417326.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae 12129(1)]
 gi|229334297|gb|EEN99782.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae 12129(1)]
          Length = 423

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H ++ +T Y H+    V+KGQKVSRG  IGLSG +G    P +H+EL    + 
Sbjct: 321 GNYVVIQHGNTYMTRYLHLSKILVKKGQKVSRGQRIGLSGNTGRVTGPHLHYEL---IVR 377

Query: 73  MDPIKFLEEKIP 84
             P+  ++  IP
Sbjct: 378 GRPVNAMKANIP 389


>gi|53719020|ref|YP_108006.1| peptidase [Burkholderia pseudomallei K96243]
 gi|52209434|emb|CAH35381.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei
           K96243]
          Length = 237

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++HD   +T Y+H     V++GQ V++G  I   G + N     
Sbjct: 158 VVYAGNGLRGYGNLLIVKHDADFLTTYAHNRALLVKEGQTVAQGQKIAEMGDTDN-DRVA 216

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 217 LHFELRYGGRSIDPARYLPSR 237


>gi|303242119|ref|ZP_07328609.1| Peptidase M23 [Acetivibrio cellulolyticus CD2]
 gi|302590306|gb|EFL60064.1| Peptidase M23 [Acetivibrio cellulolyticus CD2]
          Length = 374

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GNT++I H   I T+Y+H     V  G+ V  G TI   G +G +  P +HFE+RKN   
Sbjct: 306 GNTVVIDHGGGITTLYAHCSKLLVSVGETVKAGETIAKVGSTGMSTGPHLHFEVRKNGST 365

Query: 73  MDPIKFL 79
            DP++++
Sbjct: 366 TDPLRYV 372


>gi|259908224|ref|YP_002648580.1| hypothetical protein EpC_15690 [Erwinia pyrifoliae Ep1/96]
 gi|224963846|emb|CAX55348.1| conserved uncharacterized protein YebA [Erwinia pyrifoliae Ep1/96]
 gi|283478154|emb|CAY74070.1| Uncharacterized metalloprotease yebA precursor [Erwinia pyrifoliae
           DSM 12163]
          Length = 441

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH    +T Y H+ T  V+ GQKV RG  I LSG +G +  P VHFE+  N  A
Sbjct: 346 GNYVAIRHGRQYMTRYMHLKTLLVKPGQKVKRGDRIALSGNTGRSTGPHVHFEVWINNQA 405

Query: 73  MDPI 76
           ++P+
Sbjct: 406 VNPL 409


>gi|212635946|ref|YP_002312471.1| peptidase M23B [Shewanella piezotolerans WP3]
 gi|212557430|gb|ACJ29884.1| Peptidase M23B [Shewanella piezotolerans WP3]
          Length = 428

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 47/90 (52%), Gaps = 10/90 (11%)

Query: 2   VIYVGNDLVEL-------GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKS 54
           VI  G+ +V L       G  ++I H +   T Y H+    V KGQ+VSRG  I LSG +
Sbjct: 315 VIAPGDGIVSLVTDHRFAGKYVVIEHGNKYRTRYLHLSKSLVHKGQRVSRGQVIALSGNT 374

Query: 55  GNAQHPQVHFELRKNAIAMDPIKFLEEKIP 84
           G    P +H+E   N  A+DP+K    KIP
Sbjct: 375 GRITGPHLHYEFHINGRAVDPMK---AKIP 401


>gi|91793856|ref|YP_563507.1| peptidase M23B [Shewanella denitrificans OS217]
 gi|91715858|gb|ABE55784.1| peptidase M23B [Shewanella denitrificans OS217]
          Length = 423

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 40/65 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I HD+ + T Y H+    V+KGQ+V+RG  I LSG +G +  P +H+E   N   
Sbjct: 328 GNYIVIEHDNKVRTRYLHLSKFLVRKGQRVTRGQVIALSGNTGRSTGPHLHYEFHVNGRP 387

Query: 73  MDPIK 77
           +D +K
Sbjct: 388 VDVMK 392


>gi|330964172|gb|EGH64432.1| lipoprotein NlpD [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 288

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|302560021|ref|ZP_07312363.1| peptidase [Streptomyces griseoflavus Tu4000]
 gi|302477639|gb|EFL40732.1| peptidase [Streptomyces griseoflavus Tu4000]
          Length = 197

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 8   DLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR 67
           D    GN I+I+H +   + Y+H+    V+ GQ V  G  I LSG +GN+  P +HFE+R
Sbjct: 116 DGPAYGNAIVIKHGNKTYSQYAHLSQINVKVGQVVKTGQKIALSGNTGNSSGPHLHFEIR 175

Query: 68  KN---AIAMDPIKFLEE 81
                  A+DP KFL  
Sbjct: 176 TTPNYGSAVDPAKFLRA 192


>gi|229506747|ref|ZP_04396256.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae BX 330286]
 gi|229510458|ref|ZP_04399938.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae B33]
 gi|229517411|ref|ZP_04406856.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae RC9]
 gi|229522748|ref|ZP_04412164.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae TM
           11079-80]
 gi|229605221|ref|YP_002875925.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae MJ-1236]
 gi|229340733|gb|EEO05739.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae TM
           11079-80]
 gi|229345447|gb|EEO10420.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae RC9]
 gi|229352903|gb|EEO17843.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae B33]
 gi|229357098|gb|EEO22016.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae BX 330286]
 gi|229371707|gb|ACQ62129.1| cell wall endopeptidase family M23/M37 [Vibrio cholerae MJ-1236]
          Length = 423

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H ++ +T Y H+    V+KGQKVSRG  IGLSG +G    P +H+EL    + 
Sbjct: 321 GNYVVIQHGNTYMTRYLHLSKILVKKGQKVSRGQRIGLSGNTGRVTGPHLHYEL---IVR 377

Query: 73  MDPIKFLEEKIP 84
             P+  ++  IP
Sbjct: 378 GRPVNAMKANIP 389


>gi|156977518|ref|YP_001448424.1| peptidase [Vibrio harveyi ATCC BAA-1116]
 gi|156529112|gb|ABU74197.1| hypothetical protein VIBHAR_06306 [Vibrio harveyi ATCC BAA-1116]
          Length = 439

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H     T Y H+    V+KGQKVSRG  IGLSGK+G    P +H+EL +    
Sbjct: 339 GNYVVIEHGSKYKTRYLHLSKILVKKGQKVSRGQRIGLSGKTGRVTGPHLHYELIEYG-- 396

Query: 73  MDPIKFLEEKIP 84
             P+  +  KIP
Sbjct: 397 -RPVNAMRAKIP 407


>gi|20807323|ref|NP_622494.1| membrane proteins related to metalloendopeptidase
           [Thermoanaerobacter tengcongensis MB4]
 gi|20515836|gb|AAM24098.1| Membrane proteins related to metalloendopeptidases
           [Thermoanaerobacter tengcongensis MB4]
          Length = 301

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  L   G  ++I H   I +VY H     V+ GQ V+RG  I  SG +G +  P
Sbjct: 220 VVVYAGW-LAGYGKAVIIDHGYGIESVYGHNSQILVKVGQTVNRGDVIAKSGNTGRSTGP 278

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+R N   ++P+K+L +
Sbjct: 279 HVHFEIRANGSPVNPMKYLAK 299


>gi|310767861|gb|ADP12811.1| hypothetical protein EJP617_31300 [Erwinia sp. Ejp617]
          Length = 441

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH    +T Y H+ T  V+ GQKV RG  I LSG +G +  P VHFE+  N  A
Sbjct: 346 GNYVAIRHGRQYMTRYMHLKTLLVKPGQKVKRGDRIALSGNTGRSTGPHVHFEVWINNQA 405

Query: 73  MDPI 76
           ++P+
Sbjct: 406 VNPL 409


>gi|304396230|ref|ZP_07378112.1| Peptidase M23 [Pantoea sp. aB]
 gi|304356599|gb|EFM20964.1| Peptidase M23 [Pantoea sp. aB]
          Length = 443

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH    +T Y H+    V+ G+KV RG  IGLSG +G +  P +HFE+  N  A
Sbjct: 348 GNYVAIRHGRQYMTRYMHMKKVLVKPGEKVKRGDRIGLSGNTGRSTGPHLHFEIWINNQA 407

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 408 VNP---LTAKLP 416


>gi|327485311|gb|AEA79717.1| Cell wall endopeptidase, family M23/M37 [Vibrio cholerae LMA3894-4]
          Length = 416

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H ++ +T Y H+    V+KGQKVSRG  IGLSG +G    P +H+EL    + 
Sbjct: 314 GNYVVIQHGNTYMTRYLHLSKILVKKGQKVSRGQRIGLSGNTGRVTGPHLHYEL---IVR 370

Query: 73  MDPIKFLEEKIP 84
             P+  ++  IP
Sbjct: 371 GRPVNAMKANIP 382


>gi|33600283|ref|NP_887843.1| putative lipoprotein [Bordetella bronchiseptica RB50]
 gi|33567881|emb|CAE31795.1| putative lipoprotein [Bordetella bronchiseptica RB50]
          Length = 224

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y  N L   GN +++RHD S +T+Y+H     V++GQ+VS+G  I   G + ++Q   
Sbjct: 145 VAYASNGLRGYGNLVIVRHDGSFLTIYAHNRKLLVKQGQRVSQGQRIAEMGDTDSSQV-N 203

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           ++FELR++  A++P   L  +
Sbjct: 204 LYFELRRDGKAVNPAGALPRR 224


>gi|312128630|ref|YP_003993504.1| peptidase M23 [Caldicellulosiruptor hydrothermalis 108]
 gi|311778649|gb|ADQ08135.1| Peptidase M23 [Caldicellulosiruptor hydrothermalis 108]
          Length = 582

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+I H +   T Y H+    V  GQKV++G  I  SG +G +  P +HFE+RKN + 
Sbjct: 515 GKLIIINHQNGYKTYYGHLSRFLVSPGQKVAKGQLIAKSGSTGRSTGPHLHFEVRKNGVP 574

Query: 73  MDPIKFLE 80
            +P+ +L 
Sbjct: 575 QNPLVYLR 582


>gi|167836246|ref|ZP_02463129.1| lipoprotein NlpD, putative [Burkholderia thailandensis MSMB43]
          Length = 232

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+   +T Y+H  T  V++GQ V++G  I   G + N     
Sbjct: 153 VVYAGNGLRGYGNLLIVKHNADFLTTYAHNRTLLVKEGQTVAQGQKIAEMGDTDN-DRVA 211

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 212 LHFELRYGGRSIDPARYLPSR 232


>gi|146297400|ref|YP_001181171.1| peptidase M23B [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145410976|gb|ABP67980.1| peptidase M23B [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 574

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H +   T Y H+    V  GQKV +G  I  SG +G +  P +HFE+RKN + 
Sbjct: 507 GKLVIINHKNGYQTYYGHLSRILVSPGQKVVKGQLIAKSGSTGRSTGPHLHFEVRKNGVP 566

Query: 73  MDPIKFL 79
            +P+++L
Sbjct: 567 QNPLRYL 573


>gi|313157515|gb|EFR56934.1| peptidase, M23 family [Alistipes sp. HGB5]
          Length = 316

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T++I H +   T Y+H+    V+KGQ+V RG  I LSG +G +  P +H+E+R N + 
Sbjct: 226 GQTVVIDHGNGYETSYNHLSKIDVRKGQQVRRGDIIALSGDTGLSLAPHLHYEVRYNGMR 285

Query: 73  MDPIKFL 79
           +DPI + 
Sbjct: 286 VDPIHYF 292


>gi|53725511|ref|YP_102562.1| lipoprotein NlpD [Burkholderia mallei ATCC 23344]
 gi|121601016|ref|YP_992653.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei SAVP1]
 gi|124386085|ref|YP_001026550.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei NCTC 10229]
 gi|126451856|ref|YP_001065814.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1106a]
 gi|134282708|ref|ZP_01769411.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 305]
 gi|167719095|ref|ZP_02402331.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei DM98]
 gi|167738093|ref|ZP_02410867.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 14]
 gi|167815280|ref|ZP_02446960.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 91]
 gi|167823685|ref|ZP_02455156.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 9]
 gi|167845231|ref|ZP_02470739.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei B7210]
 gi|167893780|ref|ZP_02481182.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 7894]
 gi|167902232|ref|ZP_02489437.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei NCTC 13177]
 gi|167910474|ref|ZP_02497565.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 112]
 gi|167918499|ref|ZP_02505590.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei BCC215]
 gi|217423577|ref|ZP_03455078.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 576]
 gi|226196151|ref|ZP_03791736.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei Pakistan 9]
 gi|237811809|ref|YP_002896260.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           MSHR346]
 gi|242314503|ref|ZP_04813519.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1106b]
 gi|254178139|ref|ZP_04884794.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei ATCC 10399]
 gi|254188402|ref|ZP_04894913.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254197462|ref|ZP_04903884.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei S13]
 gi|254199478|ref|ZP_04905844.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei FMH]
 gi|254205792|ref|ZP_04912144.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei JHU]
 gi|254298012|ref|ZP_04965465.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 406e]
 gi|254358808|ref|ZP_04975081.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei 2002721280]
 gi|52428934|gb|AAU49527.1| lipoprotein NlpD, putative [Burkholderia mallei ATCC 23344]
 gi|121229826|gb|ABM52344.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei SAVP1]
 gi|126225498|gb|ABN89038.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1106a]
 gi|134245794|gb|EBA45885.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 305]
 gi|147749074|gb|EDK56148.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei FMH]
 gi|147753235|gb|EDK60300.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei JHU]
 gi|148027935|gb|EDK85956.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei 2002721280]
 gi|157807957|gb|EDO85127.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 406e]
 gi|157936081|gb|EDO91751.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160699178|gb|EDP89148.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei ATCC 10399]
 gi|169654203|gb|EDS86896.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei S13]
 gi|217393435|gb|EEC33456.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 576]
 gi|225931737|gb|EEH27739.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei Pakistan 9]
 gi|237506704|gb|ACQ99022.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           MSHR346]
 gi|242137742|gb|EES24144.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1106b]
          Length = 233

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++HD   +T Y+H     V++GQ V++G  I   G + N     
Sbjct: 154 VVYAGNGLRGYGNLLIVKHDADFLTTYAHNRALLVKEGQTVAQGQKIAEMGDTDN-DRVA 212

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 213 LHFELRYGGRSIDPARYLPSR 233


>gi|325277036|ref|ZP_08142697.1| peptidase M23B [Pseudomonas sp. TJI-51]
 gi|324097833|gb|EGB96018.1| peptidase M23B [Pseudomonas sp. TJI-51]
          Length = 138

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 59  VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTGT-DRVK 117

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 118 LHFEIRRQGKPVDPLQFLPRR 138


>gi|312883941|ref|ZP_07743658.1| hypothetical protein VIBC2010_01623 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368399|gb|EFP95934.1| hypothetical protein VIBC2010_01623 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 304

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+D+ ++ Y+H D   V +GQ V  G  I   G SG +   +
Sbjct: 227 VVYSGNALRGYGNLVIIKHNDNYLSAYAHNDRLLVHEGQSVKAGQKIATMGSSGTSS-VR 285

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 286 LHFEIRYQGKSVNPKRYL 303


>gi|251800214|ref|YP_003014945.1| peptidase M23 [Paenibacillus sp. JDR-2]
 gi|247547840|gb|ACT04859.1| Peptidase M23 [Paenibacillus sp. JDR-2]
          Length = 518

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 43/67 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I++ H +   T+Y H+ +  V+KGQ V +G ++G+ G +G +    +HFE+ KN + 
Sbjct: 452 GNCIIVNHKNGYKTLYGHLKSIGVKKGQIVEKGDSLGIMGSTGESTGVHLHFEITKNGVL 511

Query: 73  MDPIKFL 79
            +P+K+L
Sbjct: 512 QNPLKYL 518


>gi|254259037|ref|ZP_04950091.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1710a]
 gi|254217726|gb|EET07110.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1710a]
          Length = 232

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++HD   +T Y+H     V++GQ V++G  I   G + N     
Sbjct: 153 VVYAGNGLRGYGNLLIVKHDADFLTTYAHNRALLVKEGQTVAQGQKIAEMGDTDN-DRVA 211

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 212 LHFELRYGGRSIDPARYLPSR 232


>gi|119962355|ref|YP_946807.1| M23 peptidase domain-containing protein [Arthrobacter aurescens
           TC1]
 gi|119949214|gb|ABM08125.1| M23 peptidase domain protein [Arthrobacter aurescens TC1]
          Length = 278

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 43/67 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H + + T Y+H+ +  VQ GQ V+RG T+ LSG +G +    +HFE++ N   
Sbjct: 212 GNRVVVDHGNGLETTYNHLSSFTVQVGQTVNRGDTVALSGTTGASTGCHLHFEVQVNGEV 271

Query: 73  MDPIKFL 79
           +DP+ +L
Sbjct: 272 VDPMGWL 278


>gi|86146342|ref|ZP_01064666.1| membrane protein [Vibrio sp. MED222]
 gi|85835821|gb|EAQ53955.1| membrane protein [Vibrio sp. MED222]
          Length = 304

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A   +
Sbjct: 227 VVYSGNALRGYGNLVIVKHNDNYLSAYAHNDRLLVSEGQSVKPGQKIATMGSSG-ASSVR 285

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 286 LHFEIRYQGKSVNPKRYL 303


>gi|222528232|ref|YP_002572114.1| peptidase M23 [Caldicellulosiruptor bescii DSM 6725]
 gi|222455079|gb|ACM59341.1| Peptidase M23 [Caldicellulosiruptor bescii DSM 6725]
          Length = 582

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+I H +   T Y H+    V  GQKV++G  I  SG +G +  P +HFE+RKN + 
Sbjct: 515 GKLIIINHQNGYKTYYGHLSRFLVSPGQKVAKGQLIAKSGSTGRSTGPHLHFEVRKNGVP 574

Query: 73  MDPIKFL 79
            +P+ +L
Sbjct: 575 QNPLVYL 581


>gi|306820490|ref|ZP_07454124.1| peptidase M23B [Eubacterium yurii subsp. margaretiae ATCC 43715]
 gi|304551476|gb|EFM39433.1| peptidase M23B [Eubacterium yurii subsp. margaretiae ATCC 43715]
          Length = 373

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G      GN ++I H   IVT+Y H  +  VQ GQ V RG  +   G +G +  P 
Sbjct: 294 VIYAGPKGT-YGNAVMIDHGAGIVTLYGHCSSVAVQVGQIVKRGELVAYMGSTGRSTGPH 352

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N   +DP+ +L
Sbjct: 353 LHFEVRLNGEFVDPMPYL 370


>gi|163802976|ref|ZP_02196863.1| lipoprotein NlpD [Vibrio sp. AND4]
 gi|159173266|gb|EDP58094.1| lipoprotein NlpD [Vibrio sp. AND4]
          Length = 307

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG ++  +
Sbjct: 230 IVYSGNALRGYGNLIIVKHNDNYLSAYAHNDRLLVSEGQSVKSGQKIATMGSSG-SKSVK 288

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 289 LHFEIRYQGKSVNPKRYL 306


>gi|126667565|ref|ZP_01738535.1| Membrane protein [Marinobacter sp. ELB17]
 gi|126627991|gb|EAZ98618.1| Membrane protein [Marinobacter sp. ELB17]
          Length = 268

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L+  GN +++ H +  ++ Y H     V++G+ V  G  I   G SG A+ P 
Sbjct: 189 VVYAGSGLLGYGNLVIVNHSEQYLSAYGHNRKILVKEGENVQAGQIIAELGSSG-AERPM 247

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN   ++P  +L  +
Sbjct: 248 LHFEIRKNGNPVNPAYYLPAR 268


>gi|332652692|ref|ZP_08418437.1| peptidase, M23/M37 family [Ruminococcaceae bacterium D16]
 gi|332517838|gb|EGJ47441.1| peptidase, M23/M37 family [Ruminococcaceae bacterium D16]
          Length = 415

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H D   T+Y+H+    V KGQ VS+G  +G  G +G++    +HFE+R N   
Sbjct: 332 GNYVVVSHSDGTSTLYAHMSRRGVSKGQTVSQGQVVGYVGTTGSSTGNHLHFEIRVNGSR 391

Query: 73  MDPIKFL 79
           +DP+ + 
Sbjct: 392 VDPVNYF 398


>gi|320010066|gb|ADW04916.1| Peptidase M23 [Streptomyces flavogriseus ATCC 33331]
          Length = 240

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 3/79 (3%)

Query: 6   GNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFE 65
           G D    GN I+I+H +   + Y+H+    V+ G +V  G  IGLSG +GN+  P +HFE
Sbjct: 157 GGDGPAYGNAIVIKHANGKYSQYAHLSKIDVKIGDRVKTGEKIGLSGNTGNSSGPHLHFE 216

Query: 66  LRKNA---IAMDPIKFLEE 81
           +R  A    A++P+ +L  
Sbjct: 217 IRTTANYGSAINPVSYLNS 235


>gi|254420013|ref|ZP_05033737.1| M23 peptidase domain protein [Brevundimonas sp. BAL3]
 gi|196186190|gb|EDX81166.1| M23 peptidase domain protein [Brevundimonas sp. BAL3]
          Length = 211

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 43/78 (55%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++  G D    GN I +RH + + TVY H+    V  G  V+ G  IGL G +G +  P 
Sbjct: 122 IVRTGYDAGGYGNFIEVRHPNGLSTVYGHLSRIDVASGDAVTPGQRIGLVGSTGYSTGPH 181

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P K +
Sbjct: 182 LHFEVRRNGGQVNPTKVM 199


>gi|84390121|ref|ZP_00991383.1| lipoprotein NlpD [Vibrio splendidus 12B01]
 gi|84376775|gb|EAP93650.1| lipoprotein NlpD [Vibrio splendidus 12B01]
          Length = 304

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A   +
Sbjct: 227 VVYSGNALRGYGNLVIVKHNDNYLSAYAHNDRLLVSEGQSVKPGQKIATMGSSG-ASSVR 285

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 286 LHFEIRYQGKSVNPKRYL 303


>gi|255066230|ref|ZP_05318085.1| peptidase M23B [Neisseria sicca ATCC 29256]
 gi|255049440|gb|EET44904.1| peptidase M23B [Neisseria sicca ATCC 29256]
          Length = 306

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S ++ Y H     V +GQ+V RG TI   G + +A   Q
Sbjct: 228 VVYAGSGLRGYGNLVIIQHNSSYLSAYGHNQRLLVNEGQQVKRGQTIANMGNT-DASRTQ 286

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 287 LHFEVRQNGKPVNPANYV 304


>gi|94987362|ref|YP_595295.1| membrane proteins related to metalloendopeptidases [Lawsonia
           intracellularis PHE/MN1-00]
 gi|94731611|emb|CAJ54974.1| membrane proteins related to metalloendopeptidases [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 299

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G D    GN ++++H   + + Y+H+ T  V+ GQ V RG  IG  G +G +  P 
Sbjct: 221 VILAGCDGA-YGNCVVLQHGSGLTSRYAHMSTVDVKVGQNVRRGQIIGYVGSTGRSSGPH 279

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E++ N + +DP++++
Sbjct: 280 LHYEVKVNGMNVDPLRYI 297


>gi|239983378|ref|ZP_04705902.1| secreted peptidase [Streptomyces albus J1074]
 gi|291455202|ref|ZP_06594592.1| secreted peptidase [Streptomyces albus J1074]
 gi|291358151|gb|EFE85053.1| secreted peptidase [Streptomyces albus J1074]
          Length = 315

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN ++I+H D   + Y+H+ +  V  GQ V+ G  IGLSG +GN+  P +HFE+R     
Sbjct: 239 GNEVVIKHADGKYSQYAHLSSLSVSSGQTVTPGQQIGLSGSTGNSTGPHLHFEVRTGPSY 298

Query: 70  AIAMDPIKFL 79
              +DP+ +L
Sbjct: 299 GSDIDPLAYL 308


>gi|241764487|ref|ZP_04762508.1| Peptidase M23 [Acidovorax delafieldii 2AN]
 gi|241366071|gb|EER60668.1| Peptidase M23 [Acidovorax delafieldii 2AN]
          Length = 303

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN ++++H+++ +T Y+H  T  V++ Q V RG  I   G S ++   +
Sbjct: 224 VVYAGAGLRGYGNLVILKHNNTFLTAYAHNQTLLVKEDQSVRRGQKIAEMG-STDSDRVK 282

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 283 LHFEIRRQGKPVDPVRYLPAR 303


>gi|328883268|emb|CCA56507.1| putative peptidase [Streptomyces venezuelae ATCC 10712]
          Length = 233

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 6   GNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFE 65
           G D    GN I+++H +   + Y+H+    V  GQKV  G  I LSG +GN+  P +HFE
Sbjct: 150 GGDGPAYGNAIVVKHANGTYSQYAHLSKIKVHIGQKVMAGQQIALSGNTGNSSGPHLHFE 209

Query: 66  LRKN---AIAMDPIKFLEE 81
           +R       A++P  FL  
Sbjct: 210 IRTTPNYGSAVNPAAFLRS 228


>gi|83719959|ref|YP_443265.1| lipoprotein NlpD [Burkholderia thailandensis E264]
 gi|83653784|gb|ABC37847.1| lipoprotein NlpD, putative [Burkholderia thailandensis E264]
          Length = 295

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+   +T Y+H  T   ++GQ V++G  I   G + N     
Sbjct: 216 VVYAGNGLRGYGNLLIIKHNADFLTTYAHNRTLLAKEGQTVAQGQKIAEMGDTDN-DRVA 274

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 275 LHFELRYGGRSIDPARYLPSR 295


>gi|325663476|ref|ZP_08151886.1| hypothetical protein HMPREF0490_02627 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325470375|gb|EGC73606.1| hypothetical protein HMPREF0490_02627 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 380

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 44/78 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
            + + N     GN ++I+HD+ +V+ Y H     V  GQ+V +G  IG  G +G +  P 
Sbjct: 303 TVLIANYSTSAGNWVVIQHDNGLVSKYMHHSALTVSAGQRVEKGQQIGYVGSTGQSTGPH 362

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++  N +A++P  ++
Sbjct: 363 LHFQVELNGVAVNPSNYM 380


>gi|157961020|ref|YP_001501054.1| peptidase M23B [Shewanella pealeana ATCC 700345]
 gi|157846020|gb|ABV86519.1| peptidase M23B [Shewanella pealeana ATCC 700345]
          Length = 296

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q VS G T+   G +G      
Sbjct: 217 VVYAGSALRGYGNLVIIKHSDDYLSAYAHADKISVKEKQLVSVGQTVATMGSTG-TNRVM 275

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+KFL ++
Sbjct: 276 LHFEIRYHGKSVNPVKFLPKQ 296


>gi|33595757|ref|NP_883400.1| putative lipoprotein [Bordetella parapertussis 12822]
 gi|33565836|emb|CAE36382.1| putative lipoprotein [Bordetella parapertussis]
          Length = 195

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y  N L   GN +++RHD S +T+Y+H     V++GQ+VS+G  I   G + ++Q   
Sbjct: 116 VAYASNGLRGYGNLVIVRHDGSFLTIYAHNRKLLVKQGQRVSQGQRIAEMGDTDSSQV-N 174

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           ++FELR++  A++P   L  +
Sbjct: 175 LYFELRRDGKAVNPAGALPRR 195


>gi|307824680|ref|ZP_07654904.1| Peptidase M23 [Methylobacter tundripaludum SV96]
 gi|307734334|gb|EFO05187.1| Peptidase M23 [Methylobacter tundripaludum SV96]
          Length = 297

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L+  GN ++I+H+D  ++ Y++     V +G  V +G  I   G++G +    
Sbjct: 218 VVYSGQGLIGYGNLLIIKHNDLYLSAYANNSRLLVAEGYTVEKGEVIAKVGQAG-SNKTS 276

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN   ++P+ FL EK
Sbjct: 277 LHFEIRKNGKPVNPLSFLPEK 297


>gi|307266014|ref|ZP_07547561.1| Peptidase M23 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326389768|ref|ZP_08211333.1| Peptidase M23 [Thermoanaerobacter ethanolicus JW 200]
 gi|306918976|gb|EFN49203.1| Peptidase M23 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325994250|gb|EGD52677.1| Peptidase M23 [Thermoanaerobacter ethanolicus JW 200]
          Length = 389

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 40/65 (61%)

Query: 16  ILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDP 75
           ++I H D I T+Y H     V++G  V RG  I  +G +G +  P +HFE+RKN + +DP
Sbjct: 325 VIIDHGDGISTLYGHNSALLVKEGDMVKRGQVIAKAGSTGLSTGPHLHFEVRKNGVPVDP 384

Query: 76  IKFLE 80
           + +L+
Sbjct: 385 MDWLK 389


>gi|27367974|ref|NP_763501.1| cell wall endopeptidase [Vibrio vulnificus CMCP6]
 gi|37676104|ref|NP_936500.1| membrane protein [Vibrio vulnificus YJ016]
 gi|320158246|ref|YP_004190624.1| cell wall endopeptidase, family M23/M37 [Vibrio vulnificus
           MO6-24/O]
 gi|27359547|gb|AAO08491.1| Cell wall endopeptidase, family M23/M37 [Vibrio vulnificus CMCP6]
 gi|37200645|dbj|BAC96470.1| membrane protein [Vibrio vulnificus YJ016]
 gi|319933558|gb|ADV88421.1| cell wall endopeptidase, family M23/M37 [Vibrio vulnificus
           MO6-24/O]
          Length = 429

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I++ H     T Y H+    V KGQKVSRG  IGLSGK+G    P +H+EL ++   
Sbjct: 329 GNYIVVEHGSKYKTRYLHLSKVLVTKGQKVSRGQRIGLSGKTGRVTGPHLHYELLEHN-- 386

Query: 73  MDPIKFLEEKIP 84
             P+  ++ KIP
Sbjct: 387 -RPVDAMKAKIP 397


>gi|167646074|ref|YP_001683737.1| peptidase M23B [Caulobacter sp. K31]
 gi|167348504|gb|ABZ71239.1| peptidase M23B [Caulobacter sp. K31]
          Length = 362

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 9/83 (10%)

Query: 2   VIYVGNDLVE-------LGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSG 52
           V+  G+ +VE        G  IL+RH D   T+Y H+    P  + G +V +G  IG +G
Sbjct: 230 VLAAGDGVVEAVGWDGGYGRRILLRHADGYETLYGHLSAAGPAAEVGARVRQGQVIGWTG 289

Query: 53  KSGNAQHPQVHFELRKNAIAMDP 75
            SG A  P +HFE+R + +A+DP
Sbjct: 290 VSGQATGPHLHFEVRLHRVAVDP 312


>gi|291514085|emb|CBK63295.1| Membrane proteins related to metalloendopeptidases [Alistipes
           shahii WAL 8301]
          Length = 399

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 39/70 (55%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++IRHD+ + T Y H+    V+  Q V  G  IGL G +G +  P +HFE R    +
Sbjct: 238 GNLVIIRHDNGLETYYGHLSERLVEPDQWVEAGQIIGLGGSTGRSTGPHLHFETRYYGQS 297

Query: 73  MDPIKFLEEK 82
            DP + ++ K
Sbjct: 298 FDPERLIDFK 307


>gi|302383728|ref|YP_003819551.1| peptidase M23 [Brevundimonas subvibrioides ATCC 15264]
 gi|302194356|gb|ADL01928.1| Peptidase M23 [Brevundimonas subvibrioides ATCC 15264]
          Length = 366

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V YVG+DLV  G T+LI H D   TVY H+ +  V  G  V  G  IG  G +     P 
Sbjct: 283 VAYVGDDLVGQGLTVLIVHRDGWRTVYGHLGSATVDDGADVRAGQQIGTVGLTAGDGRPS 342

Query: 62  VHFELRK----NAIAMDPIKFL 79
           +H+E R+      +A+DP+  L
Sbjct: 343 IHYETRRMQGDEPVAIDPLTVL 364


>gi|225619315|ref|YP_002720541.1| peptidase [Brachyspira hyodysenteriae WA1]
 gi|225214134|gb|ACN82868.1| peptidase [Brachyspira hyodysenteriae WA1]
          Length = 394

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ V  +L   GN ++I H + + + Y H+     ++GQ V +G  IGL G +G +  P 
Sbjct: 302 VVRVSRELFVRGNCVVIDHGEGVYSSYFHMSKLIAKEGQYVKKGEVIGLIGSTGMSTGPH 361

Query: 62  VHFELRKNAIAMDPIKFLEEKI 83
            H+E+R   +  DP+  LE+ +
Sbjct: 362 CHWEMRAGNMTFDPLSILEKPV 383


>gi|254428989|ref|ZP_05042696.1| M23 peptidase domain protein [Alcanivorax sp. DG881]
 gi|196195158|gb|EDX90117.1| M23 peptidase domain protein [Alcanivorax sp. DG881]
          Length = 259

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H +  ++ Y+H D   V++G  V  G  +   G SG  +  Q
Sbjct: 180 VVYRGSGLTGYGNLLIIKHSERWLSAYAHNDKMMVKEGDTVKGGQQVATMGASGTFR-TQ 238

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK+   +DP+ +L ++
Sbjct: 239 LHFEIRKDGKPVDPMGYLPKR 259


>gi|119897380|ref|YP_932593.1| lipoprotein [Azoarcus sp. BH72]
 gi|119669793|emb|CAL93706.1| conserved hypothetical lipoprotein [Azoarcus sp. BH72]
          Length = 302

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H+    +VY+H     V++  +VS+G  I   G S +A  P+
Sbjct: 223 VVYAGSGLRGYGKLVIIKHNQEYNSVYAHNQKLLVKEDDQVSQGQKIAELG-STDADRPK 281

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK    +DP+KFL  +
Sbjct: 282 LHFEIRKQGRPVDPMKFLSAR 302


>gi|188586803|ref|YP_001918348.1| Peptidase M23 [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179351490|gb|ACB85760.1| Peptidase M23 [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 412

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 44/67 (65%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  +++ H     T Y+H+++  V +G++VSRG  +GL G +G++  P +HFE+RKN   
Sbjct: 345 GRIVIVDHGGGYSTWYAHLNSILVSEGEEVSRGQPVGLIGSTGSSTGPHLHFEVRKNDNP 404

Query: 73  MDPIKFL 79
            +P+++L
Sbjct: 405 QNPLEYL 411


>gi|167587438|ref|ZP_02379826.1| peptidase M23B [Burkholderia ubonensis Bu]
          Length = 233

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y GN L   GN I+++H+   +T Y+H     V++GQ V++G TI   G + ++   
Sbjct: 153 VVVYAGNGLRGYGNLIILKHNADYLTAYAHNRALLVKEGQSVTQGQTIAEMGNT-DSDRV 211

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFELR    ++DP ++L  +
Sbjct: 212 ALHFELRYGGRSIDPSRYLPAR 233


>gi|218710551|ref|YP_002418172.1| membrane protein [Vibrio splendidus LGP32]
 gi|218323570|emb|CAV19795.1| Membrane protein [Vibrio splendidus LGP32]
          Length = 309

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A   +
Sbjct: 232 VVYSGNALRGYGNLVIVKHNDNYLSAYAHNDRLLVSEGQSVKPGQKIATMGSSG-ASSVR 290

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 291 LHFEIRYQGKSVNPKRYL 308


>gi|300312264|ref|YP_003776356.1| NlpD precursor lipoprotein [Herbaspirillum seropedicae SmR1]
 gi|300075049|gb|ADJ64448.1| NlpD precursor lipoprotein [Herbaspirillum seropedicae SmR1]
          Length = 332

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 50/78 (64%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ +   GN ++I+H  ++++ Y+H  T  V++GQ V++G  I   GKS ++   +
Sbjct: 253 VMYAGSGIRGYGNLVIIKHTSNLLSAYAHNQTILVKEGQSVTKGQKIAEMGKS-DSDTVK 311

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP K+L
Sbjct: 312 LHFEIRQQGKPVDPSKYL 329


>gi|33946400|gb|AAQ55815.1| lipoprotein [Pseudomonas syringae]
          Length = 152

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 73  VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKVGQTIAEMGSTGT-DRVK 131

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 132 LHFEIRRQGKPVDPLQFLPRR 152


>gi|86142095|ref|ZP_01060619.1| putative peptidase [Leeuwenhoekiella blandensis MED217]
 gi|85831658|gb|EAQ50114.1| putative peptidase [Leeuwenhoekiella blandensis MED217]
          Length = 325

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%)

Query: 7   NDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFEL 66
           N+    GN I I H    V++Y+H+    V++GQKV RG  IG  G +G ++ P VH+E+
Sbjct: 229 NNATGYGNHIRIDHGYGYVSLYAHLYKYNVRRGQKVQRGDLIGFVGSTGRSEAPHVHYEI 288

Query: 67  RKNAIAMDPIKF 78
            K+   ++PI F
Sbjct: 289 FKDGQRINPINF 300


>gi|319410723|emb|CBY91105.1| putative metallopeptidase [Neisseria meningitidis WUE 2594]
          Length = 415

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G +  A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-EASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|6175877|gb|AAF05318.1|AF178851_1 lipoprotein [Pseudomonas putida]
          Length = 97

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2  VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
          V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 18 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTGT-DRVK 76

Query: 62 VHFELRKNAIAMDPIKFLEEK 82
          +HFE+R+    +DP++FL  +
Sbjct: 77 LHFEIRRQGKPVDPLQFLPRR 97


>gi|331087008|ref|ZP_08336083.1| hypothetical protein HMPREF0987_02386 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330409458|gb|EGG88901.1| hypothetical protein HMPREF0987_02386 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 402

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 44/77 (57%)

Query: 3   IYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQV 62
           + + N     GN ++I+HD+ +V+ Y H     V  GQ+V +G  IG  G +G +  P +
Sbjct: 326 VLIANYSTSAGNWVVIQHDNGLVSKYMHHSALTVSAGQRVEKGQQIGYVGSTGQSTGPHL 385

Query: 63  HFELRKNAIAMDPIKFL 79
           HF++  N +A++P  ++
Sbjct: 386 HFQVELNGVAVNPSNYM 402


>gi|1352504|sp|P47764|NLPD_YEREN RecName: Full=Lipoprotein nlpD
 gi|687582|gb|AAC43390.1| NlpD [Yersinia enterocolitica]
          Length = 97

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2  VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
          V+Y GN L   GN I+I+H+D  ++ Y H DT  V++ ++V  G  I   G +G +   +
Sbjct: 18 VVYAGNALGGYGNLIIIKHNDDYLSAYVHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 76

Query: 62 VHFELRKNAIAMDPIKFLEEK 82
          +HFE+R    +++P+++L ++
Sbjct: 77 LHFEIRYKGKSVNPLRYLPQR 97


>gi|296125073|ref|YP_003632325.1| peptidase M23 [Brachyspira murdochii DSM 12563]
 gi|296016889|gb|ADG70126.1| Peptidase M23 [Brachyspira murdochii DSM 12563]
          Length = 395

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ V  +L   GN ++I H + + + Y H+     ++GQ V +G  IGL G +G +  P 
Sbjct: 303 VVRVSRELFVRGNCVVIDHGEGVYSSYFHMSKLIAKEGQYVKKGEVIGLIGSTGMSTGPH 362

Query: 62  VHFELRKNAIAMDPIKFLEEKI 83
            H+E+R   +  DP+  LE+ +
Sbjct: 363 CHWEMRAGNMTFDPLSILEKPV 384


>gi|167987242|gb|ACA13291.1| NlpD [Listonella anguillarum]
          Length = 301

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+D+ ++ Y+H D   V++GQ V  G  I   G SG +   +
Sbjct: 224 VVYSGNALRGYGNLVIVKHNDNYLSAYAHNDRLLVKEGQSVKAGQKIATMGSSGTSSV-R 282

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 283 LHFEIRYQGKSVNPKRYL 300


>gi|218768475|ref|YP_002342987.1| putative membrane peptidase [Neisseria meningitidis Z2491]
 gi|121052483|emb|CAM08822.1| putative membrane peptidase [Neisseria meningitidis Z2491]
          Length = 415

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G +  A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-EASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|124009944|ref|ZP_01694609.1| M23/M37 peptidase [Microscilla marina ATCC 23134]
 gi|123984028|gb|EAY24406.1| M23/M37 peptidase [Microscilla marina ATCC 23134]
          Length = 326

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GNT+ I H  + VT Y+H+ +  V+ G+KV RG  IG  G +G +  P VH+E+ KN   
Sbjct: 236 GNTVDIDHGYNYVTRYAHMASFKVRPGEKVKRGQCIGYVGSTGFSTAPHVHYEVLKNNKQ 295

Query: 73  MDPIKFL 79
           +DP+ F 
Sbjct: 296 IDPVYFF 302


>gi|239946670|ref|ZP_04698423.1| periplasmic protein [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239920946|gb|EER20970.1| periplasmic protein [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 363

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 43/69 (62%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           + GN + I+H   +VT Y+H+    V++G K+ RG  IG+ G++GNA    +HFE+  + 
Sbjct: 289 DYGNFVEIKHGRKLVTKYAHLKEMSVKEGNKIKRGQFIGIQGRTGNATGEHLHFEILLDN 348

Query: 71  IAMDPIKFL 79
            A++P  F+
Sbjct: 349 KAINPFDFI 357


>gi|120404667|ref|YP_954496.1| peptidase M23B [Mycobacterium vanbaalenii PYR-1]
 gi|119957485|gb|ABM14490.1| peptidase M23B [Mycobacterium vanbaalenii PYR-1]
          Length = 340

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            G  + IR  D  VT+Y HIDT  VQ GQ+V  G  I   G  GN+  P +HFE+  N  
Sbjct: 264 FGMWVKIRAADGTVTLYGHIDTTNVQTGQRVMAGDQIATMGNRGNSTGPHLHFEVHLNGT 323

Query: 72  -AMDPIKFLEEK-IP 84
             +DP+ +L E+ IP
Sbjct: 324 DKIDPMAWLGERGIP 338


>gi|330504212|ref|YP_004381081.1| peptidase M23B [Pseudomonas mendocina NK-01]
 gi|328918498|gb|AEB59329.1| peptidase M23B [Pseudomonas mendocina NK-01]
          Length = 253

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G A   +
Sbjct: 174 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-ADRVK 232

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 233 LHFEIRRQGKPVDPLQYLPRR 253


>gi|291541639|emb|CBL14749.1| Membrane-bound metallopeptidase [Ruminococcus bromii L2-63]
          Length = 438

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 14  NTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAM 73
           N ++I H    +TVY H+ +  V  GQ VSRG  IG  G +GN+  P +H+E R N +  
Sbjct: 370 NYVMISHAGGKMTVYGHLTSLTVSSGQSVSRGQVIGYVGSTGNSTGPHLHYECRLNGVRY 429

Query: 74  DPI 76
           +P+
Sbjct: 430 NPM 432


>gi|166712466|ref|ZP_02243673.1| lipoprotein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 252

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 172 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 230

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 231 MLHFEIRYNGKPVDPLLYLPKK 252


>gi|251793633|ref|YP_003008363.1| outer membrane antigenic lipoprotein B [Aggregatibacter aphrophilus
           NJ8700]
 gi|247535030|gb|ACS98276.1| outer membrane antigenic lipoprotein B [Aggregatibacter aphrophilus
           NJ8700]
          Length = 402

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V+  Q+V  G  I   G +G     +
Sbjct: 323 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDSILVKDQQEVKAGQQIAKMGSTG-TNGVK 381

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  +
Sbjct: 382 LHFEIRYKGKSVDPTRYLPRR 402


>gi|237739939|ref|ZP_04570420.1| cell wall endopeptidase [Fusobacterium sp. 2_1_31]
 gi|229421956|gb|EEO37003.1| cell wall endopeptidase [Fusobacterium sp. 2_1_31]
          Length = 249

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRHD+   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 171 VVTFAGN-MSGYGKIIIIRHDNGYETRYAHLSVISTNVGEHVNQGDLIGKTGNSGRTTGA 229

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R+N +  +P+K+L 
Sbjct: 230 HLHFEIRQNGVPKNPMKYLR 249


>gi|118595112|ref|ZP_01552459.1| lipoprotein NlpD, putative [Methylophilales bacterium HTCC2181]
 gi|118440890|gb|EAV47517.1| lipoprotein NlpD, putative [Methylophilales bacterium HTCC2181]
          Length = 289

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 51/80 (63%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G DL   G  I+I+HD+ +++VY H +  +V++GQ V     IG  G++G     +
Sbjct: 211 VIYAGEDLKGYGRLIIIKHDNDLLSVYGHNEEIFVREGQTVEALEAIGTMGRTG-TDRVK 269

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           ++FE+RK   +++P+ ++++
Sbjct: 270 LYFEIRKGGQSVNPLLYIKK 289


>gi|294668379|ref|ZP_06733482.1| hypothetical protein NEIELOOT_00291 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291309697|gb|EFE50940.1| hypothetical protein NEIELOOT_00291 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 200

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 1/74 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN +   GN ILI H+   +T Y+H D   V+KGQ V  G TI   G S +A   +
Sbjct: 92  IMYAGNGVRGYGNLILISHNPGTLTAYAHNDKLLVKKGQTVRAGDTIATMGSS-DADRVK 150

Query: 62  VHFELRKNAIAMDP 75
           +HFE+R N  A++P
Sbjct: 151 LHFEVRINGKAVNP 164


>gi|332876595|ref|ZP_08444355.1| peptidase, M23 family [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332685428|gb|EGJ58265.1| peptidase, M23 family [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 410

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + +RH+++  T Y H+     +KGQ V++G  IGL G +G A  P V +   KN + 
Sbjct: 311 GNYVKVRHNNTYTTQYLHMSRIIARKGQHVAQGEVIGLVGSTGLATGPHVCYRFWKNGVQ 370

Query: 73  MDPIKFLEEKIP 84
           +DP+K   EK+P
Sbjct: 371 VDPLK---EKLP 379


>gi|323701464|ref|ZP_08113137.1| Peptidase M23 [Desulfotomaculum nigrificans DSM 574]
 gi|323533473|gb|EGB23339.1| Peptidase M23 [Desulfotomaculum nigrificans DSM 574]
          Length = 376

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G+ +   GN ++I H   +V++Y H+    V  GQ V++G  I L G +G +    
Sbjct: 300 VIYSGS-MTGYGNVVMIDHGGGVVSLYGHLSAKLVSNGQTVTKGMPIALVGNTGMSTGSH 358

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RKN   + P  +L
Sbjct: 359 LHFEVRKNGTPVSPYGYL 376


>gi|167623163|ref|YP_001673457.1| peptidase M23B [Shewanella halifaxensis HAW-EB4]
 gi|167353185|gb|ABZ75798.1| peptidase M23B [Shewanella halifaxensis HAW-EB4]
          Length = 297

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q V+ G T+   G +G      
Sbjct: 218 VVYAGSALRGYGNLVIIKHSDDYLSAYAHADKILVKEKQAVNVGQTVATMGSTG-TNRVM 276

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+KFL ++
Sbjct: 277 LHFEIRYHGKSVNPVKFLPKQ 297


>gi|168031336|ref|XP_001768177.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162680615|gb|EDQ67050.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 521

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I+H+   VT Y+H    + + GQ+V +G  +   G +G A  P +HFE+RKN  A
Sbjct: 453 GYLVAIQHEGGFVTRYAHCCAIHSRIGQQVLKGQQVAAVGATGRATGPHLHFEVRKNGEA 512

Query: 73  MDPIKFL 79
           +DP+K++
Sbjct: 513 LDPLKWV 519


>gi|290955832|ref|YP_003487014.1| peptidase [Streptomyces scabiei 87.22]
 gi|260645358|emb|CBG68444.1| putative secreted peptidase [Streptomyces scabiei 87.22]
          Length = 335

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN ++IR  D     Y+H+ +  V  GQ VS G  IGLSG +GN   P +HFE+R     
Sbjct: 259 GNQVVIRLADGYYAQYAHLSSISVSAGQSVSGGQQIGLSGATGNVTGPHLHFEIRTTPSY 318

Query: 70  AIAMDPIKFLEEK 82
              +DP+ +L  K
Sbjct: 319 GSDLDPLAYLRSK 331


>gi|148978208|ref|ZP_01814738.1| lipoprotein NlpD [Vibrionales bacterium SWAT-3]
 gi|145962630|gb|EDK27906.1| lipoprotein NlpD [Vibrionales bacterium SWAT-3]
          Length = 304

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A   +
Sbjct: 227 VVYSGNALRGYGNLVIVKHNDNYLSAYAHNDRLLVSEGQSVKPGQKIATMGSSG-ASSVR 285

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 286 LHFEIRYQGKSVNPKRYL 303


>gi|68249280|ref|YP_248392.1| lipoprotein [Haemophilus influenzae 86-028NP]
 gi|68057479|gb|AAX87732.1| outer membrane antigenic lipoprotein B [Haemophilus influenzae
           86-028NP]
          Length = 405

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSG-TNTVK 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L ++
Sbjct: 385 LHFEIRYKGKSVDPVRYLPKR 405


>gi|290955736|ref|YP_003486918.1| hypothetical protein SCAB_11801 [Streptomyces scabiei 87.22]
 gi|260645262|emb|CBG68348.1| putative secreted protein [Streptomyces scabiei 87.22]
          Length = 371

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN-- 69
            G  ++IRH D   T Y+H+    V+ GQ VS G  IG SG +GN+  P +HFE+R    
Sbjct: 294 FGYEVVIRHADGRYTQYAHLSAISVKAGQGVSTGQRIGRSGSTGNSSGPHLHFEVRTGPG 353

Query: 70  -AIAMDPIKFL 79
               +DPI +L
Sbjct: 354 FGSDIDPIAYL 364


>gi|145629596|ref|ZP_01785393.1| outer membrane antigenic lipoprotein B [Haemophilus influenzae
           22.1-21]
 gi|144978107|gb|EDJ87880.1| outer membrane antigenic lipoprotein B [Haemophilus influenzae
           22.1-21]
          Length = 405

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q++  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEIKAGQDIAKMGSSG-TNTVK 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L ++
Sbjct: 385 LHFEIRYKGKSVDPVRYLPKR 405


>gi|312898639|ref|ZP_07758029.1| peptidase, M23 family [Megasphaera micronuciformis F0359]
 gi|310620558|gb|EFQ04128.1| peptidase, M23 family [Megasphaera micronuciformis F0359]
          Length = 392

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H + + TVY H  +  V  GQ VS+G  I  SG +GN+  P VHFE+R     
Sbjct: 326 GYAVIIDHGNGLSTVYGHNSSLNVSPGQSVSKGQIIAYSGSTGNSTGPHVHFEVRSGGEP 385

Query: 73  MDPIKFL 79
           +DP+ +L
Sbjct: 386 VDPMGYL 392


>gi|222110295|ref|YP_002552559.1| peptidase m23 [Acidovorax ebreus TPSY]
 gi|221729739|gb|ACM32559.1| Peptidase M23 [Acidovorax ebreus TPSY]
          Length = 303

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN ++++H+++ +T Y+H  T  V++ Q V RG  I   G S +A   +
Sbjct: 224 VVYAGAGLRGYGNLVILKHNNTYLTAYAHNQTLLVKEDQNVRRGQKIAEMG-STDADRVK 282

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 283 LHFEIRRQGKPVDPARYLPSR 303


>gi|193214951|ref|YP_001996150.1| peptidase M23 [Chloroherpeton thalassium ATCC 35110]
 gi|193088428|gb|ACF13703.1| Peptidase M23 [Chloroherpeton thalassium ATCC 35110]
          Length = 304

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H     TVY+H+    V  GQ+V RG  I  SG +G ++ P VH+E+ KN + 
Sbjct: 221 GKLVIIDHGFGYKTVYAHLSEFNVHSGQQVKRGDVIAYSGNTGVSEGPHVHYEVIKNGVK 280

Query: 73  MDPIKFL 79
           M+P+ F+
Sbjct: 281 MNPVNFM 287


>gi|254304071|ref|ZP_04971429.1| M23B subfamily peptidase [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148324263|gb|EDK89513.1| M23B subfamily peptidase [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 372

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRHD+   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 294 VVTFAGN-MSGYGKIIIIRHDNGYETRYAHLSVISTNVGEHVNKGDLIGKTGNSGRTTGA 352

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 353 HLHFEIRHNGVPKNPMKYLQ 372


>gi|225570772|ref|ZP_03779795.1| hypothetical protein CLOHYLEM_06875 [Clostridium hylemonae DSM
           15053]
 gi|225160234|gb|EEG72853.1| hypothetical protein CLOHYLEM_06875 [Clostridium hylemonae DSM
           15053]
          Length = 369

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 41/76 (53%), Gaps = 4/76 (5%)

Query: 4   YVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVH 63
           Y GN     GN I+I H + + T Y H +  YV+ GQ VSRG  I   G +GN+  P +H
Sbjct: 298 YSGN----AGNLIIINHGNGLQTYYMHCNNIYVRAGQTVSRGQNIAAVGTTGNSTGPHLH 353

Query: 64  FELRKNAIAMDPIKFL 79
           F++    I ++P  + 
Sbjct: 354 FQVMSGGIPVNPRNYF 369


>gi|70728588|ref|YP_258337.1| peptidase M23/LysM domain-containing protein [Pseudomonas
           fluorescens Pf-5]
 gi|68342887|gb|AAY90493.1| peptidase M23/LysM domain protein [Pseudomonas fluorescens Pf-5]
          Length = 286

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H+++ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 207 VVYAGSGLRGYGELVIIKHNETYVSAYGHNRKLLVREGQQVKVGQTIAEMGSTG-TDRVK 265

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 266 LHFEIRRQGKPVDPLQFLPRR 286


>gi|302555664|ref|ZP_07308006.1| secreted protein [Streptomyces viridochromogenes DSM 40736]
 gi|302473282|gb|EFL36375.1| secreted protein [Streptomyces viridochromogenes DSM 40736]
          Length = 409

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN-- 69
            G  +++RH D   + Y+H+    V+ GQ VS G  IG SG +GN+  P +HFE+R    
Sbjct: 332 FGYQVVVRHGDGRYSQYAHLSAISVRDGQTVSAGQRIGRSGSTGNSSGPHLHFEVRTGPG 391

Query: 70  -AIAMDPIKFL 79
               +DPI +L
Sbjct: 392 FGTDVDPIAYL 402


>gi|197121213|ref|YP_002133164.1| peptidase M23 [Anaeromyxobacter sp. K]
 gi|196171062|gb|ACG72035.1| Peptidase M23 [Anaeromyxobacter sp. K]
          Length = 294

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G      G  +++RHD  +VT+Y+H     V++G +V RG  I   G++G    P 
Sbjct: 217 VIYAGEQ-AGYGAVVILRHDGGLVTLYAHNSEVLVKEGARVDRGQPIARVGQTGRTTGPH 275

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+     +P+ FL
Sbjct: 276 LHFEVREGTRPRNPLLFL 293


>gi|296284793|ref|ZP_06862791.1| peptidase M23/M37 [Citromicrobium bathyomarinum JL354]
          Length = 396

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 39/68 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H   ++T Y+H+     + GQ+V  G  IG  G +G +  P +HFE+R N  A
Sbjct: 299 GNVVEISHGQGLLTRYAHMSRFEARVGQRVEAGTVIGAIGSTGRSTGPHLHFEVRVNGTA 358

Query: 73  MDPIKFLE 80
           ++P  FLE
Sbjct: 359 VNPRTFLE 366


>gi|288929901|ref|ZP_06423743.1| peptidase, M23/M37 family [Prevotella sp. oral taxon 317 str.
           F0108]
 gi|288328720|gb|EFC67309.1| peptidase, M23/M37 family [Prevotella sp. oral taxon 317 str.
           F0108]
          Length = 229

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+IRHD+ + T+YSH    +V+ GQ V  G  IGL+G++G A    +HFE+      
Sbjct: 121 GNCIVIRHDNGLETLYSHQSRNFVKVGQAVKAGDVIGLTGRTGRATTEHLHFEVSFKGKR 180

Query: 73  MDP 75
           +DP
Sbjct: 181 IDP 183


>gi|239814805|ref|YP_002943715.1| peptidase M23 [Variovorax paradoxus S110]
 gi|239801382|gb|ACS18449.1| Peptidase M23 [Variovorax paradoxus S110]
          Length = 298

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN I+++H+++ +T Y+H  T  V++ Q V +G  I   G S +A   +
Sbjct: 219 VVYAGAGLRGYGNLIILKHNNTYLTAYAHNQTLLVKEDQSVQKGQKIAEMGNS-DADRVK 277

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 278 LHFEIRRQGKPVDPARYLPSR 298


>gi|220934608|ref|YP_002513507.1| Peptidase M23 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995918|gb|ACL72520.1| Peptidase M23 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 265

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ LV  G  I+++HD++ ++ Y+H +   V +G  V+ G  I   G +G    P 
Sbjct: 186 VVYSGSGLVGYGQLIIVKHDENFLSAYAHNEKLLVNEGMDVTGGQQIARLGDTG-TDRPM 244

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R     +DP+++L  +
Sbjct: 245 LHFEIRFEGRPVDPLRYLPRR 265


>gi|253583335|ref|ZP_04860533.1| membrane protein [Fusobacterium varium ATCC 27725]
 gi|251833907|gb|EES62470.1| membrane protein [Fusobacterium varium ATCC 27725]
          Length = 359

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+I+H +   T Y+H+D   V+ GQ V++G  IG +G SG    P +HFE+RKN   
Sbjct: 290 GKIIIIKHSNGYETRYAHLDKIGVKVGQNVNKGELIGKTGMSGRVTGPHLHFEVRKNGKT 349

Query: 73  MDPIKFLEEK 82
            +P+  L  K
Sbjct: 350 ENPMSHLTRK 359


>gi|121593574|ref|YP_985470.1| peptidase M23B [Acidovorax sp. JS42]
 gi|120605654|gb|ABM41394.1| peptidase M23B [Acidovorax sp. JS42]
          Length = 303

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN ++++H+++ +T Y+H  T  V++ Q V RG  I   G S +A   +
Sbjct: 224 VVYAGAGLRGYGNLVILKHNNTYLTAYAHNQTLLVKEDQNVRRGQKIAEMG-STDADRVK 282

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 283 LHFEIRRQGKPVDPARYLPSR 303


>gi|83858677|ref|ZP_00952199.1| putative metalloendopeptidase [Oceanicaulis alexandrii HTCC2633]
 gi|83853500|gb|EAP91352.1| putative metalloendopeptidase [Oceanicaulis alexandrii HTCC2633]
          Length = 295

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 45/81 (55%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN+L   G  +LIRH+++ VT Y       V  G +V+ G  I  +G SG+     
Sbjct: 215 VVYAGNELQGYGELVLIRHENNWVTAYGLNSILRVNVGDRVTAGQHIADAGASGSETRTA 274

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++ L  +
Sbjct: 275 LHFEVRRGVSPVDPMQVLPSR 295


>gi|317152623|ref|YP_004120671.1| peptidase M23 [Desulfovibrio aespoeensis Aspo-2]
 gi|316942874|gb|ADU61925.1| Peptidase M23 [Desulfovibrio aespoeensis Aspo-2]
          Length = 336

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI VG D    GN++ + H + +VT+Y H+    V+KG  V RG  IGLSG SG +  P
Sbjct: 250 VVILVG-DHYYAGNSVYVDHGNGVVTLYFHLAKAEVKKGDTVQRGQIIGLSGMSGRSTGP 308

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            VHF +      +DP   L+
Sbjct: 309 HVHFSVSVLGRLVDPTPLLK 328


>gi|183222679|ref|YP_001840675.1| hypothetical protein LEPBI_I3335 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189912711|ref|YP_001964266.1| metalloendopeptidase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167777387|gb|ABZ95688.1| Metalloendopeptidase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167781101|gb|ABZ99399.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 300

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VGN     GN I+I+H     T Y H+    V++GQKV +G  IG  G++G A  P 
Sbjct: 223 VSFVGNQ-GGYGNLIIIKHSLGYETRYGHLLNFAVKQGQKVKKGEKIGEVGQTGRATGPH 281

Query: 62  VHFELRKNAIAMDPI 76
           +HFE+R+N+    PI
Sbjct: 282 LHFEIRRNSKRQRPI 296


>gi|119717996|ref|YP_924961.1| peptidase M23B [Nocardioides sp. JS614]
 gi|119538657|gb|ABL83274.1| peptidase M23B [Nocardioides sp. JS614]
          Length = 266

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 47/83 (56%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           ++ +VG D    GN +++ H D   T Y+H+DT  V  GQ+V+ G  IG  G +GN   P
Sbjct: 181 VITFVGYDGA-YGNKVVVTHADGTETWYAHLDTITVAVGQEVAAGQQIGTVGATGNVTGP 239

Query: 61  QVHFELRKNAI-AMDPIKFLEEK 82
            +H E+R +    +DP+  L E+
Sbjct: 240 HLHLEVRPDGQDPVDPVPVLRER 262


>gi|312135552|ref|YP_004002890.1| peptidase M23 [Caldicellulosiruptor owensensis OL]
 gi|311775603|gb|ADQ05090.1| Peptidase M23 [Caldicellulosiruptor owensensis OL]
          Length = 379

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G TI+I +   I T+Y+H+ +  V  GQKV +G  +G  G +G +  P +HFE+R N   
Sbjct: 312 GKTIIIDNGSGISTLYAHLSSINVAVGQKVKKGEIVGYVGSTGYSTGPHLHFEVRINGDV 371

Query: 73  MDPIKFLE 80
            DP+ FL+
Sbjct: 372 TDPLNFLK 379


>gi|9630157|ref|NP_046584.1| putative transglycosylase [Bacillus phage SPBc2]
 gi|3025510|gb|AAC13005.1| putative transglycosylase [Bacillus phage SPbeta]
          Length = 2285

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 13   GNTILIRHDDSIVTVYSH-IDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            GN ++I+ DD  V  Y H ++TP V+ GQ V  G TIG  G +GN+    +H ++ +N  
Sbjct: 1611 GNWVVIKQDDGTVAKYMHMLNTPSVKAGQSVKAGQTIGKVGSTGNSTGNHLHLQIEQNGK 1670

Query: 72   AMDPIKFLE 80
             +DP K+++
Sbjct: 1671 TIDPEKYMQ 1679


>gi|221310044|ref|ZP_03591891.1| hypothetical protein Bsubs1_11756 [Bacillus subtilis subsp. subtilis
            str. 168]
 gi|221314366|ref|ZP_03596171.1| hypothetical protein BsubsN3_11677 [Bacillus subtilis subsp. subtilis
            str. NCIB 3610]
 gi|221319288|ref|ZP_03600582.1| hypothetical protein BsubsJ_11603 [Bacillus subtilis subsp. subtilis
            str. JH642]
 gi|221323564|ref|ZP_03604858.1| hypothetical protein BsubsS_11732 [Bacillus subtilis subsp. subtilis
            str. SMY]
 gi|255767473|ref|NP_390018.2| SPbeta phage protein; lytic transglycosylase [Bacillus subtilis
            subsp. subtilis str. 168]
 gi|251757362|sp|O31976|YOMI_BACSU RecName: Full=SPBc2 prophage-derived uncharacterized transglycosylase
            yomI
 gi|225185100|emb|CAB14053.2| SPbeta phage protein; lytic transglycosylase [Bacillus subtilis
            subsp. subtilis str. 168]
          Length = 2285

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 13   GNTILIRHDDSIVTVYSH-IDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            GN ++I+ DD  V  Y H ++TP V+ GQ V  G TIG  G +GN+    +H ++ +N  
Sbjct: 1611 GNWVVIKQDDGTVAKYMHMLNTPSVKAGQSVKAGQTIGKVGSTGNSTGNHLHLQIEQNGK 1670

Query: 72   AMDPIKFLE 80
             +DP K+++
Sbjct: 1671 TIDPEKYMQ 1679


>gi|167582277|ref|ZP_02375151.1| lipoprotein NlpD, putative [Burkholderia thailandensis TXDOH]
          Length = 233

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+   +T Y+H  T   ++GQ V++G  I   G + N     
Sbjct: 154 VVYAGNGLRGYGNLLIIKHNADFLTTYAHNRTLLAKEGQTVAQGQKIAEMGDTDN-DRVA 212

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 213 LHFELRYGGRSIDPARYLPSR 233


>gi|71908138|ref|YP_285725.1| peptidoglycan-binding LysM:peptidase M23B [Dechloromonas aromatica
           RCB]
 gi|71847759|gb|AAZ47255.1| Peptidoglycan-binding LysM:Peptidase M23B [Dechloromonas aromatica
           RCB]
          Length = 304

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++++H+ + ++ Y+H     V++GQ+VSRG  I   G + +A+  +
Sbjct: 225 VVYAGSGLRGFGELVIVKHNATYLSAYAHNRKILVKEGQQVSRGQKIAEMGNT-DAESVK 283

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK    +DP ++L ++
Sbjct: 284 LHFEIRKQGKPVDPAQYLPKR 304


>gi|320007069|gb|ADW01919.1| Transglycosylase-like domain protein [Streptomyces flavogriseus
           ATCC 33331]
          Length = 421

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           G  +++RHDD   + Y+H+ + +V+ GQ+V  G  I  SG +GN+  P +HFE+R     
Sbjct: 345 GYEVVVRHDDGRYSQYAHLSSLHVRAGQQVGTGQRIARSGSTGNSTGPHLHFEIRTGPGY 404

Query: 70  AIAMDPIKFL 79
              +DP+ +L
Sbjct: 405 GSDIDPLAYL 414


>gi|261821388|ref|YP_003259494.1| hypothetical protein Pecwa_2112 [Pectobacterium wasabiae WPP163]
 gi|261605401|gb|ACX87887.1| Peptidase M23 [Pectobacterium wasabiae WPP163]
          Length = 441

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++IRH     T + H++   V+ GQKV RG  IGLSG +G +  P +H+EL  N  A
Sbjct: 346 GNYVVIRHGRQYTTRFMHLNRILVKPGQKVKRGDRIGLSGNTGRSTGPHLHYELWVNQQA 405

Query: 73  MDPI 76
           ++P+
Sbjct: 406 VNPL 409


>gi|220915917|ref|YP_002491221.1| Peptidase M23 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219953771|gb|ACL64155.1| Peptidase M23 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 292

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G      G  +++RHD  +VT+Y+H     V++G +V RG  I   G++G    P 
Sbjct: 215 VIYAGEQ-AGYGAVVILRHDGGLVTLYAHNSEVLVKEGARVDRGQPIARVGQTGRTTGPH 273

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+     +P+ FL
Sbjct: 274 LHFEVREGTRPRNPLLFL 291


>gi|86157179|ref|YP_463964.1| peptidoglycan-binding peptidase M23B [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85773690|gb|ABC80527.1| peptidoglycan-binding peptidase M23B [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 291

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G      G  +++RHD  +VT+Y+H     V++G +V RG  I   G++G    P 
Sbjct: 214 VIYAGEQ-AGYGAVVILRHDGGLVTLYAHNSEVLVKEGARVGRGQPIARVGQTGRTTGPH 272

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+     +P+ FL
Sbjct: 273 LHFEVREGTRPRNPLLFL 290


>gi|300781704|ref|ZP_07091558.1| probable secreted metallopeptidase [Corynebacterium genitalium ATCC
           33030]
 gi|300533411|gb|EFK54472.1| probable secreted metallopeptidase [Corynebacterium genitalium ATCC
           33030]
          Length = 236

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            G  + +RHDD  +TVY H+ +  V  GQ+V+ G  I   G  G +  P +HFE+R    
Sbjct: 161 FGKWVRVRHDDGTITVYGHVHSFNVSVGQRVTAGEQIAEMGNEGQSTGPHLHFEVRPGGG 220

Query: 72  -AMDPIKFLEEK 82
            A+DP+ +L+++
Sbjct: 221 NAIDPVPWLKDR 232


>gi|224531649|ref|ZP_03672281.1| hypothetical protein BVAVS116_0781 [Borrelia valaisiana VS116]
 gi|224511114|gb|EEF81520.1| hypothetical protein BVAVS116_0781 [Borrelia valaisiana VS116]
          Length = 281

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 53/81 (65%), Gaps = 3/81 (3%)

Query: 1   MVIYVG-NDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQH 59
           +VI VG NDL   GN +++ H ++I ++Y H+++  V++G  +  G  +G  G++G +  
Sbjct: 203 IVIEVGYNDLY--GNFVVVGHKNNIKSLYGHLNSYSVKRGDLIKSGEFLGRVGQTGRSTG 260

Query: 60  PQVHFELRKNAIAMDPIKFLE 80
           P +HFE+ K  I ++P+KFL+
Sbjct: 261 PHLHFEILKKNIPINPLKFLK 281


>gi|329122517|ref|ZP_08251102.1| outer membrane antigenic lipoprotein B [Haemophilus aegyptius ATCC
           11116]
 gi|327473207|gb|EGF18629.1| outer membrane antigenic lipoprotein B [Haemophilus aegyptius ATCC
           11116]
          Length = 405

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVVDQQEVKAGQDIAKMGSSG-TNAVK 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 385 LHFEVRYKGKSVDPVRYLPRR 405


>gi|304413264|ref|ZP_07394737.1| putative M23 peptidase family protein [Candidatus Regiella
           insecticola LSR1]
 gi|304284107|gb|EFL92500.1| putative M23 peptidase family protein [Candidatus Regiella
           insecticola LSR1]
          Length = 439

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++IRH    +T Y H+    V+ GQKV RG  I LSG +G +  P +H+EL  N  A
Sbjct: 344 GNYVVIRHGRQYITRYMHLKKLLVEPGQKVKRGDRIALSGNTGRSTGPHLHYELWINQQA 403

Query: 73  MDPI 76
           ++P+
Sbjct: 404 VNPV 407


>gi|309973797|gb|ADO96998.1| Outer membrane antigenic lipoprotein B [Haemophilus influenzae
           R2846]
          Length = 405

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSG-TNTVK 384

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    ++DP+++L
Sbjct: 385 LHFEIRYKGKSVDPVRYL 402


>gi|296134901|ref|YP_003642143.1| Peptidase M23 [Thiomonas intermedia K12]
 gi|295795023|gb|ADG29813.1| Peptidase M23 [Thiomonas intermedia K12]
          Length = 321

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G++L   G  I+I+H+D  ++VY+H +   V++ + V RG  I   G S +A   +
Sbjct: 241 VVYAGSELRGFGKLIIIKHNDDYISVYAHNNVMLVKENETVKRGQKIAEMG-STDAPRVE 299

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DPI  L ++
Sbjct: 300 LHFEIRLRGKSIDPIGLLPKQ 320


>gi|206896082|ref|YP_002247290.1| membrane protein [Coprothermobacter proteolyticus DSM 5265]
 gi|206738699|gb|ACI17777.1| membrane protein [Coprothermobacter proteolyticus DSM 5265]
          Length = 386

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 39/68 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H D   TVY+H+    V+ GQKVS G  +G  G +G A  P +HFE+R     
Sbjct: 318 GLCVIIDHQDGYGTVYAHMSRIAVKSGQKVSAGTVVGYEGSTGWATGPHLHFEIRIQGEP 377

Query: 73  MDPIKFLE 80
            +P KF++
Sbjct: 378 TNPAKFVQ 385


>gi|167036492|ref|YP_001664070.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|320114920|ref|YP_004185079.1| peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166855326|gb|ABY93734.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|319928011|gb|ADV78696.1| Peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 314

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I I H+    T Y+H+    V+K QKV  G  IG  G +G +  P +HFE+R N  A
Sbjct: 247 GNVIYITHNGGYETRYAHLSRIAVKKWQKVKAGDIIGYVGSTGKSTGPHLHFEIRINGQA 306

Query: 73  MDPIKF 78
           +DP+ F
Sbjct: 307 VDPLGF 312


>gi|319795928|ref|YP_004157568.1| peptidase m23 [Variovorax paradoxus EPS]
 gi|315598391|gb|ADU39457.1| Peptidase M23 [Variovorax paradoxus EPS]
          Length = 449

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 38/69 (55%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H ++  T Y+H+    V+ GQ VS+G  IG  G +G A  P +HFE R   + 
Sbjct: 345 GNIVIITHRNNQQTAYAHLSRIDVKAGQSVSQGQAIGAVGSTGWATGPHLHFEFRVGGVY 404

Query: 73  MDPIKFLEE 81
            DP    +E
Sbjct: 405 QDPATIAQE 413


>gi|308071059|ref|YP_003872664.1| membrane protein [Paenibacillus polymyxa E681]
 gi|305860338|gb|ADM72126.1| Membrane protein [Paenibacillus polymyxa E681]
          Length = 427

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQH 59
           V+ V       GNT++I H D + T+Y HI      V  GQ V RG  I   G +GN+  
Sbjct: 348 VVIVAEWWSGYGNTVVIDHGDGLWTLYGHIRNGGTVVHTGQTVKRGQKIAEVGSTGNSTG 407

Query: 60  PQVHFELRKNAIAMDPIKFL 79
           P  HFE+R+N   ++P+ +L
Sbjct: 408 PHCHFEVRENNKPVNPMNYL 427


>gi|294338838|emb|CAZ87172.1| putative Peptidase M23B [Thiomonas sp. 3As]
          Length = 321

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G++L   G  I+I+H+D  ++VY+H +   V++ + V RG  I   G S +A   +
Sbjct: 241 VVYAGSELRGFGKLIIIKHNDDYISVYAHNNVMLVKENETVKRGQKIAEMG-STDAPRVE 299

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DPI  L ++
Sbjct: 300 LHFEIRLRGKSIDPIGLLPKQ 320


>gi|167036987|ref|YP_001664565.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167039698|ref|YP_001662683.1| peptidase M23B [Thermoanaerobacter sp. X514]
 gi|256750631|ref|ZP_05491517.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915053|ref|ZP_07132368.1| Peptidase M23 [Thermoanaerobacter sp. X561]
 gi|307724976|ref|YP_003904727.1| peptidase M23 [Thermoanaerobacter sp. X513]
 gi|320115405|ref|YP_004185564.1| peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166853938|gb|ABY92347.1| peptidase M23B [Thermoanaerobacter sp. X514]
 gi|166855821|gb|ABY94229.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256750471|gb|EEU63489.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888777|gb|EFK83924.1| Peptidase M23 [Thermoanaerobacter sp. X561]
 gi|307582037|gb|ADN55436.1| Peptidase M23 [Thermoanaerobacter sp. X513]
 gi|319928496|gb|ADV79181.1| Peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 379

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%)

Query: 15  TILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMD 74
           T++I H D I T+Y+H     V++G  V RG  I  +G +G +  P +HFE+RKN + ++
Sbjct: 314 TVIIDHGDGISTLYAHNSALLVKEGDTVKRGQVIAKAGSTGLSTGPHLHFEVRKNGVPVN 373

Query: 75  PIKFLE 80
           P+ +L+
Sbjct: 374 PMDWLK 379


>gi|315635253|ref|ZP_07890530.1| lipoprotein [Aggregatibacter segnis ATCC 33393]
 gi|315475999|gb|EFU66754.1| lipoprotein [Aggregatibacter segnis ATCC 33393]
          Length = 394

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V+  Q+V  G  I   G +G     +
Sbjct: 315 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDSILVKDQQEVKAGQQIAKMGNTG-TNDVK 373

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  +
Sbjct: 374 LHFEIRYKGKSVDPTRYLPRR 394


>gi|291326294|ref|ZP_06123953.2| peptidase, M23 family [Providencia rettgeri DSM 1131]
 gi|291314884|gb|EFE55337.1| peptidase, M23 family [Providencia rettgeri DSM 1131]
          Length = 443

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +HFE+  N  A
Sbjct: 348 GNFIAIRHGRQYTTRYMHLRQLLVKPGQKVKRGDRIALSGNTGRSTGPHLHFEMWVNQQA 407

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 408 VNP---LTAKLP 416


>gi|171463397|ref|YP_001797510.1| Peptidase M23 [Polynucleobacter necessarius subsp. necessarius
           STIR1]
 gi|171192935|gb|ACB43896.1| Peptidase M23 [Polynucleobacter necessarius subsp. necessarius
           STIR1]
          Length = 252

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++HD++ +T Y+H     V++G  V +G  I   G + +A   +
Sbjct: 176 VVYAGNSLRGYGNLVIVKHDNTYLTAYAHNSKLLVKEGDAVRKGQKIAEMGDT-DANAAK 234

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELR N   ++P  +L
Sbjct: 235 LHFELRVNGKPVNPTPYL 252


>gi|86606542|ref|YP_475305.1| M23B family peptidase [Synechococcus sp. JA-3-3Ab]
 gi|86555084|gb|ABD00042.1| peptidase, M23B family [Synechococcus sp. JA-3-3Ab]
          Length = 530

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 33/79 (41%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ GN     GN + IRH + IVT Y+H    YV KGQ V +G  I   G +G +  P 
Sbjct: 451 VIFAGNAGDGYGNRVDIRHPNGIVTRYAHGHRIYVSKGQYVQQGQVIMSRGNTGRSTGPH 510

Query: 62  VHFELRKNAIA-MDPIKFL 79
           +HFE+R    A +DP  +L
Sbjct: 511 LHFEVRPGGGAPVDPRPYL 529


>gi|310644288|ref|YP_003949047.1| peptidase m23b [Paenibacillus polymyxa SC2]
 gi|309249239|gb|ADO58806.1| Peptidase M23B [Paenibacillus polymyxa SC2]
          Length = 427

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQH 59
           V+ V       GNT++I H D + T+Y HI      V  GQ V RG  I   G +GN+  
Sbjct: 348 VVIVAEWWSGYGNTVVIDHGDGLWTLYGHIRNGGTVVHTGQTVKRGQKIAEVGSTGNSTG 407

Query: 60  PQVHFELRKNAIAMDPIKFL 79
           P  HFE+R+N   ++P+ +L
Sbjct: 408 PHCHFEVRENNKPVNPMNYL 427


>gi|270262218|ref|ZP_06190490.1| putative peptidase [Serratia odorifera 4Rx13]
 gi|270044094|gb|EFA17186.1| putative peptidase [Serratia odorifera 4Rx13]
          Length = 440

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +HFE+  N  A
Sbjct: 345 GNYVAIRHGRQYTTRYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHFEMWTNQQA 404

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 405 VNP---LTAKLP 413


>gi|257457553|ref|ZP_05622720.1| M23/M37 peptidase domain protein [Treponema vincentii ATCC 35580]
 gi|257444939|gb|EEV20015.1| M23/M37 peptidase domain protein [Treponema vincentii ATCC 35580]
          Length = 312

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 40/70 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ILIRHDD   ++Y H+     +  +KV  G  IG  G +G +  P +HFE+R+   A
Sbjct: 239 GNYILIRHDDGRESLYGHLSKVNARLYEKVKSGTIIGYVGSTGLSTGPHLHFEVREQGKA 298

Query: 73  MDPIKFLEEK 82
            DP  F++ K
Sbjct: 299 KDPSLFIDTK 308


>gi|167621077|ref|ZP_02389708.1| lipoprotein NlpD, putative [Burkholderia thailandensis Bt4]
 gi|257139500|ref|ZP_05587762.1| lipoprotein NlpD, putative [Burkholderia thailandensis E264]
          Length = 233

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+   +T Y+H  T   ++GQ V++G  I   G + N     
Sbjct: 154 VVYAGNGLRGYGNLLIIKHNADFLTTYAHNRTLLAKEGQTVAQGQKIAEMGDTDN-DRVA 212

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 213 LHFELRYGGRSIDPARYLPSR 233


>gi|167037851|ref|YP_001665429.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167040748|ref|YP_001663733.1| peptidase M23B [Thermoanaerobacter sp. X514]
 gi|300914786|ref|ZP_07132102.1| Peptidase M23 [Thermoanaerobacter sp. X561]
 gi|307723980|ref|YP_003903731.1| peptidase M23 [Thermoanaerobacter sp. X513]
 gi|320116268|ref|YP_004186427.1| peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166854988|gb|ABY93397.1| peptidase M23B [Thermoanaerobacter sp. X514]
 gi|166856685|gb|ABY95093.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|300889721|gb|EFK84867.1| Peptidase M23 [Thermoanaerobacter sp. X561]
 gi|307581041|gb|ADN54440.1| Peptidase M23 [Thermoanaerobacter sp. X513]
 gi|319929359|gb|ADV80044.1| Peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 249

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 42/66 (63%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           + G  I++RH + + TVY+H+    V++G +V +G  IG +G +G A  P +HFE+ +N 
Sbjct: 170 DFGKVIVLRHANDVRTVYAHLSEILVKEGDQVKQGDIIGKTGDTGKATAPHLHFEVWENG 229

Query: 71  IAMDPI 76
             +DP+
Sbjct: 230 KPVDPL 235


>gi|91777923|ref|YP_553131.1| putative lipoprotein [Burkholderia xenovorans LB400]
 gi|91690583|gb|ABE33781.1| Putative lipoprotein [Burkholderia xenovorans LB400]
          Length = 256

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ +   G  I+I+HDDS++T Y    T  V++G  V++G TIG  G         
Sbjct: 175 VVYAGSGIEAYGPLIIIKHDDSLITAYGQNSTLLVKEGDAVAQGQTIGEVGMDSRGV-AS 233

Query: 62  VHFELRKNAIAMDPIKFL 79
           + FE+R+N   +DP+ +L
Sbjct: 234 IQFEVRQNGQPVDPLAWL 251


>gi|256750959|ref|ZP_05491842.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1]
 gi|256750069|gb|EEU63090.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1]
          Length = 249

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 42/66 (63%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           + G  I++RH + + TVY+H+    V++G +V +G  IG +G +G A  P +HFE+ +N 
Sbjct: 170 DFGKVIVLRHANDVRTVYAHLSEILVKEGDQVKQGDIIGKTGDTGKATAPHLHFEVWENG 229

Query: 71  IAMDPI 76
             +DP+
Sbjct: 230 KPVDPL 235


>gi|288575628|ref|ZP_06393850.1| YgeR protein [Neisseria mucosa ATCC 25996]
 gi|288567375|gb|EFC88935.1| YgeR protein [Neisseria mucosa ATCC 25996]
          Length = 228

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVG ++   G  ILI H+D  +T Y+H D   VQK Q+V+    I   G S +    +
Sbjct: 150 VLYVGEEVRGYGKLILISHNDYAITAYAHNDALLVQKDQQVAASQQIATMG-STDTDSVK 208

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N  A++PI +L
Sbjct: 209 LHFEVRLNGKAVNPIPYL 226


>gi|254420749|ref|ZP_05034473.1| M23 peptidase domain protein [Brevundimonas sp. BAL3]
 gi|196186926|gb|EDX81902.1| M23 peptidase domain protein [Brevundimonas sp. BAL3]
          Length = 338

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 45/82 (54%), Gaps = 4/82 (4%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V YVG+DLV  G T+L+ H+    TVY H+ +  V+ G  V  G  IG  G +     P 
Sbjct: 255 VAYVGDDLVGQGLTVLVVHNGGWRTVYGHLGSATVKDGDDVRAGQQIGTVGLTAGDGRPS 314

Query: 62  VHFELRK----NAIAMDPIKFL 79
           +HFE R+    + +A+DP+  L
Sbjct: 315 IHFETRQMRGDDPVAVDPLTVL 336


>gi|328886505|emb|CCA59744.1| putative peptidase [Streptomyces venezuelae ATCC 10712]
          Length = 330

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN ++I+H D   + Y+H+ +  V  GQ V+ G  IGLSG +GN   P +HFE+R     
Sbjct: 254 GNQVVIQHADGTFSQYAHLSSISVSAGQTVTGGQQIGLSGATGNVTGPHLHFEMRTGPEY 313

Query: 70  AIAMDPIKFLEE 81
              +DPI  L +
Sbjct: 314 GSDIDPISTLRQ 325


>gi|59711438|ref|YP_204214.1| peptidase [Vibrio fischeri ES114]
 gi|59479539|gb|AAW85326.1| predicted peptidase [Vibrio fischeri ES114]
          Length = 446

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 41/65 (63%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I+H    +T Y H+    V+KGQKVS G  I LSG +G +  P +H+EL KN  A
Sbjct: 350 GNYIIIKHGREYMTRYLHLSKILVKKGQKVSMGDKIALSGNTGRSTGPHLHYELIKNGRA 409

Query: 73  MDPIK 77
           ++ +K
Sbjct: 410 VNAMK 414


>gi|254478304|ref|ZP_05091684.1| M23 peptidase domain protein [Carboxydibrachium pacificum DSM
           12653]
 gi|214035769|gb|EEB76463.1| M23 peptidase domain protein [Carboxydibrachium pacificum DSM
           12653]
          Length = 317

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  L   G  ++I H   I +VY H     V+ GQ V+RG  I  SG +G +  P
Sbjct: 236 VVVYAGW-LAGYGKAVIIDHGYGIESVYGHNSQILVKVGQTVNRGDVIAKSGNTGRSTGP 294

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+R N   ++P+K+L +
Sbjct: 295 HVHFEIRVNGSPVNPMKYLAK 315


>gi|157371012|ref|YP_001479001.1| hypothetical protein Spro_2772 [Serratia proteamaculans 568]
 gi|157322776|gb|ABV41873.1| peptidase M23B [Serratia proteamaculans 568]
          Length = 440

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +HFE+  N  A
Sbjct: 345 GNYVAIRHGRQYTTRYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHFEMWTNQQA 404

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 405 VNP---LTAKLP 413


>gi|323144472|ref|ZP_08079074.1| peptidase, M23 family [Succinatimonas hippei YIT 12066]
 gi|322415750|gb|EFY06482.1| peptidase, M23 family [Succinatimonas hippei YIT 12066]
          Length = 339

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 42/76 (55%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y        GN I+I H++   TVY H+   +V+KGQKV  G  I  SG +G    P 
Sbjct: 216 VVYFSGYQRAAGNYIIIEHNNGYKTVYMHLSKRHVKKGQKVKLGQLIAKSGNTGRTSGPH 275

Query: 62  VHFELRKNAIAMDPIK 77
           +H+E+  N   +DP+K
Sbjct: 276 LHYEVHVNNRPVDPMK 291


>gi|313157671|gb|EFR57082.1| peptidase, M23 family [Alistipes sp. HGB5]
          Length = 356

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (55%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++IRHD+ + T Y H+    V+  Q V  G  IGL G +G +  P +HFE R    +
Sbjct: 195 GNLVIIRHDNGLETYYGHLSERMVEPNQWVEAGQIIGLGGSTGRSTGPHLHFETRYYGQS 254

Query: 73  MDPIKFLEEK 82
            DP + ++ K
Sbjct: 255 FDPERLIDFK 264


>gi|261212770|ref|ZP_05927054.1| cell wall endopeptidase family M23/M37 [Vibrio sp. RC341]
 gi|260837835|gb|EEX64512.1| cell wall endopeptidase family M23/M37 [Vibrio sp. RC341]
          Length = 364

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H  + +T Y H+    V+KGQKVSRG  IGLSG +G    P +H+EL     A
Sbjct: 262 GNYVVIQHGSTYMTRYLHLSKILVKKGQKVSRGQRIGLSGNTGRVTGPHLHYELIVRGRA 321

Query: 73  MDPIK 77
           ++ +K
Sbjct: 322 VNAMK 326


>gi|253688215|ref|YP_003017405.1| Peptidase M23 [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251754793|gb|ACT12869.1| Peptidase M23 [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 440

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++IRH     T + H++   V+ GQKV RG  IGLSG +G +  P +H+EL  N  A
Sbjct: 345 GNYVVIRHGRQYTTRFMHLNRILVKPGQKVKRGDRIGLSGNTGRSTGPHLHYELWINQQA 404

Query: 73  MDPI 76
           ++P+
Sbjct: 405 VNPL 408


>gi|301155392|emb|CBW14858.1| predicted outer membrane lipoprotein [Haemophilus parainfluenzae
           T3T1]
          Length = 405

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G +G     +
Sbjct: 326 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVSDQQEVKAGQEIAKMGSTG-TNAVK 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 385 LHFEIRYKGKSVDPVRYLPRR 405


>gi|91205003|ref|YP_537358.1| periplasmic protein [Rickettsia bellii RML369-C]
 gi|157827666|ref|YP_001496730.1| periplasmic protein [Rickettsia bellii OSU 85-389]
 gi|91068547|gb|ABE04269.1| Periplasmic protein [Rickettsia bellii RML369-C]
 gi|157802970|gb|ABV79693.1| Periplasmic protein [Rickettsia bellii OSU 85-389]
          Length = 284

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 42/69 (60%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           + GN I I+H    VT YSH+   +V++G KV+RG  IG  GK+GNA    +HFE+  + 
Sbjct: 210 DYGNFIEIKHSHKFVTKYSHLKEIHVKEGTKVTRGQFIGTQGKTGNATGEHLHFEIILDN 269

Query: 71  IAMDPIKFL 79
             ++P  F+
Sbjct: 270 KPINPFDFI 278


>gi|222823611|ref|YP_002575185.1| peptidase, M23/M37 family [Campylobacter lari RM2100]
 gi|222538833|gb|ACM63934.1| peptidase, M23/M37 family [Campylobacter lari RM2100]
          Length = 268

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++ + ++    GN+++I H   I + Y H+    V+ GQKV +G  IGLSG SG    P 
Sbjct: 185 IVRIASNRYYAGNSVVIDHGYGIYSQYYHLSKLNVKIGQKVKKGELIGLSGASGRVTGPH 244

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HF +  N + +DP+ F+ +
Sbjct: 245 LHFGILVNGVQVDPLDFIAK 264


>gi|332527116|ref|ZP_08403195.1| hypothetical protein RBXJA2T_14411 [Rubrivivax benzoatilyticus JA2]
 gi|332111546|gb|EGJ11528.1| hypothetical protein RBXJA2T_14411 [Rubrivivax benzoatilyticus JA2]
          Length = 456

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 38/65 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I I+H     T+Y+H+    V+KGQ+V +G  IG  G +G A  P +HFE + N   
Sbjct: 350 GNVIQIQHGGGKATLYAHLSRIDVKKGQRVEQGQRIGAVGATGWATGPHLHFEFKINGAQ 409

Query: 73  MDPIK 77
            DP++
Sbjct: 410 HDPLR 414


>gi|308048569|ref|YP_003912135.1| peptidase M23 [Ferrimonas balearica DSM 9799]
 gi|307630759|gb|ADN75061.1| Peptidase M23 [Ferrimonas balearica DSM 9799]
          Length = 304

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D  ++ Y+H     V++ Q+VS G  I   G S +A  P 
Sbjct: 225 VVYAGSALRGYGQLIIIKHSDEYLSAYAHNSRILVKEKQRVSAGQKIAEVGSS-DADRPM 283

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  +
Sbjct: 284 LHFEIRYKGKSVDPQRYLPRQ 304


>gi|288572933|ref|ZP_06391290.1| Peptidase M23 [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288568674|gb|EFC90231.1| Peptidase M23 [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 396

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   G  +++ +  +  TVY+H+    + +GQ+VS G  IG  G +G A  P 
Sbjct: 320 VLYAGW-LRGYGQIVILDNGGNFSTVYAHLSRILISEGQRVSDGQPIGNVGDTGVATGPH 378

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N  A DP+K+L
Sbjct: 379 LHFEVRVNGDARDPLKYL 396


>gi|332284243|ref|YP_004416154.1| hypothetical protein PT7_0990 [Pusillimonas sp. T7-7]
 gi|330428196|gb|AEC19530.1| hypothetical protein PT7_0990 [Pusillimonas sp. T7-7]
          Length = 285

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 43/83 (51%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ +  D    G TI I H    +T+Y H+    V+ GQ+V RG  IGL G +G A  P 
Sbjct: 203 VVTIVADYFFNGKTIFIDHGQGFITMYCHLSGFQVEPGQEVRRGQVIGLVGATGRATGPH 262

Query: 62  VHFELRKNAIAMDPIKFLEEKIP 84
           +H+ +  N+  +DP  F+    P
Sbjct: 263 LHWNVSLNSTRVDPAIFINAFKP 285


>gi|328885561|emb|CCA58800.1| putative peptidase [Streptomyces venezuelae ATCC 10712]
          Length = 256

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA-- 70
           GN I+IR +D   T Y H+ +  V  GQ V  G  IG+SG +GN+  P +HFE R  A  
Sbjct: 180 GNNIVIRMNDGTYTQYGHLSSIGVSVGQSVEPGQRIGISGSTGNSTGPHLHFEARTTAEY 239

Query: 71  -IAMDPIKFLEEK 82
              ++PI +L  +
Sbjct: 240 GSDINPIAYLRAR 252


>gi|325577190|ref|ZP_08147674.1| outer membrane antigenic lipoprotein B [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325160772|gb|EGC72893.1| outer membrane antigenic lipoprotein B [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 405

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G +G     +
Sbjct: 326 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVSDQQEVKAGQEIAKMGSTG-TNAVK 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 385 LHFEIRYKGKSVDPVRYLPRR 405


>gi|149185304|ref|ZP_01863621.1| Peptidase M23/M37 [Erythrobacter sp. SD-21]
 gi|148831415|gb|EDL49849.1| Peptidase M23/M37 [Erythrobacter sp. SD-21]
          Length = 385

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 39/68 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GNT+ I H + ++T Y+H+     + G+ V  G  IG  G +G +  P +HFE+R N   
Sbjct: 298 GNTVEITHGNGLMTRYAHMSAFRAKVGETVQPGEVIGAIGSTGRSSGPHLHFEVRSNGRP 357

Query: 73  MDPIKFLE 80
           ++P  FLE
Sbjct: 358 LNPRTFLE 365


>gi|186473533|ref|YP_001860875.1| peptidase M23B [Burkholderia phymatum STM815]
 gi|184195865|gb|ACC73829.1| peptidase M23B [Burkholderia phymatum STM815]
          Length = 248

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  +   G  ++I+HDD+++T Y       VQ+G  V++G  +G  G   N   P 
Sbjct: 170 VVYAGTGIEAYGPLVIIKHDDTLITAYGQNSRLLVQEGDAVTQGQPVGEVGTDSNG-VPS 228

Query: 62  VHFELRKNAIAMDPIKFL 79
           + FE+RK+   +DP+ +L
Sbjct: 229 IQFEVRKDGKPVDPLTWL 246


>gi|157826139|ref|YP_001493859.1| periplasmic protein [Rickettsia akari str. Hartford]
 gi|157800097|gb|ABV75351.1| Periplasmic protein [Rickettsia akari str. Hartford]
          Length = 301

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           + GN + I+H    VT Y+H+    V++G K+ RG  IG+ G++GNA    +HFE+  + 
Sbjct: 227 DYGNFVEIKHGRKFVTKYAHLKEMLVKEGNKIKRGQLIGIQGRTGNATGEHLHFEILLDN 286

Query: 71  IAMDPIKFL 79
            A++P+ F+
Sbjct: 287 KAINPLDFI 295


>gi|239995278|ref|ZP_04715802.1| hypothetical lipoprotein NlpD [Alteromonas macleodii ATCC 27126]
          Length = 260

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D+ ++ Y++ DT  V++ + VS G  I   G SG     +
Sbjct: 180 VVYSGSALRGYGNLVIIKHTDTFLSAYAYNDTILVKEREWVSAGQQIATMGDSGT-NSVK 238

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    ++DP+K+L
Sbjct: 239 LHFEVRYRGKSLDPMKYL 256


>gi|91788919|ref|YP_549871.1| peptidase M23B [Polaromonas sp. JS666]
 gi|91698144|gb|ABE44973.1| peptidase M23B [Polaromonas sp. JS666]
          Length = 318

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN ++++H+++ +T Y+H  T  V++ Q V +G  I   G + +A   +
Sbjct: 239 VVYAGAGLRGYGNLVILKHNNTFLTAYAHNQTLLVKEDQTVKKGQKIAEMGNT-DADRVK 297

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP K+L  K
Sbjct: 298 LHFEIRRQGKPVDPAKYLPPK 318


>gi|295696760|ref|YP_003589998.1| Peptidase M23 [Bacillus tusciae DSM 2912]
 gi|295412362|gb|ADG06854.1| Peptidase M23 [Bacillus tusciae DSM 2912]
          Length = 478

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 42/77 (54%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G D    GN + I H + +VT+Y H+    V  GQ V++G  IG  G +G A  P 
Sbjct: 401 VIFAGWDSGGYGNCVRIDHGNGVVTIYGHMSQVLVSPGQAVAQGQVIGRVGATGEATGPH 460

Query: 62  VHFELRKNAIAMDPIKF 78
           +H+E+      +DP+ +
Sbjct: 461 LHYEVHVGGHVVDPMPY 477


>gi|78187500|ref|YP_375543.1| membrane proteins related to metalloendopeptidase-like [Chlorobium
           luteolum DSM 273]
 gi|78167402|gb|ABB24500.1| Membrane proteins related to metalloendopeptidases-like protein
           [Chlorobium luteolum DSM 273]
          Length = 248

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  +LI H    +T Y+H+    V++GQK+ RG  I LSG +G +  P +H+E+ K+ + 
Sbjct: 158 GQKVLINHGFGFMTAYAHLSKSLVRQGQKIRRGEVIALSGNTGISTGPHLHYEVYKDRVR 217

Query: 73  MDPIKFL 79
           +DP  + 
Sbjct: 218 VDPAAYF 224


>gi|240948397|ref|ZP_04752775.1| Outer membrane antigenic lipoprotein B precursor [Actinobacillus
           minor NM305]
 gi|240297223|gb|EER47781.1| Outer membrane antigenic lipoprotein B precursor [Actinobacillus
           minor NM305]
          Length = 409

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V  G  I   G +G   + +
Sbjct: 330 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDSVRAGEKIATMGSTGTTSN-K 388

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L ++
Sbjct: 389 LHFEIRYKGKSVDPTRYLPKQ 409


>gi|227499121|ref|ZP_03929256.1| peptidase M23B [Acidaminococcus sp. D21]
 gi|226904568|gb|EEH90486.1| peptidase M23B [Acidaminococcus sp. D21]
          Length = 320

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 27/66 (40%), Positives = 37/66 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I I H   + T Y H+    V  GQ+VSRG  IG  G SG +  P +HFE+R+N   
Sbjct: 247 GRFISIDHGSGMSTAYGHMSALAVTVGQQVSRGQVIGYVGSSGYSTGPHLHFEVRENGQT 306

Query: 73  MDPIKF 78
            +P++F
Sbjct: 307 ENPLQF 312


>gi|153876407|ref|ZP_02003745.1| Peptidase M23B [Beggiatoa sp. PS]
 gi|152067129|gb|EDN66255.1| Peptidase M23B [Beggiatoa sp. PS]
          Length = 217

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 38/63 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GNT++I H   IVT+Y H++   VQ GQ V RG  IG  GK+G A  P +H+ +  N   
Sbjct: 150 GNTVIINHGQGIVTLYGHLNAITVQSGQTVKRGQKIGTVGKTGRATGPHLHWGVAINYTM 209

Query: 73  MDP 75
           ++P
Sbjct: 210 VNP 212


>gi|119356372|ref|YP_911016.1| peptidase M23B [Chlorobium phaeobacteroides DSM 266]
 gi|119353721|gb|ABL64592.1| peptidase M23B [Chlorobium phaeobacteroides DSM 266]
          Length = 247

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 42/67 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H     TVY+H+    V++GQ+V+RG  I L+G SG +  P +H+E+RK+ + 
Sbjct: 157 GEKVVINHGYGFETVYAHLSKSLVRQGQRVNRGEIIALTGNSGVSTGPHLHYEVRKHNVK 216

Query: 73  MDPIKFL 79
           ++P  + 
Sbjct: 217 VNPTAYF 223


>gi|197334343|ref|YP_002155593.1| peptidase M23B [Vibrio fischeri MJ11]
 gi|197315833|gb|ACH65280.1| peptidase M23B [Vibrio fischeri MJ11]
          Length = 394

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 41/65 (63%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I+H    +T Y H+    V+KGQKVS G  I LSG +G +  P +H+EL KN  A
Sbjct: 298 GNYIIIKHGREYMTRYLHLSKILVKKGQKVSMGDKIALSGNTGRSTGPHLHYELIKNGRA 357

Query: 73  MDPIK 77
           ++ +K
Sbjct: 358 VNAMK 362


>gi|73540775|ref|YP_295295.1| peptidoglycan-binding LysM:peptidase M23B [Ralstonia eutropha
           JMP134]
 gi|72118188|gb|AAZ60451.1| Peptidoglycan-binding LysM:Peptidase M23B [Ralstonia eutropha
           JMP134]
          Length = 242

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 5/82 (6%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
             I+VG DL   G  ++++H D  +TVY ++D P V +G +V+ G  +G  G +G     
Sbjct: 165 WAIHVG-DLRGYGMLVIVKHSDDWLTVYGNLDKPLVSEGARVAAGQDVGRMGSAGA---- 219

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP  +L  +
Sbjct: 220 DLHFEVRGNGKPVDPANYLPAR 241


>gi|114332282|ref|YP_748504.1| peptidase M23B [Nitrosomonas eutropha C91]
 gi|114309296|gb|ABI60539.1| peptidase M23B [Nitrosomonas eutropha C91]
          Length = 328

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+DS ++ Y H    +V +G+ VS+G  I   G + +    +
Sbjct: 249 VVYSGNGLRGYGNLIIIKHNDSYLSAYGHNSKIFVHEGENVSKGQKIAEMGNT-DGGVVK 307

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+ +L
Sbjct: 308 LHFEIREKGKPVDPLGYL 325


>gi|290476559|ref|YP_003469464.1| lipoprotein [Xenorhabdus bovienii SS-2004]
 gi|289175897|emb|CBJ82700.1| lipoprotein [Xenorhabdus bovienii SS-2004]
          Length = 336

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V+  Q V  G  I   G +G +   +
Sbjct: 257 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVRDSQDVQAGQKIATMGSTGTSL-VK 315

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++ L ++
Sbjct: 316 LHFEIRYKGKSVNPLRHLPQR 336


>gi|292670319|ref|ZP_06603745.1| M23B family peptidase [Selenomonas noxia ATCC 43541]
 gi|292648050|gb|EFF66022.1| M23B family peptidase [Selenomonas noxia ATCC 43541]
          Length = 371

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H   I T+Y H  +  V  GQ V++G  I   G +GN+  P  HFE+R N   
Sbjct: 305 GNAVIINHGGGISTLYGHCQSLEVSTGQSVAQGELIAECGSTGNSTGPHCHFEVRVNGEP 364

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 365 VNPLAYL 371


>gi|67925063|ref|ZP_00518442.1| Peptidoglycan-binding LysM:Peptidase M23B [Crocosphaera watsonii WH
           8501]
 gi|67853086|gb|EAM48466.1| Peptidoglycan-binding LysM:Peptidase  M23B [Crocosphaera watsonii
           WH 8501]
          Length = 423

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI VG D    G  + IRH D  VT+Y H     V++GQKV +G  I   G +G +  P 
Sbjct: 339 VITVGWDARGYGKFLKIRHPDGSVTLYGHNSRHLVRRGQKVEQGQKIAEMGNTGRSTGPH 398

Query: 62  VHFELR-KNAIAMDPIKFL 79
           +H+E+R K     DP+ FL
Sbjct: 399 LHYEIRPKGRGPQDPMAFL 417


>gi|149190124|ref|ZP_01868400.1| membrane protein [Vibrio shilonii AK1]
 gi|148836013|gb|EDL52974.1| membrane protein [Vibrio shilonii AK1]
          Length = 318

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
            V+Y GN L   GN ++++H+D+ ++ Y+H D   V +GQ V  G  I   G SG     
Sbjct: 240 TVVYSGNALRGYGNLVIVKHNDNYLSAYAHNDRLLVSEGQSVKAGQKIATMGSSG-TNSV 298

Query: 61  QVHFELRKNAIAMDPIKFL 79
           ++HFE+R    +++P ++L
Sbjct: 299 RLHFEIRYQGKSVNPKRYL 317


>gi|67458587|ref|YP_246211.1| periplasmic protein [Rickettsia felis URRWXCal2]
 gi|67004120|gb|AAY61046.1| Periplasmic protein [Rickettsia felis URRWXCal2]
          Length = 284

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           + GN + I+H    VT Y+H+    V++G K+ RG  IG+ GK+GNA    +HFE+  + 
Sbjct: 210 DYGNFVEIKHGRKFVTKYAHLKEMSVKEGNKIKRGQFIGIQGKTGNATGEHLHFEILLDN 269

Query: 71  IAMDPIKFL 79
            A++P  F+
Sbjct: 270 KAINPFDFI 278


>gi|310658192|ref|YP_003935913.1| peptidase m23b [Clostridium sticklandii DSM 519]
 gi|308824970|emb|CBH21008.1| putative Peptidase M23B [Clostridium sticklandii]
          Length = 303

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  IL+ H +   TVY+H+    V+ G +V +G  IG  G +G +  P +HFE+R+N   
Sbjct: 235 GKMILVSHGNGYSTVYAHLSKQLVKAGDQVKKGDLIGKMGSTGRSTGPHLHFEIRENGTP 294

Query: 73  MDPIKFL 79
           +DP K L
Sbjct: 295 IDPQKIL 301


>gi|262403217|ref|ZP_06079777.1| cell wall endopeptidase family M23/M37 [Vibrio sp. RC586]
 gi|262350716|gb|EEY99849.1| cell wall endopeptidase family M23/M37 [Vibrio sp. RC586]
          Length = 413

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H  + +T Y H+    V+KGQKVSRG  IGLSG +G    P +H+EL     A
Sbjct: 311 GNYVVIQHGSTYMTRYLHMSKILVKKGQKVSRGQRIGLSGNTGRVTGPHLHYELIVRGRA 370

Query: 73  MDPIK 77
           ++ +K
Sbjct: 371 VNAMK 375


>gi|312897456|ref|ZP_07756880.1| peptidase, M23 family [Megasphaera micronuciformis F0359]
 gi|310621517|gb|EFQ05053.1| peptidase, M23 family [Megasphaera micronuciformis F0359]
          Length = 320

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H + IVT Y H     V +GQ+V  G  I L+G +GN+  P VH+E+R N   
Sbjct: 253 GNLVEIDHGNGIVTRYGHNSMLLVVEGQEVKTGDIIALAGSTGNSTGPHVHYEVRVNGSP 312

Query: 73  MDPIKFL 79
            +PI FL
Sbjct: 313 TNPILFL 319


>gi|260767190|ref|ZP_05876132.1| peptidase M23 [Vibrio furnissii CIP 102972]
 gi|260617798|gb|EEX42975.1| peptidase M23 [Vibrio furnissii CIP 102972]
          Length = 311

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+D  ++ Y+H D   V++GQ V  G  I   G SG     +
Sbjct: 234 VVYSGNALRGYGNLVIIKHNDHYLSAYAHNDRLLVKEGQSVKAGQKIATMGSSG-TNSVR 292

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 293 LHFEIRYQGKSVNPKRYL 310


>gi|121535375|ref|ZP_01667187.1| peptidase M23B [Thermosinus carboxydivorans Nor1]
 gi|121306067|gb|EAX46997.1| peptidase M23B [Thermosinus carboxydivorans Nor1]
          Length = 309

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H + IVT+Y H     V+ GQ+V +G  I   G +G +  P VH+E+R N  A
Sbjct: 243 GKMVEIDHGNGIVTIYGHNSQNLVETGQRVKKGEIIAYMGSTGISTGPHVHYEVRVNGTA 302

Query: 73  MDPIKFL 79
           ++P  FL
Sbjct: 303 VNPANFL 309


>gi|330465495|ref|YP_004403238.1| peptidase M23 [Verrucosispora maris AB-18-032]
 gi|328808466|gb|AEB42638.1| peptidase M23 [Verrucosispora maris AB-18-032]
          Length = 356

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 42/67 (62%), Gaps = 5/67 (7%)

Query: 18  IRHDDSIVTVYSHIDT-PYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFEL----RKNAIA 72
           I H D + T Y H+ T P V +GQ+V+ GH IG++G SG++  P +HFE+      +  A
Sbjct: 281 ITHPDGVATRYCHLLTRPSVVEGQRVTAGHVIGVAGSSGHSSGPHLHFEVHLGHHTSRTA 340

Query: 73  MDPIKFL 79
           +DP+ F+
Sbjct: 341 VDPVTFM 347


>gi|307721682|ref|YP_003892822.1| Peptidase M23 [Sulfurimonas autotrophica DSM 16294]
 gi|306979775|gb|ADN09810.1| Peptidase M23 [Sulfurimonas autotrophica DSM 16294]
          Length = 291

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T++I H + I T Y H+    V+K Q V +G  +GLSGKSG    P +HF  R + + 
Sbjct: 211 GGTVVIDHGEGIYTCYFHMSKFNVKKNQFVKKGELLGLSGKSGRVTGPHLHFSARIDGVQ 270

Query: 73  MDPIKFL 79
           +DP++ +
Sbjct: 271 VDPLQLI 277


>gi|315181179|gb|ADT88093.1| lipoprotein NlpD [Vibrio furnissii NCTC 11218]
          Length = 311

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+D  ++ Y+H D   V++GQ V  G  I   G SG     +
Sbjct: 234 VVYSGNALRGYGNLVIIKHNDHYLSAYAHNDRLLVKEGQSVKAGQKIATMGSSG-TNSVR 292

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 293 LHFEIRYQGKSVNPKRYL 310


>gi|254383471|ref|ZP_04998822.1| peptidase [Streptomyces sp. Mg1]
 gi|194342367|gb|EDX23333.1| peptidase [Streptomyces sp. Mg1]
          Length = 427

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 40/70 (57%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           G  ++IRH D   + Y+H+    V+ GQ+VS G  IG SG +GN   P +HFE+R     
Sbjct: 351 GYQVVIRHSDGRYSQYAHLSALSVKAGQQVSGGQRIGRSGSTGNTTGPHLHFEMRTGPGY 410

Query: 70  AIAMDPIKFL 79
              +DP+ +L
Sbjct: 411 GTDIDPLAYL 420


>gi|86609277|ref|YP_478039.1| M23B family peptidase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557819|gb|ABD02776.1| peptidase, M23B family [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 539

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ GN     GN + IRH + IVT Y+H    YV  GQ V +G TI   G +G +  P
Sbjct: 459 VVIFAGNAGDGYGNRVDIRHPNGIVTRYAHGHQIYVSTGQYVQQGQTIMSRGSTGWSTGP 518

Query: 61  QVHFELRKNAIA-MDPIKFL 79
            +HFE+R    A +DP  +L
Sbjct: 519 HLHFEVRPGGGAPVDPRPYL 538


>gi|304318076|ref|YP_003853221.1| peptidase M23 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302779578|gb|ADL70137.1| Peptidase M23 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 421

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 39/68 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H +  VT Y H     V+KG KV +G  I L G +GN   P VHFE+RKN + 
Sbjct: 354 GYLVKIDHGNGYVTYYGHASKLIVKKGDKVYKGQEIALVGMTGNTTGPHVHFEVRKNGVP 413

Query: 73  MDPIKFLE 80
           ++P  +L+
Sbjct: 414 VNPQIYLK 421


>gi|319897855|ref|YP_004136052.1| lipoprotein [Haemophilus influenzae F3031]
 gi|317433361|emb|CBY81741.1| Lipoprotein [Haemophilus influenzae F3031]
          Length = 400

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 321 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVVDQQEVKAGQDIAKMGSSG-TNAVK 379

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 380 LHFEVRYKGKSVDPVRYLPRR 400


>gi|315182363|gb|ADT89276.1| hypothetical metalloprotease [Vibrio furnissii NCTC 11218]
          Length = 409

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H  + +T Y H+    V KGQKVSRG  IGLSG +G    P +H+EL    + 
Sbjct: 299 GNYVVIQHGSTYMTRYLHLSKILVSKGQKVSRGQRIGLSGATGRVTGPHIHYEL---IVR 355

Query: 73  MDPIKFLEEKIP 84
             P+  ++  IP
Sbjct: 356 GRPVDAMKANIP 367


>gi|119387178|ref|YP_918233.1| peptidase M23B [Paracoccus denitrificans PD1222]
 gi|119377773|gb|ABL72537.1| peptidase M23B [Paracoccus denitrificans PD1222]
          Length = 491

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I I+H+    T Y H+    V+ GQKVSRG  IG  G +G +    +H+E+R N  A
Sbjct: 418 GNLIKIQHELGTETRYGHLSKIRVKAGQKVSRGSQIGDMGNTGRSTGSHLHYEVRVNGRA 477

Query: 73  MDPIKFLE 80
           ++P+ F++
Sbjct: 478 VNPMSFIK 485


>gi|260769632|ref|ZP_05878565.1| cell wall endopeptidase family M23/M37 [Vibrio furnissii CIP
           102972]
 gi|260614970|gb|EEX40156.1| cell wall endopeptidase family M23/M37 [Vibrio furnissii CIP
           102972]
          Length = 409

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H  + +T Y H+    V KGQKVSRG  IGLSG +G    P +H+EL    + 
Sbjct: 299 GNYVVIQHGSTYMTRYLHLSKILVSKGQKVSRGQRIGLSGATGRVTGPHIHYEL---IVR 355

Query: 73  MDPIKFLEEKIP 84
             P+  ++  IP
Sbjct: 356 GRPVDAMKANIP 367


>gi|282879460|ref|ZP_06288197.1| peptidase, M23 family [Prevotella buccalis ATCC 35310]
 gi|281298432|gb|EFA90864.1| peptidase, M23 family [Prevotella buccalis ATCC 35310]
          Length = 316

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 39/63 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+IRH++ + T+Y H+    VQ+ Q+V  G  IGL G +G +    +HFE R   +A
Sbjct: 142 GNYIVIRHNNGLETIYGHLSKQLVQENQEVRAGDVIGLGGNTGRSTGSHLHFETRLCGVA 201

Query: 73  MDP 75
           ++P
Sbjct: 202 LNP 204


>gi|320008110|gb|ADW02960.1| Peptidase M23 [Streptomyces flavogriseus ATCC 33331]
          Length = 263

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 38/70 (54%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN I++R  D   T Y H+ +  V  GQ V  G  IGLSG +GN+  P +HFE R     
Sbjct: 187 GNNIVLRMKDGTYTQYGHLSSIGVSVGQSVVSGEQIGLSGSTGNSTGPHLHFEARTTPEY 246

Query: 70  AIAMDPIKFL 79
              MDP+ +L
Sbjct: 247 GSDMDPVAYL 256


>gi|242239569|ref|YP_002987750.1| hypothetical protein Dd703_2141 [Dickeya dadantii Ech703]
 gi|242131626|gb|ACS85928.1| Peptidase M23 [Dickeya dadantii Ech703]
          Length = 486

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 42/74 (56%), Gaps = 3/74 (4%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           E GN I IRH     T Y H+    V+ GQ+V RG  IGLSG +G +  P +H+E+  N 
Sbjct: 388 EAGNYIAIRHGRQYTTRYMHMTRLLVKPGQRVKRGDRIGLSGNTGRSTGPHLHYEIWINQ 447

Query: 71  IAMDPIKFLEEKIP 84
            A++P   L  K+P
Sbjct: 448 QAVNP---LTAKLP 458


>gi|86606286|ref|YP_475049.1| M23B family peptidase [Synechococcus sp. JA-3-3Ab]
 gi|86554828|gb|ABC99786.1| peptidase, M23B family [Synechococcus sp. JA-3-3Ab]
          Length = 392

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 38/65 (58%)

Query: 15  TILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMD 74
           T+++ H   I T+Y+H     V  GQ+V RG  I  SG +G +  P VHFE+R N   +D
Sbjct: 328 TVIVNHGGGITTLYAHNSRVAVGVGQQVQRGQAIAASGSTGLSTGPHVHFEVRVNGQPVD 387

Query: 75  PIKFL 79
           P ++L
Sbjct: 388 PRRYL 392


>gi|300717079|ref|YP_003741882.1| metallopeptidase [Erwinia billingiae Eb661]
 gi|299062915|emb|CAX60035.1| putative metallopeptidase [Erwinia billingiae Eb661]
          Length = 442

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH    +T Y H+    V+ G+KV RG  IGLSG +G +  P +HFE+  N  A
Sbjct: 347 GNYVAIRHGRQYMTRYMHMQKLLVKPGEKVKRGERIGLSGSTGRSTGPHLHFEIWINNQA 406

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 407 VNP---LTAKLP 415


>gi|296161303|ref|ZP_06844111.1| Peptidase M23 [Burkholderia sp. Ch1-1]
 gi|295888461|gb|EFG68271.1| Peptidase M23 [Burkholderia sp. Ch1-1]
          Length = 256

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ +   G  I+I+HDDS++T Y    T  V++G  V++G TIG  G         
Sbjct: 175 VVYAGSGIEAYGPLIIIKHDDSLITAYGQNSTLLVKEGDAVAQGQTIGEVGVDSRGV-AS 233

Query: 62  VHFELRKNAIAMDPIKFL 79
           + FE+R+N   +DP+ +L
Sbjct: 234 IQFEVRQNGQPVDPLAWL 251


>gi|282599691|ref|ZP_05971502.2| peptidase, M23 family [Providencia rustigianii DSM 4541]
 gi|282568244|gb|EFB73779.1| peptidase, M23 family [Providencia rustigianii DSM 4541]
          Length = 439

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +HFE+  N  A
Sbjct: 344 GNFIAIRHGRQYTTRYMHLRQLLVKPGQKVKRGDRIALSGNTGRSTGPHLHFEMWVNQQA 403

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 404 VNP---LTAKLP 412


>gi|86609354|ref|YP_478116.1| M23B family peptidase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557896|gb|ABD02853.1| peptidase, M23B family [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 392

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 38/65 (58%)

Query: 15  TILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMD 74
           T+++ H   I T+Y+H     V  GQ+V RG  I  SG +G +  P VHFE+R N   +D
Sbjct: 328 TVIVNHGGGITTLYAHNSRVAVGVGQQVQRGQAIAASGSTGLSTGPHVHFEVRVNGQPVD 387

Query: 75  PIKFL 79
           P ++L
Sbjct: 388 PRRYL 392


>gi|313892296|ref|ZP_07825889.1| peptidase, M23 family [Dialister microaerophilus UPII 345-E]
 gi|313119434|gb|EFR42633.1| peptidase, M23 family [Dialister microaerophilus UPII 345-E]
          Length = 297

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I+H ++IVT Y H     V  GQKV +G+ I L G +G +  P  H+E+R    A
Sbjct: 227 GNLVEIQHAENIVTRYGHNSIILVNVGQKVEKGNIIALIGNTGYSTGPHCHYEVRIGGTA 286

Query: 73  MDPIKFLEEKI 83
           ++PI F++ +I
Sbjct: 287 VNPIPFMQTQI 297


>gi|148826652|ref|YP_001291405.1| lipoprotein [Haemophilus influenzae PittEE]
 gi|319775450|ref|YP_004137938.1| Lipoprotein [Haemophilus influenzae F3047]
 gi|148716812|gb|ABQ99022.1| lipoprotein [Haemophilus influenzae PittEE]
 gi|317450041|emb|CBY86255.1| Lipoprotein [Haemophilus influenzae F3047]
          Length = 405

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVVDQQEVKAGQDIAKMGSSG-TNAVK 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 385 LHFEVRYKGKSVDPVRYLPRR 405


>gi|29828182|ref|NP_822816.1| secreted peptidase [Streptomyces avermitilis MA-4680]
 gi|29605284|dbj|BAC69351.1| putative secreted peptidase [Streptomyces avermitilis MA-4680]
          Length = 301

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN +++RH D   + Y+H+    V  GQ V+ G  +GLSG +GN   P +HFE+R     
Sbjct: 224 GNEVVVRHADGQYSQYAHMSQLSVSTGQSVAEGRQLGLSGATGNVTGPHLHFEIRTTPSY 283

Query: 70  AIAMDPIKFL 79
              +DP+ +L
Sbjct: 284 GSDVDPVAYL 293


>gi|323496788|ref|ZP_08101833.1| peptidase [Vibrio sinaloensis DSM 21326]
 gi|323318213|gb|EGA71179.1| peptidase [Vibrio sinaloensis DSM 21326]
          Length = 435

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 39/65 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++++H     T Y H+    V+KGQKVSRG  IGLSG +G    P +H+EL     A
Sbjct: 326 GNYVVVQHSSRYKTRYLHLSKILVRKGQKVSRGQRIGLSGATGRVTGPHIHYELLDRGRA 385

Query: 73  MDPIK 77
           ++ +K
Sbjct: 386 VNAMK 390


>gi|310778732|ref|YP_003967065.1| Peptidase M23 [Ilyobacter polytropus DSM 2926]
 gi|309748055|gb|ADO82717.1| Peptidase M23 [Ilyobacter polytropus DSM 2926]
          Length = 273

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 41/63 (65%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H +   T Y+H++   V+KGQK+S+G  I  +G +G +  P +H+E+RKN+  
Sbjct: 207 GKVVIINHGNGYETRYAHLNRWLVKKGQKISKGQVIAKTGNTGLSTGPHLHYEIRKNSKP 266

Query: 73  MDP 75
           +DP
Sbjct: 267 VDP 269


>gi|158339674|ref|YP_001520681.1| D-alanyl-D-alanine carboxypeptidase, putative [Acaryochloris marina
            MBIC11017]
 gi|158309915|gb|ABW31531.1| D-alanyl-D-alanine carboxypeptidase, putative [Acaryochloris marina
            MBIC11017]
          Length = 1082

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 13   GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRK-NAI 71
            GN + I+H    VTVY H+    VQ G  V +G  I LSG SG    P +HFE+R  +  
Sbjct: 1014 GNFVFIQHSSGYVTVYGHLSATNVQIGDPVKQGQVIALSGNSGRTTGPHLHFEIRDPSGQ 1073

Query: 72   AMDPIKFL 79
             ++P  FL
Sbjct: 1074 RLNPANFL 1081


>gi|21221797|ref|NP_627576.1| peptidase [Streptomyces coelicolor A3(2)]
 gi|256787026|ref|ZP_05525457.1| peptidase (secreted protein) [Streptomyces lividans TK24]
 gi|4585600|emb|CAB40868.1| putative peptidase (putative secreted protein) [Streptomyces
           coelicolor A3(2)]
          Length = 228

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 3/78 (3%)

Query: 8   DLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR 67
           D    GN I+I+H +   + Y+H+    V+ GQ V  G +I  SG +GN+  P +HFE+R
Sbjct: 147 DGPAYGNAIVIKHGNGTYSQYAHLSRINVKIGQIVKTGQSIAKSGNTGNSSGPHLHFEIR 206

Query: 68  KN---AIAMDPIKFLEEK 82
                  A+DP+ FL  K
Sbjct: 207 TTPNYGSAVDPVAFLRGK 224


>gi|313903653|ref|ZP_07837043.1| Peptidase M23 [Thermaerobacter subterraneus DSM 13965]
 gi|313466206|gb|EFR61730.1| Peptidase M23 [Thermaerobacter subterraneus DSM 13965]
          Length = 282

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 43/72 (59%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           + G  + + H     T+Y H+++  V+ GQKV+RG  +G +G +GNA  P +H E+R + 
Sbjct: 185 DYGLAVEVVHPGGWSTLYGHLESLAVEPGQKVTRGQLLGWAGATGNATGPHLHLEVRADG 244

Query: 71  IAMDPIKFLEEK 82
              DP+ +L+ +
Sbjct: 245 GFFDPLAWLDPR 256


>gi|325982715|ref|YP_004295117.1| peptidase M23 [Nitrosomonas sp. AL212]
 gi|325532234|gb|ADZ26955.1| Peptidase M23 [Nitrosomonas sp. AL212]
          Length = 355

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 50/78 (64%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+I+H+++ ++ Y+H     V++G+ V++G  I   G + +    Q
Sbjct: 275 VVYSGHGLRGYGNLIIIKHNNTFLSAYAHNSRLLVKEGEAVAKGQKIAEMGNT-DTDMTQ 333

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RK+   +DP+++L
Sbjct: 334 LHFEIRKHGKPVDPLEYL 351


>gi|323700412|ref|ZP_08112324.1| Peptidase M23 [Desulfovibrio sp. ND132]
 gi|323460344|gb|EGB16209.1| Peptidase M23 [Desulfovibrio desulfuricans ND132]
          Length = 300

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 42/74 (56%), Gaps = 1/74 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI VG D    GN++ + H + +V++Y H+    V+ G  V RG TIGL+G +G A  P 
Sbjct: 215 VILVG-DHYYAGNSVYVDHGNGVVSMYFHLSESTVKVGDAVRRGQTIGLTGMTGRATGPH 273

Query: 62  VHFELRKNAIAMDP 75
           +HF L      +DP
Sbjct: 274 LHFSLSVQGDLVDP 287


>gi|289770919|ref|ZP_06530297.1| peptidase [Streptomyces lividans TK24]
 gi|289701118|gb|EFD68547.1| peptidase [Streptomyces lividans TK24]
          Length = 208

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 3/78 (3%)

Query: 8   DLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR 67
           D    GN I+I+H +   + Y+H+    V+ GQ V  G +I  SG +GN+  P +HFE+R
Sbjct: 127 DGPAYGNAIVIKHGNGTYSQYAHLSRINVKIGQIVKTGQSIAKSGNTGNSSGPHLHFEIR 186

Query: 68  KN---AIAMDPIKFLEEK 82
                  A+DP+ FL  K
Sbjct: 187 TTPNYGSAVDPVAFLRGK 204


>gi|167469970|ref|ZP_02334674.1| hypothetical protein YpesF_19264 [Yersinia pestis FV-1]
          Length = 340

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +H+E   N  A
Sbjct: 245 GNYVVIRHGRQYTTHYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEFWMNQQA 304

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 305 VNP---LTAKLP 313


>gi|134298665|ref|YP_001112161.1| peptidase M23B [Desulfotomaculum reducens MI-1]
 gi|134051365|gb|ABO49336.1| peptidase M23B [Desulfotomaculum reducens MI-1]
          Length = 352

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 39/68 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++++H D  VTVY H+    V  G  V +G  I LSG +G +  P +HFE+RK    
Sbjct: 279 GYCVMMKHPDETVTVYGHLSDIKVTMGDNVKQGQVIALSGNTGRSTGPHLHFEVRKANNL 338

Query: 73  MDPIKFLE 80
            +P+ +L+
Sbjct: 339 CNPMDWLK 346


>gi|169830176|ref|YP_001700334.1| metalloprotease yebA [Lysinibacillus sphaericus C3-41]
 gi|168994664|gb|ACA42204.1| Hypothetical metalloprotease yebA precursor [Lysinibacillus
           sphaericus C3-41]
          Length = 493

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 42/67 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I H++   T+Y H+ +  V+ GQ V +G  IG+ G +GN+    +HFE+ KN   
Sbjct: 425 GNRIVINHNNGYTTLYGHLSSINVEVGQVVEKGSVIGIMGSTGNSTGTHLHFEVEKNGSL 484

Query: 73  MDPIKFL 79
           ++P+ ++
Sbjct: 485 VNPLSYV 491


>gi|163749991|ref|ZP_02157235.1| lipoprotein NlpD [Shewanella benthica KT99]
 gi|161330265|gb|EDQ01246.1| lipoprotein NlpD [Shewanella benthica KT99]
          Length = 274

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q VS G T+   G +G      
Sbjct: 184 VVYAGSALRGYGNLVIIKHSDDFLSAYAHADKILVKEKQFVSMGQTLATMGNTG-TDRVM 242

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R +  +++P+K+L +
Sbjct: 243 LHFEIRYHGKSVNPLKYLPK 262


>gi|15603479|ref|NP_246553.1| hypothetical protein PM1614 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12722011|gb|AAK03698.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 467

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H ++  V+  Q+V  G  I   G SG     +
Sbjct: 388 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNESILVKDQQEVRAGQQIAKMGSSGT-NSVK 446

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L ++
Sbjct: 447 LHFEIRYKGKSVDPTRYLPKR 467


>gi|317402459|gb|EFV83028.1| peptidase family M23/M37 protein [Achromobacter xylosoxidans C54]
          Length = 327

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H D ++T Y+H  +  V++GQ V RG  +   G SG +  P +HFE+R     
Sbjct: 241 GNMVEIDHGDGLITRYAHASSLMVKQGQLVERGQQVARVGSSGRSTGPHLHFEVRLAGQP 300

Query: 73  MDPIKFL 79
           +DP  FL
Sbjct: 301 LDPRLFL 307


>gi|229847189|ref|ZP_04467293.1| lipoprotein [Haemophilus influenzae 7P49H1]
 gi|229809865|gb|EEP45587.1| lipoprotein [Haemophilus influenzae 7P49H1]
          Length = 405

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVVDQQEVKAGQDIAKMGSSG-TNAVK 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 385 LHFEVRYKGKSVDPVRYLPRR 405


>gi|254448973|ref|ZP_05062427.1| Fe-S type hydro-lyases tartrate/fumarate alpha region [gamma
           proteobacterium HTCC5015]
 gi|198261367|gb|EDY85658.1| Fe-S type hydro-lyases tartrate/fumarate alpha region [gamma
           proteobacterium HTCC5015]
          Length = 304

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 40/70 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H +  VT Y H  +  V +GQ V +G  I   G +G +  P VHFE+ +N   
Sbjct: 235 GNLVEISHGNGYVTRYGHNKSVLVTEGQAVKKGEVISKMGSTGRSTGPHVHFEVIQNGRK 294

Query: 73  MDPIKFLEEK 82
           +DP+K++ ++
Sbjct: 295 IDPVKYISQR 304


>gi|113461643|ref|YP_719712.1| lipoprotein B [Haemophilus somnus 129PT]
 gi|112823686|gb|ABI25775.1| lipoprotein B [Haemophilus somnus 129PT]
          Length = 290

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+I+H+DS ++ Y+H ++  V+  Q+V  G  I   G SG     +
Sbjct: 211 VVYAGDALRGYGNLIIIKHNDSYLSAYAHNESILVKDQQEVKAGQQIAKMGSSG-TNTIK 269

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    ++DP+++L
Sbjct: 270 LHFEIRYKGQSVDPMRYL 287


>gi|37519967|ref|NP_923344.1| hypothetical protein glr0398 [Gloeobacter violaceus PCC 7421]
 gi|35210959|dbj|BAC88339.1| glr0398 [Gloeobacter violaceus PCC 7421]
          Length = 251

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 40/68 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +LI H     T Y+H+D+  VQ G  V  G  IG +G +G ++ P +HFEL  N   
Sbjct: 67  GNAVLIDHGGGWKTRYAHLDSVRVQAGAPVEAGKPIGRAGNTGLSKGPHLHFELLHNGRP 126

Query: 73  MDPIKFLE 80
           +DP+ +L+
Sbjct: 127 VDPMPYLQ 134


>gi|254505836|ref|ZP_05117981.1| membrane protein [Vibrio parahaemolyticus 16]
 gi|219551059|gb|EED28039.1| membrane protein [Vibrio parahaemolyticus 16]
          Length = 409

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 39/65 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H     T Y H+    V+KGQKVSRG  IGLSG +G    P +H+EL     A
Sbjct: 300 GNYVVIQHGSRYKTRYLHLSKILVRKGQKVSRGQRIGLSGATGRVTGPHIHYELLDRGRA 359

Query: 73  MDPIK 77
           ++ +K
Sbjct: 360 VNAMK 364


>gi|126651968|ref|ZP_01724160.1| Membrane protein [Bacillus sp. B14905]
 gi|126591237|gb|EAZ85346.1| Membrane protein [Bacillus sp. B14905]
          Length = 508

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 42/67 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I H++   T+Y H+ +  V+ GQ V +G  IG+ G +GN+    +HFE+ KN   
Sbjct: 440 GNRIVINHNNGYTTLYGHLSSINVEVGQVVEKGSVIGIMGSTGNSTGTHLHFEVEKNGSL 499

Query: 73  MDPIKFL 79
           ++P+ ++
Sbjct: 500 VNPLSYV 506


>gi|304440623|ref|ZP_07400507.1| M23/M37 family peptidase [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304370810|gb|EFM24432.1| M23/M37 family peptidase [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 392

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
            + +   L   GN +++ H  S VTVY+H+    V++G +V +G  +GL G +G +  P 
Sbjct: 316 TVLMARTLGSYGNVVMVDHG-STVTVYAHLSVIKVRQGDRVDKGQVVGLVGSTGLSTGPH 374

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N    +P+ F+
Sbjct: 375 LHFEVRVNGTPQNPLNFV 392


>gi|300871512|ref|YP_003786385.1| LysM domain/M23/M37 peptidase domain-containing protein
           [Brachyspira pilosicoli 95/1000]
 gi|300689213|gb|ADK31884.1| LysM domain/M23/M37 peptidase domain protein [Brachyspira
           pilosicoli 95/1000]
          Length = 392

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 38/68 (55%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            GN +++RHD    T Y H++      G  V  G  IG  G +GN+    +HFE+R+N +
Sbjct: 316 FGNLVIVRHDKGYTTYYGHLNKITTTVGANVGVGVMIGRMGSTGNSTGSHLHFEVRRNGV 375

Query: 72  AMDPIKFL 79
           A++P  F+
Sbjct: 376 ALNPADFI 383


>gi|293603452|ref|ZP_06685877.1| membrane-bound metalloendopeptidase [Achromobacter piechaudii ATCC
           43553]
 gi|292818154|gb|EFF77210.1| membrane-bound metalloendopeptidase [Achromobacter piechaudii ATCC
           43553]
          Length = 328

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 38/68 (55%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            GN + I H D ++T Y+H  +  V++GQ V RG  +   G SG +  P +HFE+R    
Sbjct: 240 FGNMVEIDHGDGLITRYAHASSLMVKQGQLVERGQQVARVGSSGRSTGPHLHFEVRLAGQ 299

Query: 72  AMDPIKFL 79
            +DP  FL
Sbjct: 300 PLDPRLFL 307


>gi|223041604|ref|ZP_03611803.1| outer membrane antigenic lipoprotein B precursor [Actinobacillus
           minor 202]
 gi|223017579|gb|EEF15991.1| outer membrane antigenic lipoprotein B precursor [Actinobacillus
           minor 202]
          Length = 409

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V  G  I   G +G   + +
Sbjct: 330 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDSVRAGEKIATLGSTGTTSN-K 388

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L ++
Sbjct: 389 LHFEIRYKGKSVDPTRYLPKQ 409


>gi|212711930|ref|ZP_03320058.1| hypothetical protein PROVALCAL_03005 [Providencia alcalifaciens DSM
           30120]
 gi|212685452|gb|EEB44980.1| hypothetical protein PROVALCAL_03005 [Providencia alcalifaciens DSM
           30120]
          Length = 441

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +HFE+  N  A
Sbjct: 346 GNFIAIRHGRQYTTRYMHLRQLLVKPGQKVKRGDRIALSGNTGRSTGPHLHFEMWVNQQA 405

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 406 VNP---LTAKLP 414


>gi|188025999|ref|ZP_02960499.2| hypothetical protein PROSTU_02450 [Providencia stuartii ATCC 25827]
 gi|188021221|gb|EDU59261.1| hypothetical protein PROSTU_02450 [Providencia stuartii ATCC 25827]
          Length = 440

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +HFE+  N  A
Sbjct: 345 GNFIAIRHGRQYTTRYMHLRQLLVKPGQKVKRGDRIALSGNTGRSTGPHLHFEMWVNQQA 404

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 405 VNP---LTAKLP 413


>gi|323698075|ref|ZP_08109987.1| Peptidase M23 [Desulfovibrio sp. ND132]
 gi|323458007|gb|EGB13872.1| Peptidase M23 [Desulfovibrio desulfuricans ND132]
          Length = 301

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G D    G  I ++H+ S+ T ++H++   ++ GQ+V+RG  IG  G +G +  P 
Sbjct: 223 VTFAGRD-GSYGLCIRLKHNASLTTRFAHLNRIAIKSGQEVTRGELIGYVGNTGRSTGPH 281

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N + ++P +++
Sbjct: 282 LHYEVRLNGVPVNPKRYI 299


>gi|260655310|ref|ZP_05860798.1| peptidase, M23/M37 family [Jonquetella anthropi E3_33 E1]
 gi|260629758|gb|EEX47952.1| peptidase, M23/M37 family [Jonquetella anthropi E3_33 E1]
          Length = 392

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  +++ H + + TVY+H+    VQ+G KVS G T+G  G SG A    +HFE+R    A
Sbjct: 324 GQIVILDHGNQMSTVYAHLSAITVQEGAKVSAGSTVGRVGSSGVATATHLHFEVRIGGTA 383

Query: 73  MDPIKFL 79
            +P+ +L
Sbjct: 384 KNPVDYL 390


>gi|253989944|ref|YP_003041300.1| hypothetical protein PAU_02465 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781394|emb|CAQ84557.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 437

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I IRH     T Y H+    V+ GQKV RG  IGLSG +G +  P +H+E   N  A
Sbjct: 342 GNFIAIRHGRQYTTRYMHLRKLLVKPGQKVKRGDRIGLSGSTGRSTGPHLHYEFWINQQA 401

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 402 VNP---LTAKLP 410


>gi|209694432|ref|YP_002262360.1| exported peptidase [Aliivibrio salmonicida LFI1238]
 gi|208008383|emb|CAQ78538.1| exported peptidase [Aliivibrio salmonicida LFI1238]
          Length = 446

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H    +T Y H+    V+KGQKVS G  I LSG +G +  P +H+EL KN  A
Sbjct: 350 GNYVIIKHGREYMTRYLHLSKILVKKGQKVSMGDKIALSGNTGRSTGPHLHYELIKNGRA 409

Query: 73  MDPIK 77
           ++ +K
Sbjct: 410 VNAMK 414


>gi|326334673|ref|ZP_08200880.1| peptidase M23B [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325693123|gb|EGD35055.1| peptidase M23B [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 432

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRHD +  T Y H+     ++GQ VS+G  IGL G +G A  P V +   KN + 
Sbjct: 312 GNYVKIRHDKTYETQYLHMSKIIARRGQHVSQGDIIGLVGSTGLATGPHVCYRFWKNGVQ 371

Query: 73  MDPIKFLEEKIP 84
           +DP+K   E++P
Sbjct: 372 IDPLK---ERLP 380


>gi|253573895|ref|ZP_04851237.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251846372|gb|EES74378.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 515

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I H +   T+Y H+    V+KGQ V +G  IG+ G +G +    +HFE+ KN   
Sbjct: 449 GNCIIIDHKNGYETLYGHLSKISVKKGQIVEKGEKIGVMGSTGRSTGTHLHFEIHKNGSI 508

Query: 73  MDPIKFL 79
            +P+K+L
Sbjct: 509 QNPLKYL 515


>gi|145639464|ref|ZP_01795069.1| outer membrane antigenic lipoprotein B [Haemophilus influenzae
           PittII]
 gi|145271511|gb|EDK11423.1| outer membrane antigenic lipoprotein B [Haemophilus influenzae
           PittII]
          Length = 405

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSG-TNTVK 384

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    ++DP+++L
Sbjct: 385 LHFEIRYKGKSVDPVRYL 402


>gi|297618451|ref|YP_003703610.1| peptidase M23 [Syntrophothermus lipocalidus DSM 12680]
 gi|297146288|gb|ADI03045.1| Peptidase M23 [Syntrophothermus lipocalidus DSM 12680]
          Length = 282

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G   V  G T++I+H  +  T+Y H     V+KGQKV RG  I   G SG +  P 
Sbjct: 204 VIFAGWKPV-YGQTVIIKHPGNKTTLYGHASKIKVKKGQKVRRGQVIAEVGSSGVSTGPH 262

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R +    +P+ FL
Sbjct: 263 LHFEVRVDDEVKNPLLFL 280


>gi|121607092|ref|YP_994899.1| peptidase M23B [Verminephrobacter eiseniae EF01-2]
 gi|121551732|gb|ABM55881.1| peptidase M23B [Verminephrobacter eiseniae EF01-2]
          Length = 295

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ +   GN I+++H+++ +T Y+H  +  VQ+ Q V +G  I   G + +A   +
Sbjct: 216 VVYAGSAIRGYGNLIILKHNNTFLTAYAHNRSLQVQEEQTVRKGQKIAEMGDT-DADRVK 274

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+N   +DP ++L  +
Sbjct: 275 LHFEIRRNGRPVDPSRYLPAR 295


>gi|121605472|ref|YP_982801.1| peptidase M23B [Polaromonas naphthalenivorans CJ2]
 gi|120594441|gb|ABM37880.1| peptidase M23B [Polaromonas naphthalenivorans CJ2]
          Length = 301

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN I+++H+++ +T Y+H  +  V++ Q V +G  I   G S +++  +
Sbjct: 222 VVYSGAGLRGYGNLIILKHNNTFLTAYAHNKSLLVKEDQTVKKGQKIAEMGNS-DSEKVK 280

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP K+L  K
Sbjct: 281 LHFEIRRQGKPVDPAKYLPAK 301


>gi|332308185|ref|YP_004436036.1| Peptidase M23 [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332175514|gb|AEE24768.1| Peptidase M23 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 273

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++++H DS ++ Y+H D+  V++ Q V  G  I   GKSG +   +
Sbjct: 194 VVYTGDALRGYGKLVIVKHSDSFLSAYAHNDSILVKEQQWVRAGQKIATMGKSG-SDTVK 252

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L ++
Sbjct: 253 LHFEVRYKGQSVDPSRYLPKR 273


>gi|269837678|ref|YP_003319906.1| peptidase M23 [Sphaerobacter thermophilus DSM 20745]
 gi|269786941|gb|ACZ39084.1| Peptidase M23 [Sphaerobacter thermophilus DSM 20745]
          Length = 407

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G+ ++I H + I T Y H  +  V  G++V RG  + LSG +G +    VH+E+R N   
Sbjct: 337 GSLVVIDHGNGISTYYGHNSSVLVSPGERVERGQVVALSGNTGRSTGAHVHYEIRVNGTP 396

Query: 73  MDPIKFL 79
           +DP  FL
Sbjct: 397 VDPSPFL 403


>gi|20808379|ref|NP_623550.1| membrane proteins related to metalloendopeptidase
           [Thermoanaerobacter tengcongensis MB4]
 gi|20516991|gb|AAM25154.1| Membrane proteins related to metalloendopeptidases
           [Thermoanaerobacter tengcongensis MB4]
          Length = 389

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 40/65 (61%)

Query: 16  ILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDP 75
           ++I H D I T+Y+H     V++G  V RG  I   G +G +  P +HFE+RKN + ++P
Sbjct: 325 VIIDHGDGISTLYAHCSALLVKEGDTVKRGQVIAKIGSTGLSTGPHLHFEVRKNGVPVNP 384

Query: 76  IKFLE 80
           + +L+
Sbjct: 385 MDWLK 389


>gi|260913884|ref|ZP_05920358.1| M23 family peptidase [Pasteurella dagmatis ATCC 43325]
 gi|260631971|gb|EEX50148.1| M23 family peptidase [Pasteurella dagmatis ATCC 43325]
          Length = 514

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+IRH     TVY H+    V+ GQ + RG  I LSG +G +  P +H+E   N  A
Sbjct: 419 GRYIMIRHGREYQTVYMHLSRSLVKAGQSIKRGQRIALSGNTGRSTGPHLHYEFHINGRA 478

Query: 73  MDPIK 77
           ++P+K
Sbjct: 479 VNPLK 483


>gi|219685977|ref|ZP_03540766.1| LysM domain/M23/M37 peptidase domain protein [Borrelia garinii
           Far04]
 gi|219672483|gb|EED29533.1| LysM domain/M23/M37 peptidase domain protein [Borrelia garinii
           Far04]
          Length = 157

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+ VG +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 78  IVVTVGFNAGGYGKYIIISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 137

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 138 HLHFTIFKNGKTENPMKYLR 157


>gi|227356593|ref|ZP_03840980.1| lipoprotein [Proteus mirabilis ATCC 29906]
 gi|227163349|gb|EEI48276.1| lipoprotein [Proteus mirabilis ATCC 29906]
          Length = 374

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+D  ++ Y+H DT  V++ Q V+ G  I   G +G +   +
Sbjct: 295 VVYAGSALRGYGNLVIIKHNDEYLSAYAHNDTILVREQQNVNAGQQIATMGSTGTSSV-R 353

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+ +L ++
Sbjct: 354 LHFEIRYKEKSLNPMSYLPKR 374


>gi|261366894|ref|ZP_05979777.1| membrane peptidase [Subdoligranulum variabile DSM 15176]
 gi|282571008|gb|EFB76543.1| membrane peptidase [Subdoligranulum variabile DSM 15176]
          Length = 271

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 40/68 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H +   T+Y+H+   +V  G++VS G  +G  G++GNA  P +HFEL    I 
Sbjct: 201 GNYVRILHSNGDETLYAHMQYLFVHAGEQVSAGDCLGTVGETGNATGPHLHFELLHKGIR 260

Query: 73  MDPIKFLE 80
            DP + L+
Sbjct: 261 YDPSEALQ 268


>gi|121998210|ref|YP_001002997.1| peptidase M23B [Halorhodospira halophila SL1]
 gi|121589615|gb|ABM62195.1| peptidase M23B [Halorhodospira halophila SL1]
          Length = 245

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 46/81 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN +++ HDD  ++ Y +  T  VQ+G +VS G  I   G++  A+   
Sbjct: 164 VVYSGSGLRGYGNLVILMHDDRFLSAYGYNRTLKVQEGDRVSGGDPIAEMGRAPGAEAAS 223

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +   +DP  +L  +
Sbjct: 224 LHFEIRIDGEVVDPEAYLPAR 244


>gi|332970303|gb|EGK09295.1| LysM domain/M23 peptidase domain protein [Kingella kingae ATCC
           23330]
          Length = 246

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQ-H 59
           MVIY G  L   G  +LI+H + ++T Y+H  T  V K  +V RG  +   G +  A   
Sbjct: 139 MVIYAGEGLRGYGKLMLIQHSNQLITAYAHNQTLLVGKNARVKRGQPVATVGNTARADGR 198

Query: 60  PQVHFELRKNAIAMDPIKFLEEKI 83
             +HFE+R N  A++P  +L   +
Sbjct: 199 SALHFEVRLNGKAVNPAPYLNGAM 222


>gi|197286083|ref|YP_002151955.1| lipoprotein [Proteus mirabilis HI4320]
 gi|194683570|emb|CAR44442.1| lipoprotein [Proteus mirabilis HI4320]
          Length = 374

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+D  ++ Y+H DT  V++ Q V+ G  I   G +G +   +
Sbjct: 295 VVYAGSALRGYGNLVIIKHNDEYLSAYAHNDTILVREQQNVNAGQQIATMGSTGTSSV-R 353

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+ +L ++
Sbjct: 354 LHFEIRYKEKSLNPMSYLPKR 374


>gi|325528379|gb|EGD05523.1| peptidase M23B [Burkholderia sp. TJI49]
          Length = 212

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 4   YVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVH 63
           Y GN L   GN I+++H+   +T Y+H     V++GQ V++G TI   G S ++    +H
Sbjct: 135 YAGNGLRGYGNLIILKHNADYLTAYAHNRALLVKEGQSVTQGQTIAEMGSS-DSDRVALH 193

Query: 64  FELRKNAIAMDPIKFLEEK 82
           FELR    ++DP ++L  +
Sbjct: 194 FELRYGGRSIDPARYLPAR 212


>gi|317153080|ref|YP_004121128.1| peptidase M23 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943331|gb|ADU62382.1| Peptidase M23 [Desulfovibrio aespoeensis Aspo-2]
          Length = 301

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           + + G D    G TI ++H+ S+ T Y+H+    V+ GQ V+RG  +G  G +G +  P 
Sbjct: 223 ITFTGRD-GSYGLTIRLKHNASLSTRYAHLHRISVKDGQVVTRGELVGYVGTTGRSTGPH 281

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N + +DP +++
Sbjct: 282 LHYEVRLNGVPVDPKRYI 299


>gi|84684979|ref|ZP_01012879.1| peptidase, M23/M37 family [Maritimibacter alkaliphilus HTCC2654]
 gi|84667314|gb|EAQ13784.1| peptidase, M23/M37 family [Rhodobacterales bacterium HTCC2654]
          Length = 410

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 43/68 (63%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I ++H+  + T Y+H+    V+KGQ+VSRG  IG  G SG +  P +H+E+R    A
Sbjct: 337 GRLIKVQHEFGLETRYAHLSRIRVKKGQRVSRGDLIGDMGNSGRSTGPHLHYEVRVGGKA 396

Query: 73  MDPIKFLE 80
           ++P+ +++
Sbjct: 397 VNPMTYIK 404


>gi|116622668|ref|YP_824824.1| peptidase M23B [Candidatus Solibacter usitatus Ellin6076]
 gi|116225830|gb|ABJ84539.1| peptidase M23B [Candidatus Solibacter usitatus Ellin6076]
          Length = 300

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  +++ H + + T Y+H+    V  GQ+V RG  +GL G SG    P +H+E+R     
Sbjct: 218 GRLVIVDHGNGVQTYYAHLSKISVHAGQEVRRGEIVGLVGSSGRTTAPHLHYEVRVGGTP 277

Query: 73  MDPIKFL 79
           M+P ++L
Sbjct: 278 MNPSRYL 284


>gi|163839258|ref|YP_001623663.1| peptidase M23B [Renibacterium salmoninarum ATCC 33209]
 gi|162952734|gb|ABY22249.1| peptidase M23B [Renibacterium salmoninarum ATCC 33209]
          Length = 336

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I H + + T Y H  T  V+ GQKVSRG  + LSG +GN+    VHFE+  +   
Sbjct: 270 GNRIVIDHGNGLSTAYLHNTTLQVKVGQKVSRGDLVALSGTTGNSTGCHVHFEVMVDDKT 329

Query: 73  MDPIKFL 79
           +DP+ ++
Sbjct: 330 VDPLGWI 336


>gi|82701631|ref|YP_411197.1| peptidase M23B [Nitrosospira multiformis ATCC 25196]
 gi|82409696|gb|ABB73805.1| peptidase M23B [Nitrosospira multiformis ATCC 25196]
          Length = 360

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   G  I+I+H D+ ++ Y+H     V++G+ V +G  I   G S +A   +
Sbjct: 279 VVYSGEGLRGYGKLIIIKHSDTYLSAYAHNSKLLVKEGETVIKGQKIAEMG-STDAGLVK 337

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RKN   +DP+K+L
Sbjct: 338 LHFEIRKNGKPVDPLKYL 355


>gi|170718645|ref|YP_001783843.1| peptidase M23B [Haemophilus somnus 2336]
 gi|168826774|gb|ACA32145.1| peptidase M23B [Haemophilus somnus 2336]
          Length = 345

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+I+H+DS ++ Y+H ++  V+  Q+V  G  I   G SG     +
Sbjct: 266 VVYAGDALRGYGNLIIIKHNDSYLSAYAHNESILVKDQQEVKAGQQIAKMGSSG-TNTIK 324

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    ++DP+++L
Sbjct: 325 LHFEIRYKGQSVDPMRYL 342


>gi|307312830|ref|ZP_07592460.1| Peptidase M23 [Escherichia coli W]
 gi|306907265|gb|EFN37771.1| Peptidase M23 [Escherichia coli W]
          Length = 372

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDP 75
           +HFE+R    +++P
Sbjct: 359 LHFEIRYKGKSVNP 372


>gi|158338472|ref|YP_001519649.1| peptidase M23 domain-containing protein [Acaryochloris marina
           MBIC11017]
 gi|158308713|gb|ABW30330.1| peptidase M23 domain protein [Acaryochloris marina MBIC11017]
          Length = 411

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 37/67 (55%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H + + T+Y H    YV  GQ V RG TI   G +G +  P +HFE+R     
Sbjct: 345 GNAVIIDHGNGLTTLYGHCSELYVTVGQGVQRGQTIAAVGSTGLSTGPHLHFEVRVQGEP 404

Query: 73  MDPIKFL 79
            +P+ +L
Sbjct: 405 TEPLAYL 411


>gi|311104009|ref|YP_003976862.1| peptidase family M23 [Achromobacter xylosoxidans A8]
 gi|310758698|gb|ADP14147.1| peptidase family M23 family protein 2 [Achromobacter xylosoxidans
           A8]
          Length = 323

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H D ++T Y+H  +  V++GQ V RG  +   G SG +  P +HFE+R     
Sbjct: 241 GNMVEIDHGDGLITRYAHASSLMVKQGQLVERGQQVARVGSSGRSTGPHLHFEVRLAGQP 300

Query: 73  MDPIKFL 79
           +DP  FL
Sbjct: 301 LDPRLFL 307


>gi|307325041|ref|ZP_07604245.1| Peptidase M23 [Streptomyces violaceusniger Tu 4113]
 gi|306889187|gb|EFN20169.1| Peptidase M23 [Streptomyces violaceusniger Tu 4113]
          Length = 264

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN ++I+ +D   T Y H+ +  V  GQKV+ G  IGLSG +GN   P +HFE R +   
Sbjct: 188 GNNVVIKMNDGTYTQYGHLSSISVSVGQKVTPGQQIGLSGATGNVTGPHLHFEARTSPDY 247

Query: 70  AIAMDPIKFL 79
              +DP+ +L
Sbjct: 248 GSDIDPLAYL 257


>gi|299541795|ref|ZP_07052118.1| metalloprotease yebA precursor [Lysinibacillus fusiformis ZC1]
 gi|298725533|gb|EFI66174.1| metalloprotease yebA precursor [Lysinibacillus fusiformis ZC1]
          Length = 486

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I H++   T+Y H+ +  V+ GQ V +G  IG+ G +GN+    +HFE+ KN   
Sbjct: 418 GNRIVINHNNGFTTLYGHLSSINVEVGQVVEKGSVIGIMGSTGNSTGTHLHFEVEKNGSL 477

Query: 73  MDPIKFL 79
            +P+ ++
Sbjct: 478 ENPLSYV 484


>gi|77457358|ref|YP_346863.1| peptidase M23B [Pseudomonas fluorescens Pf0-1]
 gi|77381361|gb|ABA72874.1| putative lipoprotein [Pseudomonas fluorescens Pf0-1]
          Length = 293

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H ++ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 214 VVYAGSGLRGYGELVIIKHSETYVSAYGHNRRLLVREGQQVKVGQTIAEMGSTG-TDRVK 272

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 273 LHFEIRRQGKPVDPLQFLPRR 293


>gi|83999832|emb|CAH60132.1| putative peptidase [Streptomyces tenjimariensis]
          Length = 238

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 6   GNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFE 65
           G D    GN I+++H +   + Y+H+    V+ G KV  G  I LSG +GN+  P +HFE
Sbjct: 155 GGDGPAYGNAIVVKHANGTYSQYAHLSKIKVKPGAKVKTGQVIALSGNTGNSSGPHLHFE 214

Query: 66  LRKN---AIAMDPIKFLEEK 82
           +R       +++P  FL  +
Sbjct: 215 IRTTPNYGSSVNPAAFLRAE 234


>gi|127513383|ref|YP_001094580.1| peptidase M23B [Shewanella loihica PV-4]
 gi|126638678|gb|ABO24321.1| peptidase M23B [Shewanella loihica PV-4]
          Length = 418

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 44/83 (53%), Gaps = 7/83 (8%)

Query: 2   VIYVGNDLVEL-------GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKS 54
           VI  G+ +V L       G  ++I H +   T Y H+    V KGQ+VSRG  I LSGK+
Sbjct: 305 VIAPGDGIVSLVTDHRYAGKYVVIDHGNKYRTRYLHLSKALVHKGQRVSRGQVIALSGKT 364

Query: 55  GNAQHPQVHFELRKNAIAMDPIK 77
           G    P +H+E   N   +DP+K
Sbjct: 365 GRITGPHLHYEFHINGRPVDPMK 387


>gi|295698746|ref|YP_003603401.1| peptidase M23B [Candidatus Riesia pediculicola USDA]
 gi|291157354|gb|ADD79799.1| peptidase M23B [Candidatus Riesia pediculicola USDA]
          Length = 343

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 41/64 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+I+H++ +VT Y H+    V+ GQKV +G  IGLSG +G    P +H+E+   + A
Sbjct: 275 GYFIVIQHENKLVTKYMHLLKLMVKPGQKVKKGQCIGLSGNTGRTTGPHLHYEIWVGSQA 334

Query: 73  MDPI 76
           +DP+
Sbjct: 335 IDPL 338


>gi|261415839|ref|YP_003249522.1| Peptidase M23 [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|261372295|gb|ACX75040.1| Peptidase M23 [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|302325767|gb|ADL24968.1| peptidase, M23/M37 family [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 266

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + GN   +LGNTI+I H +   + YSH+ +   ++G  V++G  IG  G +GN   P 
Sbjct: 188 VTFAGNS-GDLGNTIVIDHQNGYKSSYSHLKSIRTRRGANVTKGDVIGYVGDTGNTSGPH 246

Query: 62  VHFELRKNAIAMDP 75
           +H+ + KN +  DP
Sbjct: 247 LHYSITKNNLPQDP 260


>gi|307726268|ref|YP_003909481.1| Peptidase M23 [Burkholderia sp. CCGE1003]
 gi|307586793|gb|ADN60190.1| Peptidase M23 [Burkholderia sp. CCGE1003]
          Length = 266

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ +   G  I+I+HDDS++T Y    T  V++G  V++G TIG  G         
Sbjct: 188 VVYAGSGIEAYGPLIIIKHDDSLITAYGQNSTLLVKEGDAVAQGQTIGEVGVDSRGVG-S 246

Query: 62  VHFELRKNAIAMDPIKFL 79
           + FE+R+N   +DP+ +L
Sbjct: 247 IQFEVRQNGQPVDPLAWL 264


>gi|310814915|ref|YP_003962879.1| peptidase, M23/M37 family protein [Ketogulonicigenium vulgare Y25]
 gi|308753650|gb|ADO41579.1| peptidase, M23/M37 family protein [Ketogulonicigenium vulgare Y25]
          Length = 423

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + IRH     T Y+H++   V+ GQ+VSRG  I  SG +G +  P +H+E+R N  A
Sbjct: 350 GRIVKIRHQFGFETRYAHLNEINVRVGQRVSRGDHIADSGNTGRSTGPHLHYEVRVNGAA 409

Query: 73  MDPIKFL 79
            +P+ ++
Sbjct: 410 QNPLNYI 416


>gi|212634212|ref|YP_002310737.1| peptidoglycan-binding LysM:peptidase M23B [Shewanella piezotolerans
           WP3]
 gi|212555696|gb|ACJ28150.1| Peptidoglycan-binding LysM:Peptidase M23B [Shewanella piezotolerans
           WP3]
          Length = 304

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q V+ G T+   G +G      
Sbjct: 225 VVYAGSALRGYGNLVIIKHSDDYLSAYAHADKILVKEKQAVNAGQTVAKMGSTGT-NRVM 283

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+K+L ++
Sbjct: 284 LHFEIRYHGKSVNPLKYLPKQ 304


>gi|325290910|ref|YP_004267091.1| Peptidase M23 [Syntrophobotulus glycolicus DSM 8271]
 gi|324966311|gb|ADY57090.1| Peptidase M23 [Syntrophobotulus glycolicus DSM 8271]
          Length = 467

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ILI H D + T Y+H     V  GQ V +G  IG  G++GNA  P +HFE+  N   
Sbjct: 401 GYMILIDHGDGVETRYAHSSKLAVSAGQSVKKGQVIGYVGRTGNATGPHLHFEVIINGGT 460

Query: 73  MDPIKFL 79
           ++P+K++
Sbjct: 461 VNPLKYI 467


>gi|187920642|ref|YP_001889674.1| peptidase M23 [Burkholderia phytofirmans PsJN]
 gi|187719080|gb|ACD20303.1| Peptidase M23 [Burkholderia phytofirmans PsJN]
          Length = 261

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  +   G  I+I+HDDS++T Y    T  V++G  V++G TIG  G         
Sbjct: 180 VVYAGTGIEAYGPLIIIKHDDSLITAYGQNSTLLVKEGDAVAQGQTIGEVGVDSRGV-AS 238

Query: 62  VHFELRKNAIAMDPIKFL 79
           + FE+R+N   +DP+ +L
Sbjct: 239 IQFEVRQNGQPVDPLAWL 256


>gi|16272646|ref|NP_438864.1| lipoprotein [Haemophilus influenzae Rd KW20]
 gi|260581475|ref|ZP_05849286.1| outer membrane antigenic lipoprotein B [Haemophilus influenzae
           RdAW]
 gi|1170822|sp|P44833|LPPB_HAEIN RecName: Full=Outer membrane antigenic lipoprotein B; Flags:
           Precursor
 gi|1573707|gb|AAC22363.1| lipoprotein [Haemophilus influenzae Rd KW20]
 gi|260091876|gb|EEW75828.1| outer membrane antigenic lipoprotein B [Haemophilus influenzae
           RdAW]
          Length = 405

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSG-TNTVK 384

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    ++DP+++L
Sbjct: 385 LHFEIRYKGKSVDPVRYL 402


>gi|262066965|ref|ZP_06026577.1| cell wall endopeptidase family M23/M37 [Fusobacterium periodonticum
           ATCC 33693]
 gi|291379313|gb|EFE86831.1| cell wall endopeptidase family M23/M37 [Fusobacterium periodonticum
           ATCC 33693]
          Length = 387

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRHD+   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 309 VVTFAGN-MSGYGKIIIIRHDNGYETRYAHLSVISTNVGEHVNQGDLIGKTGNSGRTTGA 367

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L 
Sbjct: 368 HLHFEIRHNGVPKNPMKYLR 387


>gi|254521407|ref|ZP_05133462.1| YgeR [Stenotrophomonas sp. SKA14]
 gi|219718998|gb|EED37523.1| YgeR [Stenotrophomonas sp. SKA14]
          Length = 273

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H D  ++ Y H     V +GQ V  G  I   G++G A   
Sbjct: 193 VVVYSGAGLVGYGELIIIKHSDQWLSAYGHNRKRLVNEGQSVKAGEQIAEMGRTG-ANRD 251

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VHFE+R N   +DP ++L  +
Sbjct: 252 MVHFEIRYNGKPVDPQQYLPAR 273


>gi|150392437|ref|YP_001322486.1| peptidase M23B [Alkaliphilus metalliredigens QYMF]
 gi|149952299|gb|ABR50827.1| peptidase M23B [Alkaliphilus metalliredigens QYMF]
          Length = 481

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H++   T Y+H  +  V+KG +V +G  I   G +G +  P +HFE+RKN   
Sbjct: 413 GNLVIINHENGYQTYYAHNSSLLVKKGDRVYKGEQIAKMGSTGRSTGPHLHFEVRKNGSP 472

Query: 73  MDPIKFL 79
           ++P+ F+
Sbjct: 473 VNPLSFV 479


>gi|145641969|ref|ZP_01797542.1| lipoprotein [Haemophilus influenzae R3021]
 gi|145273335|gb|EDK13208.1| lipoprotein [Haemophilus influenzae 22.4-21]
          Length = 405

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSG-TNTVK 384

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    ++DP+++L
Sbjct: 385 LHFEIRYKGKSVDPVRYL 402


>gi|254448696|ref|ZP_05062154.1| peptidase, M23/M37 family [gamma proteobacterium HTCC5015]
 gi|198261704|gb|EDY85991.1| peptidase, M23/M37 family [gamma proteobacterium HTCC5015]
          Length = 279

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G D    GN++ I H   +++ Y H++  +V+KGQ+V RG T+G  G +G    P
Sbjct: 188 LVVEAG-DFFFNGNSVFIDHGQGVISFYCHLNDIHVKKGQRVERGDTLGEVGATGRVTGP 246

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +H+ +  N   +DP  F+ +
Sbjct: 247 HLHWSVGLNGTWVDPSLFMPD 267


>gi|145631563|ref|ZP_01787330.1| lipoprotein [Haemophilus influenzae R3021]
 gi|144982832|gb|EDJ90354.1| lipoprotein [Haemophilus influenzae R3021]
          Length = 405

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSG-TNTVK 384

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    ++DP+++L
Sbjct: 385 LHFEIRYKGKSVDPVRYL 402


>gi|124268335|ref|YP_001022339.1| hypothetical protein Mpe_A3151 [Methylibium petroleiphilum PM1]
 gi|124261110|gb|ABM96104.1| conserved hypothetical protein [Methylibium petroleiphilum PM1]
          Length = 460

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 7/80 (8%)

Query: 5   VGNDLVEL-------GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNA 57
           VG+ +VE        GN  +IRH     T Y+H+    V++GQ++ +G  +G  G +G A
Sbjct: 339 VGDGVVEFAGWQNGYGNIAIIRHAGDRETRYAHLSRLDVKRGQRIDQGQLVGAVGATGWA 398

Query: 58  QHPQVHFELRKNAIAMDPIK 77
             P +HFE R+     DP+K
Sbjct: 399 TGPHLHFEFRERGQVQDPLK 418


>gi|260582961|ref|ZP_05850744.1| lipoprotein [Haemophilus influenzae NT127]
 gi|260093945|gb|EEW77850.1| lipoprotein [Haemophilus influenzae NT127]
          Length = 405

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSG-TNTVK 384

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    ++DP+++L
Sbjct: 385 LHFEIRYKGKSVDPVRYL 402


>gi|145637593|ref|ZP_01793249.1| lipoprotein [Haemophilus influenzae PittHH]
 gi|148827876|ref|YP_001292629.1| lipoprotein [Haemophilus influenzae PittGG]
 gi|145269190|gb|EDK09137.1| lipoprotein [Haemophilus influenzae PittHH]
 gi|148719118|gb|ABR00246.1| lipoprotein [Haemophilus influenzae PittGG]
          Length = 405

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSG-TNTVK 384

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    ++DP+++L
Sbjct: 385 LHFEIRYKGKSVDPVRYL 402


>gi|304436981|ref|ZP_07396944.1| peptidase M23B [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304369932|gb|EFM23594.1| peptidase M23B [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 371

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H   I T+Y H  +  V  G+ V +G  I   G +GN+  P  HFE+R+N   
Sbjct: 305 GNAVIINHGGGISTLYGHCQSLNVSVGESVLQGDVIAYCGSTGNSTGPHCHFEVRENGEP 364

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 365 VNPLSYL 371


>gi|301169421|emb|CBW29021.1| predicted outer membrane lipoprotein [Haemophilus influenzae 10810]
          Length = 405

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSG-TNTVK 384

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    ++DP+++L
Sbjct: 385 LHFEIRYKGKSVDPVRYL 402


>gi|224368261|ref|YP_002602424.1| putative metallopeptidase [Desulfobacterium autotrophicum HRM2]
 gi|223690977|gb|ACN14260.1| putative metallopeptidase [Desulfobacterium autotrophicum HRM2]
          Length = 395

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 46/69 (66%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H D+  T+Y+H++  + +KG++V     I L+G +G+ +   +HFE+R +   
Sbjct: 325 GNLMIINHGDNFYTLYAHVEEFFKKKGERVDTDEVIALAGDTGSIKGTCLHFEVRHHGRP 384

Query: 73  MDPIKFLEE 81
           +DP+K+L++
Sbjct: 385 VDPMKWLKK 393


>gi|284031498|ref|YP_003381429.1| peptidase M23 [Kribbella flavida DSM 17836]
 gi|283810791|gb|ADB32630.1| Peptidase M23 [Kribbella flavida DSM 17836]
          Length = 704

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H + + T+Y+H+ +  V  G +V+ G  IG  G  GN+  P +HFE+R     
Sbjct: 495 GNLVRIDHGNGLETLYAHLSSITVADGSRVAAGQQIGAVGNEGNSTGPHLHFEVRLGGDP 554

Query: 73  MDPIKFL 79
           ++P+ FL
Sbjct: 555 VNPMSFL 561


>gi|145633762|ref|ZP_01789487.1| lipoprotein [Haemophilus influenzae 3655]
 gi|229845538|ref|ZP_04465666.1| lipoprotein [Haemophilus influenzae 6P18H1]
 gi|144985421|gb|EDJ92248.1| lipoprotein [Haemophilus influenzae 3655]
 gi|229811554|gb|EEP47255.1| lipoprotein [Haemophilus influenzae 6P18H1]
          Length = 405

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSG-TNTVK 384

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    ++DP+++L
Sbjct: 385 LHFEIRYKGKSVDPVRYL 402


>gi|332140080|ref|YP_004425818.1| hypothetical lipoprotein NlpD [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|332143122|ref|YP_004428860.1| hypothetical lipoprotein NlpD [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327550102|gb|AEA96820.1| hypothetical lipoprotein NlpD [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327553144|gb|AEA99862.1| hypothetical lipoprotein NlpD [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 289

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D+ ++ Y++ DT  V++ + VS G  I   G SG     +
Sbjct: 209 VVYSGSALRGYGNLVIIKHTDTFLSAYAYNDTILVKEREWVSAGQQIATMGDSG-TNSVK 267

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    ++DP+K+L
Sbjct: 268 LHFEVRYRGKSLDPMKYL 285


>gi|329120603|ref|ZP_08249266.1| lipoprotein NlpD [Neisseria bacilliformis ATCC BAA-1200]
 gi|327460827|gb|EGF07161.1| lipoprotein NlpD [Neisseria bacilliformis ATCC BAA-1200]
          Length = 299

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V YVG+ +   GN +LI H + ++T Y+H     V+KGQ V  G T+   G S +A+  +
Sbjct: 154 VAYVGDGVRGYGNLVLIAHGNGVITAYAHNSRILVKKGQTVRTGDTVAAMGSS-DAERVK 212

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R +  A++P  +L
Sbjct: 213 LHFEVRISGKAVNPEPYL 230


>gi|317048515|ref|YP_004116163.1| peptidase M23 [Pantoea sp. At-9b]
 gi|316950132|gb|ADU69607.1| Peptidase M23 [Pantoea sp. At-9b]
          Length = 444

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH    +T Y H+    V+ GQKV RG  I LSG +G +  P +H+E+  N  A
Sbjct: 349 GNYVAIRHGRQYMTRYMHLSKVLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEIWINNQA 408

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 409 VNP---LTAKLP 417


>gi|145635555|ref|ZP_01791254.1| lipoprotein [Haemophilus influenzae PittAA]
 gi|145267218|gb|EDK07223.1| lipoprotein [Haemophilus influenzae PittAA]
          Length = 405

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSG-TNTVK 384

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    ++DP+++L
Sbjct: 385 LHFEIRYKGKSVDPVRYL 402


>gi|329121633|ref|ZP_08250254.1| M23 peptidase domain protein [Dialister micraerophilus DSM 19965]
 gi|327468788|gb|EGF14265.1| M23 peptidase domain protein [Dialister micraerophilus DSM 19965]
          Length = 297

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I+H ++IVT Y H     V  GQKV +G+ I   G +G +  P  H+E+R    A
Sbjct: 227 GNLVEIQHAENIVTRYGHNSIILVNAGQKVEKGNIIAFIGNTGYSTGPHCHYEVRIGGTA 286

Query: 73  MDPIKFLEEKI 83
           ++PI F++ +I
Sbjct: 287 VNPIPFMQTQI 297


>gi|323702614|ref|ZP_08114276.1| Peptidase M23 [Desulfotomaculum nigrificans DSM 574]
 gi|323532433|gb|EGB22310.1| Peptidase M23 [Desulfotomaculum nigrificans DSM 574]
          Length = 256

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 43/71 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T++I H + I ++Y+H     V +GQ+V+R   I   G +G ++ P +H E+ +  I 
Sbjct: 182 GLTVIIDHGNGIRSLYAHCSKLLVHEGQQVNRREPIARVGNTGRSEGPHLHMEILRQGIP 241

Query: 73  MDPIKFLEEKI 83
           +DP+ FL+E +
Sbjct: 242 LDPLMFLKENL 252


>gi|303240522|ref|ZP_07327038.1| Peptidase M23 [Acetivibrio cellulolyticus CD2]
 gi|302591924|gb|EFL61656.1| Peptidase M23 [Acetivibrio cellulolyticus CD2]
          Length = 307

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 41/70 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H + I T+Y H     V++GQ V +G  I   G +G +  P +HFE+R N   
Sbjct: 238 GKCVIINHSNGITTLYGHASKLLVKEGQNVKKGDVIAKVGSTGRSTGPHLHFEVRVNGNQ 297

Query: 73  MDPIKFLEEK 82
           ++PI +L++K
Sbjct: 298 VNPIDYLDKK 307


>gi|299144272|ref|ZP_07037352.1| peptidase, M23/M37 family [Peptoniphilus sp. oral taxon 386 str.
           F0131]
 gi|298518757|gb|EFI42496.1| peptidase, M23/M37 family [Peptoniphilus sp. oral taxon 386 str.
           F0131]
          Length = 377

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 43/67 (64%), Gaps = 1/67 (1%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H D IVTVY+H  +  V+ GQ VS+G  + L G +G +  P +HFE+R N   
Sbjct: 312 GNVVMVDHGD-IVTVYAHNSSIKVKVGQSVSQGDIVALVGSTGLSTGPHLHFEVRINGQT 370

Query: 73  MDPIKFL 79
           +DP+ +L
Sbjct: 371 VDPMGYL 377


>gi|197285014|ref|YP_002150886.1| hypothetical protein PMI1153 [Proteus mirabilis HI4320]
 gi|227355416|ref|ZP_03839812.1| M23B subfamily peptidase [Proteus mirabilis ATCC 29906]
 gi|194682501|emb|CAR42465.1| putative peptidase [Proteus mirabilis HI4320]
 gi|227164403|gb|EEI49287.1| M23B subfamily peptidase [Proteus mirabilis ATCC 29906]
          Length = 442

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I IRH     T Y H+    V+ GQ+V RG  I LSG +G +  P +H+EL  N  A
Sbjct: 346 GNFIAIRHGSQYTTRYMHLRQLLVKPGQRVKRGDRIALSGNTGRSTGPHLHYELWINQQA 405

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 406 VNP---LTAKLP 414


>gi|298373118|ref|ZP_06983108.1| peptidase, M23/M37 family [Bacteroidetes oral taxon 274 str. F0058]
 gi|298276022|gb|EFI17573.1| peptidase, M23/M37 family [Bacteroidetes oral taxon 274 str. F0058]
          Length = 350

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 37/55 (67%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR 67
           G+ I+IRH++ + T+Y+H+  P V+  Q+V+ G  IGL G +G +  P +HFE R
Sbjct: 206 GHYIVIRHNNGLETLYAHLSKPLVRVNQEVTAGQLIGLGGSTGRSTGPHLHFEFR 260


>gi|298245321|ref|ZP_06969127.1| Peptidase M23 [Ktedonobacter racemifer DSM 44963]
 gi|297552802|gb|EFH86667.1| Peptidase M23 [Ktedonobacter racemifer DSM 44963]
          Length = 396

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 41/78 (52%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+VG D   LGN + I H   I TVY H+ +  V  GQ V++G  +   G +G +  P 
Sbjct: 316 VIWVGWDWSGLGNAVKINHGRYIATVYGHLASYIVHVGQNVNKGDVVAYEGSTGASSGPH 375

Query: 62  VHFELRKNAIAMDPIKFL 79
           VHF +  N    DP  ++
Sbjct: 376 VHFMVVDNNHFKDPTLYM 393


>gi|297190361|ref|ZP_06907759.1| peptidase [Streptomyces pristinaespiralis ATCC 25486]
 gi|197720385|gb|EDY64293.1| peptidase [Streptomyces pristinaespiralis ATCC 25486]
          Length = 418

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           G  I+IRH D   + Y+H+    V+ GQ+VS G  I  SG +GN+  P +HFE+R     
Sbjct: 342 GYEIVIRHSDGRYSQYAHLSALTVRAGQQVSAGQRIARSGSTGNSTGPHLHFEIRTGPGY 401

Query: 70  AIAMDPIKFLEEK 82
              +DP+ +L  +
Sbjct: 402 GSDIDPLAYLRAR 414


>gi|146281945|ref|YP_001172098.1| lipoprotein NlpD [Pseudomonas stutzeri A1501]
 gi|145570150|gb|ABP79256.1| lipoprotein NlpD [Pseudomonas stutzeri A1501]
          Length = 271

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 192 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 250

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 251 LHFEIRRQGKPVDPLQYLPRR 271


>gi|225023367|ref|ZP_03712559.1| hypothetical protein EIKCOROL_00225 [Eikenella corrodens ATCC
           23834]
 gi|224943845|gb|EEG25054.1| hypothetical protein EIKCOROL_00225 [Eikenella corrodens ATCC
           23834]
          Length = 220

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V YVG  +   G  ILI H   ++T Y+H     V++GQ+VS G TI   G SG     +
Sbjct: 142 VSYVGEGIRGYGKLILINHTGGMLTAYAHNSQISVREGQQVSAGQTIATMGSSGT-DRVK 200

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N  A++P+ +L
Sbjct: 201 LHFEVRVNNRAVNPMDYL 218


>gi|189346015|ref|YP_001942544.1| Peptidase M23 [Chlorobium limicola DSM 245]
 gi|189340162|gb|ACD89565.1| Peptidase M23 [Chlorobium limicola DSM 245]
          Length = 223

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G D    G  + I H     T+Y+H+    V++GQ++SRG  I LSG +G +  P
Sbjct: 122 IVTYSGYDR-GYGQQVTISHGYGFKTLYAHLSKSLVRQGQRISRGEIIALSGNTGMSTGP 180

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E++K+ I ++P  + 
Sbjct: 181 HLHYEVQKDNIKVNPAAYF 199


>gi|309751696|gb|ADO81680.1| Outer membrane antigenic lipoprotein B [Haemophilus influenzae
           R2866]
          Length = 405

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSG-TNTVK 384

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    ++DP+++L
Sbjct: 385 LHFEIRYKGKSVDPVRYL 402


>gi|150025984|ref|YP_001296810.1| secreted M23/M37 family peptidase [Flavobacterium psychrophilum
           JIP02/86]
 gi|149772525|emb|CAL44008.1| Probable secreted M23/M37 family peptidase [Flavobacterium
           psychrophilum JIP02/86]
          Length = 325

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 40/67 (59%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            GN I+I+H     T+Y+H+     + GQ V+RG  IG  G +G ++ P  H+E+ KN  
Sbjct: 234 FGNHIVIQHGFGYETLYAHLSRYNKRAGQHVNRGDIIGFVGSTGRSEAPHCHYEVHKNGN 293

Query: 72  AMDPIKF 78
           A++PI F
Sbjct: 294 AINPINF 300


>gi|254488155|ref|ZP_05101360.1| peptidase, M23/M37 family [Roseobacter sp. GAI101]
 gi|214045024|gb|EEB85662.1| peptidase, M23/M37 family [Roseobacter sp. GAI101]
          Length = 323

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 11  ELGNTILIRHDDSIVTVYSHID--TPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRK 68
           E GN ++I H D   T Y H+   +  V+ GQ VS G  +G  G+SG A  P VH  +RK
Sbjct: 115 ECGNGVVIDHGDGWETQYCHLKQGSVLVKSGQDVSAGQELGFVGQSGKAAFPHVHLSVRK 174

Query: 69  NAIAMDP 75
           + + +DP
Sbjct: 175 DGMVVDP 181


>gi|28900372|ref|NP_800027.1| hypothetical protein VPA0517 [Vibrio parahaemolyticus RIMD 2210633]
 gi|28808683|dbj|BAC61860.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 427

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H +   T Y H+    V+KGQKVSRG  IGLSGK+G    P +H+EL +    
Sbjct: 327 GNYVVVEHGNKYKTRYLHLSKILVKKGQKVSRGQRIGLSGKTGRVTGPHLHYELIEYG-- 384

Query: 73  MDPIKFLEEKIP 84
             P+  +   IP
Sbjct: 385 -RPVNAMRANIP 395


>gi|126442274|ref|YP_001058553.1| peptidase [Burkholderia pseudomallei 668]
 gi|126221767|gb|ABN85273.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei 668]
          Length = 236

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+   +T Y+H     V++GQ V++G  I   G + N     
Sbjct: 157 VVYAGNGLRGYGNLLIVKHNADFLTTYAHNRALLVKEGQTVAQGQKIAEMGDTDN-DRVA 215

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 216 LHFELRYGGRSIDPARYLPSR 236


>gi|328470329|gb|EGF41240.1| hypothetical protein VP10329_06012 [Vibrio parahaemolyticus 10329]
          Length = 427

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H +   T Y H+    V+KGQKVSRG  IGLSGK+G    P +H+EL +    
Sbjct: 327 GNYVVVEHGNKYKTRYLHLSKILVKKGQKVSRGQRIGLSGKTGRVTGPHLHYELIEYG-- 384

Query: 73  MDPIKFLEEKIP 84
             P+  +   IP
Sbjct: 385 -RPVNAMRANIP 395


>gi|327480190|gb|AEA83500.1| lipoprotein NlpD [Pseudomonas stutzeri DSM 4166]
          Length = 271

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 192 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 250

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 251 LHFEIRRQGKPVDPLQYLPRR 271


>gi|186686114|ref|YP_001869310.1| peptidase M23B [Nostoc punctiforme PCC 73102]
 gi|186468566|gb|ACC84367.1| peptidase M23B [Nostoc punctiforme PCC 73102]
          Length = 779

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI- 71
           GN + IRH D   T Y+H     VQ GQ+V +G TI L G +G++  P  HFE+  +   
Sbjct: 708 GNLVEIRHPDGSTTRYAHNSKILVQPGQQVHQGETIALMGSTGHSTGPHTHFEIHPSGKG 767

Query: 72  AMDPIKFLEEKI 83
           A++PI  L ++I
Sbjct: 768 AVNPIAMLPDRI 779


>gi|237653676|ref|YP_002889990.1| peptidase M23 [Thauera sp. MZ1T]
 gi|237624923|gb|ACR01613.1| Peptidase M23 [Thauera sp. MZ1T]
          Length = 274

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H+    +VY+H D   V++  +V++G  I   G S  A  P+
Sbjct: 195 VVYAGSGLRGYGKLIVIKHNQEYNSVYAHNDKLLVKEDDQVAQGQKIAELGSS-EADRPK 253

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK   A+DP  +L  +
Sbjct: 254 LHFEIRKQGKAVDPTGYLPAR 274


>gi|19703812|ref|NP_603374.1| cell wall endopeptidase [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|19713960|gb|AAL94673.1| Cell wall endopeptidase family M23/M37 [Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586]
          Length = 321

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+I+HD+   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 243 VVTFAGN-MSGYGKIIIIKHDNGYETRYAHLSVISTNVGEHVNKGDLIGKTGNSGRTTGA 301

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 302 HLHFEIRHNGVPKNPMKYLQ 321


>gi|15889135|ref|NP_354816.1| membrane protein associated metalloendopeptidase [Agrobacterium
           tumefaciens str. C58]
 gi|15156945|gb|AAK87601.1| membrane protein associated metalloendopeptidase [Agrobacterium
           tumefaciens str. C58]
          Length = 432

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H   + T + H+    V+ G +V  G  IG +G +G +  P VH+E+R+N   
Sbjct: 355 GNMVEIDHGQGVSTRFGHLSAILVRAGDRVEAGDVIGRAGSTGRSTGPHVHYEVRRNDTP 414

Query: 73  MDPIKFL 79
           +DP+++L
Sbjct: 415 VDPMRYL 421


>gi|303232144|ref|ZP_07318847.1| peptidase, M23 family [Veillonella atypica ACS-049-V-Sch6]
 gi|302513250|gb|EFL55289.1| peptidase, M23 family [Veillonella atypica ACS-049-V-Sch6]
          Length = 398

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H + + T+Y H     V +GQ V++G  I  +G +GN+  P VHFE+R N   
Sbjct: 332 GYAVVIDHGNGLSTLYGHNSELAVDEGQSVAKGQVISYAGSTGNSTGPHVHFEVRVNGDP 391

Query: 73  MDPIKFL 79
           +DP+ +L
Sbjct: 392 VDPMGYL 398


>gi|260589238|ref|ZP_05855151.1| peptidase, M23/M37 family protein [Blautia hansenii DSM 20583]
 gi|260540319|gb|EEX20888.1| peptidase, M23/M37 family protein [Blautia hansenii DSM 20583]
          Length = 431

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H +   TVY H    YV+ GQKVS G  I   G +G +  P +HF + KN + 
Sbjct: 365 GNYVTIDHGNGFYTVYMHASARYVKVGQKVSAGQQIAAVGSTGYSTGPHLHFGVMKNGVY 424

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 425 VNPMNYL 431


>gi|331082646|ref|ZP_08331769.1| hypothetical protein HMPREF0992_00693 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330400265|gb|EGG79907.1| hypothetical protein HMPREF0992_00693 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 431

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H +   TVY H    YV+ GQKVS G  I   G +G +  P +HF + KN + 
Sbjct: 365 GNYVTIDHGNGFYTVYMHASARYVKVGQKVSAGQQIAAVGSTGYSTGPHLHFGVMKNGVY 424

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 425 VNPMNYL 431


>gi|220933180|ref|YP_002510088.1| peptidase M23B [Halothermothrix orenii H 168]
 gi|219994490|gb|ACL71093.1| peptidase M23B [Halothermothrix orenii H 168]
          Length = 334

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H     T Y+H++   V+KGQ V RG  I LSG SG +  P +H+E+RKN I 
Sbjct: 266 GWVVKIYHGFGFETRYAHLNRIKVKKGQWVKRGQVIALSGNSGKSTGPHLHYEVRKNNIP 325

Query: 73  MDPIKFL 79
            +P  ++
Sbjct: 326 QNPRNYI 332


>gi|220911687|ref|YP_002486996.1| peptidase M23 [Arthrobacter chlorophenolicus A6]
 gi|219858565|gb|ACL38907.1| Peptidase M23 [Arthrobacter chlorophenolicus A6]
          Length = 276

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VG      GN +++ H + + T Y+H+ +  V +GQ VSRG  I LSG +G +    
Sbjct: 199 VTFVGWHQYGGGNRVVVDHGNGLETTYNHLSSFNVTEGQTVSRGDVIALSGTTGASTGCH 258

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE++ N   +DP  +L
Sbjct: 259 LHFEVQVNGEVVDPTGWL 276


>gi|308094520|ref|ZP_05889681.2| peptidase [Vibrio parahaemolyticus AN-5034]
 gi|308095558|ref|ZP_05906859.2| peptidase [Vibrio parahaemolyticus Peru-466]
 gi|308125406|ref|ZP_05775092.2| peptidase [Vibrio parahaemolyticus K5030]
 gi|308126603|ref|ZP_05911299.2| peptidase [Vibrio parahaemolyticus AQ4037]
 gi|308085027|gb|EFO34722.1| peptidase [Vibrio parahaemolyticus Peru-466]
 gi|308090766|gb|EFO40461.1| peptidase [Vibrio parahaemolyticus AN-5034]
 gi|308107824|gb|EFO45364.1| peptidase [Vibrio parahaemolyticus AQ4037]
 gi|308113837|gb|EFO51377.1| peptidase [Vibrio parahaemolyticus K5030]
          Length = 404

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H +   T Y H+    V+KGQKVSRG  IGLSGK+G    P +H+EL +    
Sbjct: 304 GNYVVVEHGNKYKTRYLHLSKILVKKGQKVSRGQRIGLSGKTGRVTGPHLHYELIEYG-- 361

Query: 73  MDPIKFLEEKIP 84
             P+  +   IP
Sbjct: 362 -RPVNAMRANIP 372


>gi|303247858|ref|ZP_07334126.1| Peptidase M23 [Desulfovibrio fructosovorans JJ]
 gi|302490759|gb|EFL50660.1| Peptidase M23 [Desulfovibrio fructosovorans JJ]
          Length = 292

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+I HD  + T+Y+H+    V+ G++V RG  IGLSG SG      +H+E+R +   
Sbjct: 224 GLRIVISHDFGLETIYAHMQKAEVKPGEQVKRGQRIGLSGNSGRTTGAHLHYEVRVDDTP 283

Query: 73  MDPIKFL 79
           ++P ++L
Sbjct: 284 VNPRRYL 290


>gi|253577443|ref|ZP_04854758.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843143|gb|EES71176.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 324

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 42/69 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN IL++H + +V++Y H+    V++ Q+V +G  IG  G +G +  P +H E+R N   
Sbjct: 252 GNAILLQHANGLVSLYGHLTDIGVRQRQQVLQGEVIGWVGSTGKSTGPHLHLEIRVNGQK 311

Query: 73  MDPIKFLEE 81
           +DP+ +  +
Sbjct: 312 VDPLPYFRQ 320


>gi|225619789|ref|YP_002721046.1| putative metalloendopeptidase-like membrane protein [Brachyspira
           hyodysenteriae WA1]
 gi|225214608|gb|ACN83342.1| putative metalloendopeptidase-like membrane protein [Brachyspira
           hyodysenteriae WA1]
          Length = 393

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++RHD    T Y H+++   + G  V  G  IG  G +G +    +HFE+R+N +A
Sbjct: 317 GNLVIVRHDKGYTTYYGHLNSITTKAGATVGVGVMIGRMGSTGRSTGSHLHFEVRRNGVA 376

Query: 73  MDPIKFL 79
           ++P  F+
Sbjct: 377 LNPADFI 383


>gi|254362197|ref|ZP_04978312.1| M23B subfamily peptidase/lipoprotein [Mannheimia haemolytica
           PHL213]
 gi|153093769|gb|EDN74708.1| M23B subfamily peptidase/lipoprotein [Mannheimia haemolytica
           PHL213]
          Length = 426

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H D  ++ Y+H +T  V + + V  G  I   G +G   + +
Sbjct: 347 VVYAGNALQGYGNLIIIKHTDDFLSAYAHNNTIEVDEQETVKAGQKIATLGSTGTNTN-K 405

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 406 LHFEIRYKGKSVDPARYLPRK 426


>gi|158317726|ref|YP_001510234.1| peptidase M23B [Frankia sp. EAN1pec]
 gi|158113131|gb|ABW15328.1| peptidase M23B [Frankia sp. EAN1pec]
          Length = 284

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 4/81 (4%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G +    GN + I H++++VT Y H+    V+ GQ+V+ G  IGL G +G +  P 
Sbjct: 198 VIYAGWE-SGYGNFVQIMHENNVVTSYGHLSRIDVRLGQEVATGEQIGLEGNTGKSTGPH 256

Query: 62  VHFELRKN---AIAMDPIKFL 79
           +HFE+R N      +DP+ +L
Sbjct: 257 LHFEVRLNGQYGTKVDPLTWL 277


>gi|307267155|ref|ZP_07548664.1| Peptidase M23 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306917840|gb|EFN48105.1| Peptidase M23 [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 301

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  L   GN ++I H   I +VY H     V+  Q V RG  I  SG +G +  P
Sbjct: 220 VVTYAGW-LSGYGNVVIIDHGYGIQSVYGHNSQILVKVSQSVKRGDIIAKSGNTGRSTGP 278

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+R N   +DP+K+L +
Sbjct: 279 HVHFEIRVNGNPVDPMKYLAK 299


>gi|303229894|ref|ZP_07316670.1| peptidase, M23 family [Veillonella atypica ACS-134-V-Col7a]
 gi|302515450|gb|EFL57416.1| peptidase, M23 family [Veillonella atypica ACS-134-V-Col7a]
          Length = 398

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H + + T+Y H     V +GQ V++G  I  +G +GN+  P VHFE+R N   
Sbjct: 332 GYAVVIDHGNGLSTLYGHNSELAVDEGQSVAKGQVISYAGSTGNSTGPHVHFEVRVNGDP 391

Query: 73  MDPIKFL 79
           +DP+ +L
Sbjct: 392 VDPMGYL 398


>gi|194365239|ref|YP_002027849.1| peptidase M23 [Stenotrophomonas maltophilia R551-3]
 gi|194348043|gb|ACF51166.1| Peptidase M23 [Stenotrophomonas maltophilia R551-3]
          Length = 261

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H D  ++ Y H     V +GQ V  G  I   G++G A   
Sbjct: 181 VVVYSGAGLVGYGELIIIKHSDQWLSAYGHNRKRLVNEGQSVKAGEQIAEMGRTG-ANRD 239

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VHFE+R N   +DP ++L  +
Sbjct: 240 MVHFEIRYNGKPVDPQQYLPAR 261


>gi|261492213|ref|ZP_05988779.1| M23B subfamily peptidase/lipoprotein [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261495100|ref|ZP_05991565.1| M23B subfamily peptidase/lipoprotein [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261309235|gb|EEY10473.1| M23B subfamily peptidase/lipoprotein [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261312133|gb|EEY13270.1| M23B subfamily peptidase/lipoprotein [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 426

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H D  ++ Y+H +T  V + + V  G  I   G +G   + +
Sbjct: 347 VVYAGNALQGYGNLIIIKHTDDFLSAYAHNNTIEVDEQETVKAGQKIATLGSTGTNTN-K 405

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 406 LHFEIRYKGKSVDPARYLPRK 426


>gi|305666369|ref|YP_003862656.1| putative peptidase [Maribacter sp. HTCC2170]
 gi|88708361|gb|EAR00598.1| putative peptidase [Maribacter sp. HTCC2170]
          Length = 325

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 44/77 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+   N+    G  I I H    +++Y+H+    V+KGQKV RG  IG  G +G ++ P 
Sbjct: 224 VVRADNNASGYGKHIRIDHGYGYLSLYAHMSNYNVKKGQKVKRGDLIGFVGNTGRSEAPH 283

Query: 62  VHFELRKNAIAMDPIKF 78
           +H+E+ K+   ++PI F
Sbjct: 284 LHYEVWKDKERINPINF 300


>gi|117925252|ref|YP_865869.1| peptidase M23B [Magnetococcus sp. MC-1]
 gi|117609008|gb|ABK44463.1| peptidase M23B [Magnetococcus sp. MC-1]
          Length = 293

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  +++RHD    T+Y+H+    V+ G  V +G  I LSG SG +  P +H+E+R     
Sbjct: 185 GQLVMVRHDFGFRTIYAHLSKTLVKAGSFVGKGDVIALSGNSGKSSGPHLHYEVRFVHRK 244

Query: 73  MDPIKFL 79
           +DP +F+
Sbjct: 245 LDPARFV 251


>gi|288921658|ref|ZP_06415927.1| Peptidase M23 [Frankia sp. EUN1f]
 gi|288346927|gb|EFC81235.1| Peptidase M23 [Frankia sp. EUN1f]
          Length = 285

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 4/81 (4%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           +IY G +    GN + I H++++VT Y H+    V+ GQ+V  G  IGL G +G +  P 
Sbjct: 199 IIYAGWE-TGYGNFVQIMHENNVVTSYGHLSRIDVRVGQEVDTGEQIGLEGNTGKSTGPH 257

Query: 62  VHFELRKN---AIAMDPIKFL 79
           +HFE+R N      +DP+ +L
Sbjct: 258 LHFEVRLNGQYGTKVDPLAWL 278


>gi|255596869|ref|XP_002536637.1| Glycyl-glycine endopeptidase ALE-1 precursor, putative [Ricinus
           communis]
 gi|223519024|gb|EEF25747.1| Glycyl-glycine endopeptidase ALE-1 precursor, putative [Ricinus
           communis]
          Length = 420

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + + H   + T Y H+    V+ G+K+     IG +G +G +  P VH+E+R N  A
Sbjct: 343 GNMVEVDHGKGVTTRYGHLSQILVRTGEKIELSDVIGKAGSTGRSTGPHVHYEVRLNDEA 402

Query: 73  MDPIKFL 79
           +DP++FL
Sbjct: 403 VDPMRFL 409


>gi|325295608|ref|YP_004282122.1| peptidase M23 [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325066056|gb|ADY74063.1| Peptidase M23 [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 247

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 41/74 (55%)

Query: 3   IYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQV 62
           + +  D    GNTI+I H   I T+Y+H+    V++GQ V  G  IG  G +G +  P +
Sbjct: 166 VVLARDFYYTGNTIVIDHGLGIYTLYAHLSKILVKEGQIVQAGQKIGKVGSTGRSTGPHL 225

Query: 63  HFELRKNAIAMDPI 76
           HF +  N I +DPI
Sbjct: 226 HFGIYVNGIKVDPI 239


>gi|253576059|ref|ZP_04853392.1| peptidase [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251844634|gb|EES72649.1| peptidase [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 408

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (57%), Gaps = 5/76 (6%)

Query: 4   YVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVH 63
           Y+GN     GN I+I+HD  I T Y H+D   V+ GQ+V  G  I  SG +G +  P +H
Sbjct: 183 YMGN----AGNAIMIQHD-GIETRYYHLDKIKVESGQEVEAGEEIAESGNTGGSTGPHLH 237

Query: 64  FELRKNAIAMDPIKFL 79
           FE+R N   ++P+ + 
Sbjct: 238 FEVRVNGEPVNPLVYF 253


>gi|169830497|ref|YP_001716479.1| peptidase M23B [Candidatus Desulforudis audaxviator MP104C]
 gi|169637341|gb|ACA58847.1| peptidase M23B [Candidatus Desulforudis audaxviator MP104C]
          Length = 374

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVG  L   GN I++ H   + T+Y+H+ T  V +GQ V++G TI   G +G +  P 
Sbjct: 297 VLYVGT-LRGYGNVIVLDHGGGVTTLYAHLSTMGVSEGQIVAQGETIARVGSTGLSTGPH 355

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF +R++   + P  +L
Sbjct: 356 LHFTVREHGEVVSPWNYL 373


>gi|153837382|ref|ZP_01990049.1| NlpD protein [Vibrio parahaemolyticus AQ3810]
 gi|149749297|gb|EDM60076.1| NlpD protein [Vibrio parahaemolyticus AQ3810]
          Length = 331

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H +   T Y H+    V+KGQKVSRG  IGLSGK+G    P +H+EL +    
Sbjct: 231 GNYVVVEHGNKYKTRYLHLSKILVKKGQKVSRGQRIGLSGKTGRVTGPHLHYELIEYG-- 288

Query: 73  MDPIKFLEEKIP 84
             P+  +   IP
Sbjct: 289 -RPVNAMRANIP 299


>gi|125972621|ref|YP_001036531.1| peptidase M23B [Clostridium thermocellum ATCC 27405]
 gi|281416813|ref|ZP_06247833.1| Peptidase M23 [Clostridium thermocellum JW20]
 gi|125712846|gb|ABN51338.1| peptidase M23B [Clostridium thermocellum ATCC 27405]
 gi|281408215|gb|EFB38473.1| Peptidase M23 [Clostridium thermocellum JW20]
          Length = 291

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G + +  G  I I+H + I+++Y+H     V KGQ V +G T+   G +G +Q P 
Sbjct: 210 VIEAGENQI-YGKYIKIKHGEDIISLYAHCSDLLVSKGQNVKKGETVAKVGNTGTSQEPH 268

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+ +    ++P+ +++
Sbjct: 269 LHFEVWEKGTPVNPLDYIQ 287


>gi|315932380|gb|EFV11323.1| peptidase family M23 family protein [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 273

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 43/80 (53%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++ +  D    GN+++I H   I + Y H+    V+ GQK+ +G  IGLSG SG    P 
Sbjct: 188 IVKIAKDRYFAGNSVVIDHGFGIYSQYYHLSKINVKVGQKIKKGELIGLSGASGRVSGPH 247

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HF +      +DP+ F+ +
Sbjct: 248 LHFGILAGGKQVDPLDFVSK 267


>gi|269959927|ref|ZP_06174304.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269835226|gb|EEZ89308.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 439

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFEL 66
           GN ++I H     T Y H+    V+KGQKVSRG  IGLSGK+G    P +H+EL
Sbjct: 339 GNYVVIEHGSKYKTRYLHLSKILVKKGQKVSRGQRIGLSGKTGRVTGPHLHYEL 392


>gi|260910270|ref|ZP_05916947.1| M23/M37 family peptidase [Prevotella sp. oral taxon 472 str. F0295]
 gi|260635774|gb|EEX53787.1| M23/M37 family peptidase [Prevotella sp. oral taxon 472 str. F0295]
          Length = 414

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 38/63 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+IRHD+ + T+YSH     V+ GQ V  G  IGL+G++G A    +HFE+      
Sbjct: 322 GNCIVIRHDNGLETLYSHQSRNLVKVGQAVKAGDVIGLTGRTGRATTEHLHFEVSFKGRR 381

Query: 73  MDP 75
           +DP
Sbjct: 382 IDP 384



 Score = 37.4 bits (85), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSG-KSGNAQ 58
           + GN ++IRHD+ + TVY+H     V+  Q V  G +I + G KSG  +
Sbjct: 100 QWGNVVVIRHDNGLETVYAHNAQNLVKPNQMVEAGQSIAIVGTKSGKGR 148


>gi|327394168|dbj|BAK11590.1| peptidase YebA [Pantoea ananatis AJ13355]
          Length = 422

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH    +T Y H+    V+ G+KV RG  I LSG +G +  P +HFE+  N  A
Sbjct: 327 GNYVAIRHGRQYMTRYMHLKKVLVKPGEKVKRGDRIALSGNTGRSTGPHLHFEIWINNQA 386

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 387 VNP---LTAKLP 395


>gi|300723107|ref|YP_003712405.1| putative peptidase protein YebA [Xenorhabdus nematophila ATCC
           19061]
 gi|297629622|emb|CBJ90225.1| putative peptidase protein YebA [Xenorhabdus nematophila ATCC
           19061]
          Length = 439

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 37/72 (51%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +HFE   N   
Sbjct: 344 GNFIAIRHGRQYTTRYMHLRKLLVKPGQKVKRGERIALSGNTGRSTGPHLHFEFWDNK-- 401

Query: 73  MDPIKFLEEKIP 84
             P+  L  K+P
Sbjct: 402 -QPVNPLTAKLP 412


>gi|317130983|ref|YP_004097265.1| peptidase M23 [Bacillus cellulosilyticus DSM 2522]
 gi|315475931|gb|ADU32534.1| Peptidase M23 [Bacillus cellulosilyticus DSM 2522]
          Length = 484

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 42/67 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GNTI I H++ + T+Y+H+D+  V  GQ V +G  IG+ G +GN+    +HFE+  N   
Sbjct: 416 GNTIRINHNNGMETMYAHLDSIDVSVGQTVGQGQKIGIMGSTGNSTGVHLHFEVYVNGQL 475

Query: 73  MDPIKFL 79
            +P+ +L
Sbjct: 476 KNPMDYL 482


>gi|220904226|ref|YP_002479538.1| peptidase M23 [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
 gi|219868525|gb|ACL48860.1| Peptidase M23 [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
          Length = 336

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 38/75 (50%)

Query: 8   DLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR 67
           DL   GN + I H + + T Y H+    V +GQ V +G  IGL G +G    P +H  L 
Sbjct: 240 DLYFSGNVVYINHGEGVFTAYLHMSKILVAQGQPVRKGEVIGLVGATGRVTGPHLHLSLL 299

Query: 68  KNAIAMDPIKFLEEK 82
              +++DP  FL  K
Sbjct: 300 VQGVSVDPQPFLAVK 314


>gi|28200487|gb|AAO31614.1| lipoprotein D [Vibrio vulnificus]
          Length = 269

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+ +H+D+ ++ Y+H D   V +GQ V  G  I   G SG A+   
Sbjct: 192 VVYSGNALRGYGNLIIGKHNDNYLSAYAHNDRLLVSEGQSVKAGQQIATMGSSG-AKTVM 250

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 251 LHFEIRYQGKSVNPKRYL 268


>gi|332529100|ref|ZP_08405064.1| peptidase M23 [Hylemonella gracilis ATCC 19624]
 gi|332041323|gb|EGI77685.1| peptidase M23 [Hylemonella gracilis ATCC 19624]
          Length = 339

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+I+H+++ +T Y+H     V++ Q V RG  I   G S +A   +
Sbjct: 260 VVYAGSGLRGYGNLIIIKHNNTYLTAYAHNRALLVKEDQAVKRGQKIAEMGNS-DADRVK 318

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    ++P ++L ++
Sbjct: 319 LHFEVRRQGKPVNPAQYLPKR 339


>gi|296125657|ref|YP_003632909.1| peptidase M23 [Brachyspira murdochii DSM 12563]
 gi|296017473|gb|ADG70710.1| Peptidase M23 [Brachyspira murdochii DSM 12563]
          Length = 412

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++RHD    T Y H+++   + G  V  G  IG  G +G +    +HFE+R+N +A
Sbjct: 336 GNLVIVRHDKGYTTYYGHLNSITTKAGANVGVGVMIGRMGSTGRSTGSHLHFEVRRNGVA 395

Query: 73  MDPIKFL 79
           ++P  F+
Sbjct: 396 LNPADFI 402


>gi|298529922|ref|ZP_07017324.1| Peptidase M23 [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509296|gb|EFI33200.1| Peptidase M23 [Desulfonatronospira thiodismutans ASO3-1]
          Length = 359

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H +   TVY+H     VQ+G +V +G  I  SG +G +  P +HFE+R+  +A
Sbjct: 279 GNKVILEHPNGWKTVYAHNSKNLVQEGDRVDQGQEIARSGNTGRSTGPHLHFEVRQGDMA 338

Query: 73  MDP 75
            DP
Sbjct: 339 WDP 341


>gi|113867190|ref|YP_725679.1| M23B family peptidase [Ralstonia eutropha H16]
 gi|113525966|emb|CAJ92311.1| putative peptidase, M23B subfamily [Ralstonia eutropha H16]
          Length = 236

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 47/80 (58%), Gaps = 5/80 (6%)

Query: 3   IYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQV 62
           I+VGN L   G  ++++H D  +TVY ++D P V +G +VS G  +G  G S +    ++
Sbjct: 161 IHVGN-LRGYGMLVIVKHSDDWLTVYGNLDQPLVTEGAQVSAGQDVGRMGASPS----EL 215

Query: 63  HFELRKNAIAMDPIKFLEEK 82
           HFE+R N   +DP  +L  +
Sbjct: 216 HFEVRGNGKPVDPAAYLPSR 235


>gi|291617749|ref|YP_003520491.1| YebA [Pantoea ananatis LMG 20103]
 gi|291152779|gb|ADD77363.1| YebA [Pantoea ananatis LMG 20103]
          Length = 443

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH    +T Y H+    V+ G+KV RG  I LSG +G +  P +HFE+  N  A
Sbjct: 348 GNYVAIRHGRQYMTRYMHLKKVLVKPGEKVKRGDRIALSGNTGRSTGPHLHFEIWINNQA 407

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 408 VNP---LTAKLP 416


>gi|326316272|ref|YP_004233944.1| peptidase M23 [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323373108|gb|ADX45377.1| Peptidase M23 [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 299

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN ++++H+++ +T Y+H  T  V++ Q V RG  I   G S +    +
Sbjct: 220 VVYAGAGLRGYGNLVILKHNNTYLTAYAHNQTLLVKEDQSVRRGQKIAEMGSS-DTDRVK 278

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 279 LHFEIRRQGKPVDPARYLPAR 299


>gi|260426841|ref|ZP_05780820.1| LysM domain protein [Citreicella sp. SE45]
 gi|260421333|gb|EEX14584.1| LysM domain protein [Citreicella sp. SE45]
          Length = 405

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 44/64 (68%), Gaps = 3/64 (4%)

Query: 16  ILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDP 75
           +++RH D ++++Y+H+D   V+KG  VSRG TIG   +SG+     +HFE+RK   ++DP
Sbjct: 344 VVVRHADDVLSIYTHVDNLTVEKGSSVSRGQTIG-KVRSGDPSF--LHFEVRKGFDSVDP 400

Query: 76  IKFL 79
           + +L
Sbjct: 401 MSYL 404


>gi|218462793|ref|ZP_03502884.1| Peptidase M23 [Rhizobium etli Kim 5]
          Length = 440

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + + H + I T Y H+    V+ G  V R + IGL+G +G +    +H+E+R+N  A
Sbjct: 363 GNMVEVDHGNGISTRYGHMSQVLVKVGDTVGRNNVIGLAGSTGRSTGTHLHYEVRQNGQA 422

Query: 73  MDPIKFL 79
           +DP+ F+
Sbjct: 423 VDPVYFM 429


>gi|256004708|ref|ZP_05429684.1| Peptidase M23 [Clostridium thermocellum DSM 2360]
 gi|255991301|gb|EEU01407.1| Peptidase M23 [Clostridium thermocellum DSM 2360]
 gi|316941141|gb|ADU75175.1| Peptidase M23 [Clostridium thermocellum DSM 1313]
          Length = 305

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G + +  G  I I+H + I+++Y+H     V KGQ V +G T+   G +G +Q P 
Sbjct: 224 VIEAGENQI-YGKYIKIKHGEDIISLYAHCSDLLVSKGQNVKKGETVAKVGNTGTSQEPH 282

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+ +    ++P+ +++
Sbjct: 283 LHFEVWEKGTPVNPLDYIQ 301


>gi|226329890|ref|ZP_03805408.1| hypothetical protein PROPEN_03803 [Proteus penneri ATCC 35198]
 gi|225200685|gb|EEG83039.1| hypothetical protein PROPEN_03803 [Proteus penneri ATCC 35198]
          Length = 441

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 37/64 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I IRH     T Y H+    V+ GQ+V RG  I LSG +G +  P +H+EL  N  A
Sbjct: 345 GNFIAIRHGSQYTTRYMHLRQLLVKPGQRVKRGDRIALSGNTGRSTGPHLHYELWINQQA 404

Query: 73  MDPI 76
           ++P+
Sbjct: 405 VNPL 408


>gi|254469903|ref|ZP_05083308.1| peptidase M23B [Pseudovibrio sp. JE062]
 gi|211961738|gb|EEA96933.1| peptidase M23B [Pseudovibrio sp. JE062]
          Length = 407

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 43/67 (64%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G ++ I HD+ ++T Y+H+    V +GQ+V+ G  +G  G +G +  P +H+E+R N   
Sbjct: 318 GLSVEIVHDNGLITRYAHMQKLLVSEGQRVNMGDLVGTVGNTGRSTGPHLHYEVRLNGKP 377

Query: 73  MDPIKFL 79
           ++P++F+
Sbjct: 378 VNPMRFI 384


>gi|89901552|ref|YP_524023.1| peptidase M23B [Rhodoferax ferrireducens T118]
 gi|89346289|gb|ABD70492.1| peptidase M23B [Rhodoferax ferrireducens T118]
          Length = 292

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVG  L   GN I+++H+++ +T Y+H  T  +++ Q V +G  I   G S ++   +
Sbjct: 213 VVYVGAGLRGYGNLIILKHNNTYLTAYAHNKTLLIKEDQSVRKGQKIAEMGSS-DSDRVK 271

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 272 LHFEVRRQGKPVDPARYLPAR 292


>gi|83591217|ref|YP_431226.1| peptidase M23B [Moorella thermoacetica ATCC 39073]
 gi|83574131|gb|ABC20683.1| Peptidase M23B [Moorella thermoacetica ATCC 39073]
          Length = 297

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H + + TVY+H     V++G+ V  G  I   G +GNA  P VHFE+R+   A
Sbjct: 229 GRMVKIDHGNGLETVYAHTSRNLVKEGEYVQAGEAIAEVGATGNASGPHVHFEVREKGKA 288

Query: 73  MDPIKFL 79
           ++P +FL
Sbjct: 289 VNPERFL 295


>gi|326318399|ref|YP_004236071.1| peptidase M23 [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323375235|gb|ADX47504.1| Peptidase M23 [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 328

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 37/67 (55%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H + +VT Y+H    +V++G  V RG  I   G +G +  P +HFE+    + 
Sbjct: 240 GNMVEIDHGNQLVTRYAHASRTFVKRGDLVRRGQKIAEVGTTGRSTGPHLHFEVLVQGVP 299

Query: 73  MDPIKFL 79
            DP KFL
Sbjct: 300 QDPQKFL 306


>gi|22299509|ref|NP_682756.1| putative peptidase [Thermosynechococcus elongatus BP-1]
 gi|217121|dbj|BAA02464.1| hypothetical protein [Synechococcus elongatus]
 gi|22295692|dbj|BAC09518.1| tlr1966 [Thermosynechococcus elongatus BP-1]
          Length = 284

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 39/69 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GNT+ I H   ++T+Y H+D   VQ+GQ V  G  IG  G +G A  P +H+ L  N   
Sbjct: 213 GNTVGIDHGQGVLTIYLHLDQIRVQEGQMVEAGEVIGTVGNTGAATGPHLHWGLYVNGEC 272

Query: 73  MDPIKFLEE 81
           +DP  +L +
Sbjct: 273 VDPRSWLTQ 281


>gi|325283036|ref|YP_004255577.1| Peptidase M23 [Deinococcus proteolyticus MRP]
 gi|324314845|gb|ADY25960.1| Peptidase M23 [Deinococcus proteolyticus MRP]
          Length = 346

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  GN  V  G  ++I H   ++++Y H+    V+ GQ V RG  IG  G +G +  P 
Sbjct: 265 VVLAGNYPVR-GGLVVIDHGAGLLSMYFHLSKIDVKPGQSVDRGQKIGEVGSTGYSTGPH 323

Query: 62  VHFELRKNAIAMDPIKFLEEKIP 84
           +H ELR    A+DP +++ +++P
Sbjct: 324 LHLELRLRGEAVDPARWVGQQLP 346


>gi|311070166|ref|YP_003975089.1| forespore protein required for alternative engulfment [Bacillus
           atrophaeus 1942]
 gi|310870683|gb|ADP34158.1| forespore protein required for alternative engulfment [Bacillus
           atrophaeus 1942]
          Length = 295

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 50/88 (56%), Gaps = 11/88 (12%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSG------KSG 55
           V+    D V LG+ + I H D + TVY  +    V++G KV +   IG SG      KSG
Sbjct: 142 VVKAAKDPV-LGHVVEIEHADGLSTVYQSLSEVGVEQGDKVKQNQVIGKSGENLYSEKSG 200

Query: 56  NAQHPQVHFELRKNAIAMDPIKFLEEKI 83
           N     VHFE+RK+ +AM+P+ F+++ +
Sbjct: 201 N----HVHFEIRKDGVAMNPLNFMDKPV 224


>gi|326775065|ref|ZP_08234330.1| Transglycosylase-like domain protein [Streptomyces cf. griseus
           XylebKG-1]
 gi|326655398|gb|EGE40244.1| Transglycosylase-like domain protein [Streptomyces cf. griseus
           XylebKG-1]
          Length = 450

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           G  ++IRH+D   + Y+H+   +V+ GQ VS G  I  SG +GN+  P +HFE+R     
Sbjct: 374 GYEVVIRHNDGKYSQYAHLSALHVRAGQSVSGGQRIARSGSTGNSTGPHLHFEIRTGPGY 433

Query: 70  AIAMDPIKFL 79
              +DP+ +L
Sbjct: 434 GSDVDPLAYL 443


>gi|182434538|ref|YP_001822257.1| M23 family secreted peptidase [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178463054|dbj|BAG17574.1| putative M23-family secreted peptidase [Streptomyces griseus subsp.
           griseus NBRC 13350]
          Length = 450

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           G  ++IRH+D   + Y+H+   +V+ GQ VS G  I  SG +GN+  P +HFE+R     
Sbjct: 374 GYEVVIRHNDGKYSQYAHLSALHVRAGQSVSGGQRIARSGSTGNSTGPHLHFEIRTGPGY 433

Query: 70  AIAMDPIKFL 79
              +DP+ +L
Sbjct: 434 GSDVDPLAYL 443


>gi|296327835|ref|ZP_06870372.1| cell wall metalloendopeptidase [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|296155049|gb|EFG95829.1| cell wall metalloendopeptidase [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 372

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+I+HD+   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 294 VVTFAGN-MSGYGKIIIIKHDNGYETRYAHLSVISTNVGEHVNKGDLIGKTGNSGRTTGA 352

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 353 HLHFEIRHNGVPKNPMKYLQ 372


>gi|323529518|ref|YP_004231670.1| peptidase M23 [Burkholderia sp. CCGE1001]
 gi|323386520|gb|ADX58610.1| Peptidase M23 [Burkholderia sp. CCGE1001]
          Length = 278

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ +   G  I+I+HDDS++T Y    T  V++G  V++G TIG  G         
Sbjct: 200 VVYAGSGIEAYGPLIIIKHDDSLITAYGQNSTLLVKEGDAVAQGQTIGEVGVDSRGVG-A 258

Query: 62  VHFELRKNAIAMDPIKFL 79
           + FE+R+N   +DP+ +L
Sbjct: 259 IQFEVRQNGQPVDPLAWL 276


>gi|264676688|ref|YP_003276594.1| peptidase M23B [Comamonas testosteroni CNB-2]
 gi|262207200|gb|ACY31298.1| peptidase M23B [Comamonas testosteroni CNB-2]
          Length = 452

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/64 (39%), Positives = 36/64 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I + H +   TVY+H+    V++GQ+V +G  IG  G +G A  P +HFE R     
Sbjct: 345 GNVIFVDHANQHTTVYAHLSRIDVKRGQRVDQGDIIGAVGSTGWATGPHLHFEFRDKGEQ 404

Query: 73  MDPI 76
            DP+
Sbjct: 405 RDPL 408


>gi|319789804|ref|YP_004151437.1| Peptidase M23 [Thermovibrio ammonificans HB-1]
 gi|317114306|gb|ADU96796.1| Peptidase M23 [Thermovibrio ammonificans HB-1]
          Length = 299

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 40/69 (57%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
           +G  + I+H   I T Y H+    V KG+ VSRG  IG+ G SG +  P +H+ +R +  
Sbjct: 221 MGRCVEIKHGSGIYTYYGHLSKITVFKGEHVSRGMIIGIMGSSGRSTGPHLHYSVRIDGK 280

Query: 72  AMDPIKFLE 80
            ++P+ F+E
Sbjct: 281 LVNPLPFME 289


>gi|296134578|ref|YP_003641820.1| Peptidase M23 [Thiomonas intermedia K12]
 gi|295794700|gb|ADG29490.1| Peptidase M23 [Thiomonas intermedia K12]
          Length = 492

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 36/65 (55%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I I H     TVY+H+ +  V+ GQ VS G  IG +G +G +  P +HFE       
Sbjct: 382 GNVIKIAHPGGFETVYAHLSSIAVKPGQTVSEGQNIGKTGNTGTSTGPHLHFEFHAAGRL 441

Query: 73  MDPIK 77
           +DP++
Sbjct: 442 IDPLR 446


>gi|297201432|ref|ZP_06918829.1| peptidase [Streptomyces sviceus ATCC 29083]
 gi|197713839|gb|EDY57873.1| peptidase [Streptomyces sviceus ATCC 29083]
          Length = 218

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 16  ILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA---IA 72
           I+I+H +   + Y+H+    V+ GQ V  G  I LSG +GN+  P +HFE+R  A    A
Sbjct: 145 IVIKHGNKTYSQYAHLSRIKVKVGQVVKTGQRIALSGNTGNSSGPHLHFEIRTTANYGSA 204

Query: 73  MDPIKFLEEK 82
           +DP+ FL  K
Sbjct: 205 IDPVAFLRAK 214


>gi|239942191|ref|ZP_04694128.1| M23 family secreted peptidase [Streptomyces roseosporus NRRL 15998]
 gi|239988657|ref|ZP_04709321.1| M23 family secreted peptidase [Streptomyces roseosporus NRRL 11379]
 gi|291445645|ref|ZP_06585035.1| peptidase [Streptomyces roseosporus NRRL 15998]
 gi|291348592|gb|EFE75496.1| peptidase [Streptomyces roseosporus NRRL 15998]
          Length = 237

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 8   DLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR 67
           D    GN ++I+H +   + Y+H+    V+ GQ+V  G  I LSG +GN+  P +HFE+R
Sbjct: 156 DGPAYGNAVVIKHSNGKYSQYAHLSKVNVKIGQQVKTGQKIALSGNTGNSSGPHLHFEIR 215

Query: 68  KN---AIAMDPIKFLEE 81
                  A++P  FL  
Sbjct: 216 TTPNYGSALNPAAFLRS 232


>gi|237745061|ref|ZP_04575542.1| cell wall endopeptidase [Fusobacterium sp. 7_1]
 gi|229432290|gb|EEO42502.1| cell wall endopeptidase [Fusobacterium sp. 7_1]
          Length = 365

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRH++   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 287 VVTFAGN-MSGYGKIIIIRHENGYETRYAHLSVISTNVGEHVNKGDLIGKTGNSGRTTGA 345

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 346 HLHFEIRHNGVPKNPMKYLQ 365


>gi|190573707|ref|YP_001971552.1| putative subfamily M23B unassigned peptidase [Stenotrophomonas
           maltophilia K279a]
 gi|190011629|emb|CAQ45248.1| putative subfamily M23B unassigned peptidase [Stenotrophomonas
           maltophilia K279a]
          Length = 269

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H D  ++ Y H     V +GQ V  G  I   G++G A   
Sbjct: 189 VVVYSGAGLVGYGELIIIKHSDQWLSAYGHNRKRLVNEGQSVKAGEQIAEMGRTG-ANRD 247

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VHFE+R N   +DP ++L  +
Sbjct: 248 MVHFEIRYNGKPVDPQQYLPAR 269


>gi|154483757|ref|ZP_02026205.1| hypothetical protein EUBVEN_01461 [Eubacterium ventriosum ATCC
           27560]
 gi|149735248|gb|EDM51134.1| hypothetical protein EUBVEN_01461 [Eubacterium ventriosum ATCC
           27560]
          Length = 420

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 40/68 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I I H + + +VY H+    V  G KVS G +IGL G +G +Q   +HF +RKN   
Sbjct: 353 GNWIGINHGNGVYSVYMHMSALLVSAGTKVSAGQSIGLVGNTGASQGNHLHFAVRKNGAY 412

Query: 73  MDPIKFLE 80
           ++P  +L+
Sbjct: 413 VNPWDYLK 420


>gi|149369736|ref|ZP_01889588.1| putative peptidase [unidentified eubacterium SCB49]
 gi|149357163|gb|EDM45718.1| putative peptidase [unidentified eubacterium SCB49]
          Length = 325

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I I H     ++Y+H+    V+KGQKV RG  IG  G +G ++ P +H+E+ K+ + 
Sbjct: 235 GNHIRIDHGFGYQSLYAHLYKYNVRKGQKVQRGDLIGFVGSTGRSEAPHLHYEVFKDGVR 294

Query: 73  MDPIKF 78
           ++PI F
Sbjct: 295 INPINF 300


>gi|329896374|ref|ZP_08271473.1| Lipoprotein nlpD precursor [gamma proteobacterium IMCC3088]
 gi|328921794|gb|EGG29165.1| Lipoprotein nlpD precursor [gamma proteobacterium IMCC3088]
          Length = 247

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  +   G  ++++HDD+ ++ Y H D+  V +GQ V  G  I   G SG     +
Sbjct: 168 VVYAGTGIAGYGLLLIVKHDDTFLSAYGHNDSIEVSEGQDVKAGQLIARKGDSGT-DSVK 226

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN   +DP   L ++
Sbjct: 227 LHFEIRKNGKPVDPHSVLGKR 247


>gi|289764730|ref|ZP_06524108.1| cell wall endopeptidase [Fusobacterium sp. D11]
 gi|289716285|gb|EFD80297.1| cell wall endopeptidase [Fusobacterium sp. D11]
          Length = 365

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRH++   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 287 VVTFAGN-MSGYGKIIIIRHENGYETRYAHLSVISTNVGEHVNKGDLIGKTGNSGRTTGA 345

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 346 HLHFEIRHNGVPKNPMKYLQ 365


>gi|50121408|ref|YP_050575.1| hypothetical protein ECA2483 [Pectobacterium atrosepticum SCRI1043]
 gi|49611934|emb|CAG75383.1| putative peptidase [Pectobacterium atrosepticum SCRI1043]
          Length = 440

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 39/64 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++IRH     T + H++   V+ GQKV RG  IGLSG +G +  P +H+E   N  A
Sbjct: 345 GNYVVIRHGRQYTTRFMHLNRILVKPGQKVKRGDRIGLSGNTGRSTGPHLHYEFWINQQA 404

Query: 73  MDPI 76
           ++P+
Sbjct: 405 VNPL 408


>gi|281421378|ref|ZP_06252377.1| peptidase, M23/M37 family [Prevotella copri DSM 18205]
 gi|281404450|gb|EFB35130.1| peptidase, M23/M37 family [Prevotella copri DSM 18205]
          Length = 316

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+IRH++ + T+Y H+    V +G++V  G  IGL G +G +    +HFE R   +A
Sbjct: 144 GKYIVIRHNNGLETIYGHLSKQLVTEGEEVRAGDVIGLGGNTGRSTGSHLHFETRLCGVA 203

Query: 73  MDPIKFLE 80
           ++P  F +
Sbjct: 204 LNPALFFD 211


>gi|222109826|ref|YP_002552090.1| peptidase m23 [Acidovorax ebreus TPSY]
 gi|221729270|gb|ACM32090.1| Peptidase M23 [Acidovorax ebreus TPSY]
          Length = 454

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 37/64 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I+H +  VTVY+H+    V+KG+ V +G  IG  G +G A  P +HFE R     
Sbjct: 348 GNVVYIKHRNQHVTVYAHLSRIDVRKGESVEQGQKIGAVGSTGWATGPHLHFEFRVAGEH 407

Query: 73  MDPI 76
            DP+
Sbjct: 408 KDPM 411


>gi|120610103|ref|YP_969781.1| peptidase M23B [Acidovorax citrulli AAC00-1]
 gi|120588567|gb|ABM32007.1| peptidase M23B [Acidovorax citrulli AAC00-1]
          Length = 299

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN ++++H+++ +T Y+H  T  V++ Q V RG  I   G S +    +
Sbjct: 220 VVYAGAGLRGYGNLVILKHNNTYLTAYAHNQTLLVKEDQSVRRGQKIAEMGSS-DTDRVK 278

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 279 LHFEIRRQGKPVDPARYLPAR 299


>gi|260494840|ref|ZP_05814970.1| M23B subfamily peptidase [Fusobacterium sp. 3_1_33]
 gi|260198002|gb|EEW95519.1| M23B subfamily peptidase [Fusobacterium sp. 3_1_33]
          Length = 365

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRH++   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 287 VVTFAGN-MSGYGKIIIIRHENGYETRYAHLSVISTNVGEHVNKGDLIGKTGNSGRTTGA 345

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 346 HLHFEIRHNGVPKNPMKYLQ 365


>gi|291296574|ref|YP_003507972.1| Peptidase M23 [Meiothermus ruber DSM 1279]
 gi|290471533|gb|ADD28952.1| Peptidase M23 [Meiothermus ruber DSM 1279]
          Length = 316

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 42/68 (61%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            G  +LI H + + T+Y H+ + YV+KGQ+V +   IG  G +G +  P +H+ + +  +
Sbjct: 243 FGLMVLIDHGNGLHTLYGHLSSTYVEKGQQVQQSALIGAVGSTGRSTGPHLHYTVYRYGV 302

Query: 72  AMDPIKFL 79
           A+DP+ ++
Sbjct: 303 AVDPLPYV 310


>gi|221069190|ref|ZP_03545295.1| Peptidase M23 [Comamonas testosteroni KF-1]
 gi|220714213|gb|EED69581.1| Peptidase M23 [Comamonas testosteroni KF-1]
          Length = 452

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/64 (39%), Positives = 36/64 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I + H +   TVY+H+    V++GQ+V +G  IG  G +G A  P +HFE R     
Sbjct: 345 GNVIFVDHANQHTTVYAHLSRIDVKRGQRVDQGDIIGAVGSTGWATGPHLHFEFRDKGEQ 404

Query: 73  MDPI 76
            DP+
Sbjct: 405 RDPL 408


>gi|87118599|ref|ZP_01074498.1| Peptidoglycan-binding LysM:Peptidase M23B [Marinomonas sp. MED121]
 gi|86166233|gb|EAQ67499.1| Peptidoglycan-binding LysM:Peptidase  M23B [Marinomonas sp. MED121]
          Length = 281

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y GN L+  GN ++++H D  ++ Y++     V++ QKV  G  + + G  G  Q  
Sbjct: 202 VVVYAGNGLIGYGNLVIVKHSDEYLSAYAYNQRILVKEQQKVKAGQKLAIIGGKGE-QRS 260

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +HFE+RK+   ++P+K L +
Sbjct: 261 LLHFEVRKDGQPINPLKVLPK 281


>gi|190891964|ref|YP_001978506.1| metalloendopeptidase [Rhizobium etli CIAT 652]
 gi|190697243|gb|ACE91328.1| probable metalloendopeptidase protein [Rhizobium etli CIAT 652]
          Length = 411

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + + H + I T Y H+    V+ G  V R   IGL+G +G +    +H+E+R+N  A
Sbjct: 334 GNMVEVDHGNGISTRYGHMSQVMVKVGDTVGRNDVIGLAGSTGRSTGTHLHYEVRQNGQA 393

Query: 73  MDPIKFL 79
           +DP+ F+
Sbjct: 394 VDPVYFM 400


>gi|121593057|ref|YP_984953.1| peptidase M23B [Acidovorax sp. JS42]
 gi|120605137|gb|ABM40877.1| peptidase M23B [Acidovorax sp. JS42]
          Length = 454

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 37/64 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I+H +  VTVY+H+    V+KG+ V +G  IG  G +G A  P +HFE R     
Sbjct: 348 GNVVYIKHRNQHVTVYAHLSRIDVRKGESVEQGQKIGAVGSTGWATGPHLHFEFRVAGEH 407

Query: 73  MDPI 76
            DP+
Sbjct: 408 KDPM 411


>gi|56475932|ref|YP_157521.1| peptidase family protein [Aromatoleum aromaticum EbN1]
 gi|56311975|emb|CAI06620.1| Peptidase family protein [Aromatoleum aromaticum EbN1]
          Length = 441

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 42/67 (62%), Gaps = 2/67 (2%)

Query: 13  GNTILIRHDDSIVTVYSHID--TPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           GN ++++H D   T Y+H++     ++KG K+ +G  IG  G +G A  P +H+E+R N 
Sbjct: 335 GNIVILQHRDGYSTAYAHLNGFAGGLRKGTKIRQGDLIGYVGSTGWATGPHLHYEIRVNN 394

Query: 71  IAMDPIK 77
           IA DP+K
Sbjct: 395 IARDPMK 401


>gi|15598819|ref|NP_252313.1| hypothetical protein PA3623 [Pseudomonas aeruginosa PAO1]
 gi|218890152|ref|YP_002439016.1| putative lipoprotein NlpD [Pseudomonas aeruginosa LESB58]
 gi|254236537|ref|ZP_04929860.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254242321|ref|ZP_04935643.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|1171734|sp|P45682|NLPD_PSEAE RecName: Full=Lipoprotein nlpD/lppB homolog; Flags: Precursor
 gi|9949781|gb|AAG07011.1|AE004782_9 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|440377|dbj|BAA05130.1| unnamed protein product [Pseudomonas aeruginosa]
 gi|52632372|gb|AAU85547.1| lipoprotein [Pseudomonas sp. M18]
 gi|126168468|gb|EAZ53979.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126195699|gb|EAZ59762.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218770375|emb|CAW26140.1| putative lipoprotein NlpD [Pseudomonas aeruginosa LESB58]
          Length = 297

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H+++ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 218 VVYAGSGLRGYGELVIIKHNETYVSAYGHNRRLLVREGQQVKVGQSIAEMGSTG-TDRVK 276

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 277 LHFEIRRQGKPVDPLQYLPRR 297


>gi|256026733|ref|ZP_05440567.1| cell wall endopeptidase [Fusobacterium sp. D11]
          Length = 373

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRH++   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 295 VVTFAGN-MSGYGKIIIIRHENGYETRYAHLSVISTNVGEHVNKGDLIGKTGNSGRTTGA 353

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 354 HLHFEIRHNGVPKNPMKYLQ 373


>gi|219684401|ref|ZP_03539345.1| NlpD [Borrelia garinii PBr]
 gi|219672390|gb|EED29443.1| NlpD [Borrelia garinii PBr]
          Length = 295

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 52/81 (64%), Gaps = 3/81 (3%)

Query: 1   MVIYVG-NDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQH 59
           +VI VG NDL   GN +++ H ++I ++Y H+++  V+ G  +  G  +G+ G++G +  
Sbjct: 217 IVIEVGYNDLY--GNFVVVGHKNNIKSLYGHLNSYSVKTGDPIKSGELLGMVGQTGRSTG 274

Query: 60  PQVHFELRKNAIAMDPIKFLE 80
           P +HFE+ K  I ++P+K L+
Sbjct: 275 PHLHFEILKKNIPINPLKLLK 295


>gi|332970979|gb|EGK09953.1| M23/M37 family peptidase [Desmospora sp. 8437]
          Length = 274

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 13  GNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           G  I+I H   + T+Y+H+    P V+ G +V RG  IG  G +GN+  P +HFE++   
Sbjct: 204 GTYIIIDHGGGMQTLYAHMFPHQPLVKTGDRVKRGQPIGAIGNNGNSSGPHLHFEVKIGG 263

Query: 71  IAMDPIKFL 79
             +DPI FL
Sbjct: 264 RPVDPIPFL 272


>gi|329118812|ref|ZP_08247509.1| LysM domain/M23 peptidase domain protein [Neisseria bacilliformis
           ATCC BAA-1200]
 gi|327465099|gb|EGF11387.1| LysM domain/M23 peptidase domain protein [Neisseria bacilliformis
           ATCC BAA-1200]
          Length = 320

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+ + +T Y H  +  V++G  V RG TI   G + +A   +
Sbjct: 242 VVYAGNGLRGYGNLVIVQHNSTYLTAYGHNQSLLVKEGDIVKRGQTIARMGNT-DADRMK 300

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RK+   ++P  ++
Sbjct: 301 LHFEVRKDGKTVNPASYV 318


>gi|302559724|ref|ZP_07312066.1| M23 peptidase domain-containing protein [Streptomyces griseoflavus
           Tu4000]
 gi|302477342|gb|EFL40435.1| M23 peptidase domain-containing protein [Streptomyces griseoflavus
           Tu4000]
          Length = 353

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR---K 68
            G  I++RH     T Y+H+    V +G++V+ G  IG SG SGN+  P +HFE+R   +
Sbjct: 275 FGVEIVVRHAGGYYTQYAHLAAVAVDQGERVATGQWIGQSGTSGNSTGPHLHFEVRVTPE 334

Query: 69  NAIAMDPIKFLEEK 82
              A+DP+ +L  +
Sbjct: 335 MGSAVDPVPWLARR 348


>gi|213964073|ref|ZP_03392315.1| peptidase M23B [Capnocytophaga sputigena Capno]
 gi|213953299|gb|EEB64639.1| peptidase M23B [Capnocytophaga sputigena Capno]
          Length = 409

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + +RH+++  T Y H+     +KG+ V++G  IGL G +G A  P V +   KN + 
Sbjct: 312 GNYVKVRHNNTYTTQYLHMSKILARKGKYVAQGEVIGLVGSTGLATGPHVCYRFWKNGVQ 371

Query: 73  MDPIKFLEEKIP 84
           +DP+K   EK+P
Sbjct: 372 VDPLK---EKMP 380


>gi|116051620|ref|YP_789541.1| hypothetical protein PA14_17470 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115586841|gb|ABJ12856.1| putative lipoprotein NlpD [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 297

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H+++ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 218 VVYAGSGLRGYGELVIIKHNETYVSAYGHNRRLLVREGQQVKVGQSIAEMGSTG-TDRVK 276

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 277 LHFEIRRQGKPVDPLQYLPRR 297


>gi|330721382|gb|EGG99449.1| Lipoprotein NlpD [gamma proteobacterium IMCC2047]
          Length = 258

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G+ L+  GN ++I+H  + ++ Y+H     V +  KV  G  I   G SG +++ 
Sbjct: 179 VVVYAGSGLIGYGNLVIIKHSQTFLSAYAHNKKVLVAEKNKVKAGQKIAEIGSSGASEN- 237

Query: 61  QVHFELRKNAIAMDPIKFL 79
           ++HFE+RKN   ++P+ +L
Sbjct: 238 KLHFEIRKNGKPVNPLWYL 256


>gi|327191068|gb|EGE58121.1| putative metalloendopeptidase protein [Rhizobium etli CNPAF512]
          Length = 411

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + + H + I T Y H+    V+ G  V R   IGL+G +G +    +H+E+R+N  A
Sbjct: 334 GNMVEVDHGNGISTRYGHMSQVMVKVGDTVGRNDVIGLAGSTGRSTGTHLHYEVRQNGQA 393

Query: 73  MDPIKFL 79
           +DP+ F+
Sbjct: 394 VDPVYFM 400


>gi|313109027|ref|ZP_07795000.1| putative lipoprotein NlpD [Pseudomonas aeruginosa 39016]
 gi|310881502|gb|EFQ40096.1| putative lipoprotein NlpD [Pseudomonas aeruginosa 39016]
          Length = 297

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H+++ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 218 VVYAGSGLRGYGELVIIKHNETYVSAYGHNRRLLVREGQQVKVGQSIAEMGSTG-TDRVK 276

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 277 LHFEIRRQGKPVDPLQYLPRR 297


>gi|285017951|ref|YP_003375662.1| outer membrane lipoprotein precursor [Xanthomonas albilineans GPE
           PC73]
 gi|283473169|emb|CBA15675.1| putative outer membrane lipoprotein precursor [Xanthomonas
           albilineans]
          Length = 267

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+++H++  ++ Y H     V +GQ V  G  I   G+SG A+  
Sbjct: 187 VVVYSGAGLVGYGELIIVKHNEQWLSAYGHNRKRLVNEGQNVKAGQQIAEMGRSGAARD- 245

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R N   +DP+ +L
Sbjct: 246 MLHFEIRYNGKPVDPLLYL 264


>gi|167761642|ref|ZP_02433769.1| hypothetical protein CLOSCI_04054 [Clostridium scindens ATCC 35704]
 gi|167660785|gb|EDS04915.1| hypothetical protein CLOSCI_04054 [Clostridium scindens ATCC 35704]
          Length = 369

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 4   YVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVH 63
           Y GN     G  I+I H + + T Y H +  YV  GQ VS+G  I   G +GN+  P +H
Sbjct: 298 YSGN----AGKMIVINHGNGLTTYYMHCNDLYVSAGQSVSKGQNIAAVGTTGNSTGPHLH 353

Query: 64  FELRKNAIAMDPIKFL 79
           F++  N   ++P  +L
Sbjct: 354 FQVNLNGTPVNPANYL 369


>gi|310644838|ref|YP_003949597.1| peptidase m23b [Paenibacillus polymyxa SC2]
 gi|309249789|gb|ADO59356.1| Peptidase M23B [Paenibacillus polymyxa SC2]
          Length = 507

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I H +   TVY H+ +  V  GQ V +G +IG+ G +G +    +HFE+RK+  A
Sbjct: 440 GNVIMIDHGNGYQTVYGHLSSIGVHVGQVVQQGESIGVMGSTGRSTGTHLHFEIRKDNTA 499

Query: 73  MDPIKFL 79
            +P+ +L
Sbjct: 500 RNPMTYL 506


>gi|294338523|emb|CAZ86852.1| putative Peptidase M23B [Thiomonas sp. 3As]
          Length = 466

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 36/65 (55%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I I H     TVY+H+ +  V+ GQ VS G  IG +G +G +  P +HFE       
Sbjct: 356 GNVIKIAHPGGFETVYAHLSSIAVKPGQTVSEGQNIGKTGNTGTSTGPHLHFEFHAAGRL 415

Query: 73  MDPIK 77
           +DP++
Sbjct: 416 IDPLR 420


>gi|241761318|ref|ZP_04759406.1| Peptidase M23 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241374225|gb|EER63722.1| Peptidase M23 [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 441

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GN  LI H   I T Y+H+   +V +GQ VS+G  IG  G SG +  P 
Sbjct: 332 VIFAGRK-SGYGNFALIDHGQGIETAYAHMSCLHVHQGQSVSQGQVIGQIGTSGLSTGPH 390

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+EL  N++ ++P  F++
Sbjct: 391 LHYELHYNSVPVNPDHFVQ 409


>gi|297202886|ref|ZP_06920283.1| peptidase [Streptomyces sviceus ATCC 29083]
 gi|197715226|gb|EDY59260.1| peptidase [Streptomyces sviceus ATCC 29083]
          Length = 250

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN I+IR  D   T Y H+ +  V  GQ V+ G  IGLSG +GN   P +HFE R +   
Sbjct: 174 GNQIVIRMADGTYTQYGHLSSIGVSVGQSVTPGQQIGLSGATGNVTGPHLHFEARTSPEY 233

Query: 70  AIAMDPIKFLEE 81
              +DP+ +L  
Sbjct: 234 GSDIDPVSYLRS 245


>gi|6175920|gb|AAF05335.1|AF182103_1 lipoprotein [Escherichia coli]
          Length = 155

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 83  VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 141

Query: 62  VHFELRKNAIAMDP 75
           +HFE+R    +++P
Sbjct: 142 LHFEIRYKGKSVNP 155


>gi|85059242|ref|YP_454944.1| hypothetical protein SG1264 [Sodalis glossinidius str. 'morsitans']
 gi|84779762|dbj|BAE74539.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 441

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH    +T Y H+    V+ GQKV RG  I LSG +G +  P +H+E+  N  A
Sbjct: 346 GNYVAIRHGRQYMTRYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEVWINQQA 405

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 406 VNP---LTAKLP 414


>gi|283956629|ref|ZP_06374108.1| peptidase, M23/M37 family [Campylobacter jejuni subsp. jejuni 1336]
 gi|283791878|gb|EFC30668.1| peptidase, M23/M37 family [Campylobacter jejuni subsp. jejuni 1336]
          Length = 273

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 43/80 (53%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++ +  D    GN+++I H   I + Y H+    V+ GQK+ +G  IGLSG SG    P 
Sbjct: 188 IVKIAKDRYFAGNSVVIDHGFGIYSQYYHLSKIDVKVGQKIKKGELIGLSGASGRVSGPH 247

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HF +      +DP+ F+ +
Sbjct: 248 LHFGILAGGKQVDPLDFVSK 267


>gi|15639850|ref|NP_219300.1| hypothetical protein TP0864 [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189026088|ref|YP_001933860.1| hypothetical protein TPASS_0864 [Treponema pallidum subsp. pallidum
           SS14]
 gi|3323175|gb|AAC65827.1| conserved hypothetical protein [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189018663|gb|ACD71281.1| hypothetical protein TPASS_0864 [Treponema pallidum subsp. pallidum
           SS14]
          Length = 546

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H     T+Y H+ +  V +G +V +G TIG  G SG A  P +HF + KN   
Sbjct: 478 GNYLIIVHGGGYQTMYGHLSSVMVGRGARVVQGTTIGRVGASGRATGPHLHFSVFKNGSV 537

Query: 73  MDPIKFL 79
           ++P+K L
Sbjct: 538 VNPLKIL 544


>gi|86357879|ref|YP_469771.1| metalloendopeptidase protein [Rhizobium etli CFN 42]
 gi|86281981|gb|ABC91044.1| probable metalloendopeptidase protein [Rhizobium etli CFN 42]
          Length = 408

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H + I T Y H+    V+ G  V R   IGL+G +G +    +H+E+R+N  A
Sbjct: 331 GNMVEIDHGNGISTRYGHMSQVLVKIGDTVDRNDVIGLAGSTGRSTGTHLHYEVRQNGHA 390

Query: 73  MDPIKFL 79
           +DP+ F+
Sbjct: 391 VDPVYFM 397


>gi|307323191|ref|ZP_07602401.1| Peptidase M23 [Streptomyces violaceusniger Tu 4113]
 gi|306890680|gb|EFN21656.1| Peptidase M23 [Streptomyces violaceusniger Tu 4113]
          Length = 385

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN-- 69
            G  ++IRH D + T Y+H+    V+ GQ V  G  I  SG +GNA  P +HFE+R    
Sbjct: 308 FGYQVIIRHADGLYTHYAHLSALTVRTGQSVEAGGRIARSGNTGNATGPHLHFEVRTGPH 367

Query: 70  -AIAMDPIKFLEEK 82
               +DP+ +L  +
Sbjct: 368 YGSDIDPLAYLRSR 381


>gi|260424650|ref|ZP_05732812.2| peptidase, M23B family [Dialister invisus DSM 15470]
 gi|260402692|gb|EEW96239.1| peptidase, M23B family [Dialister invisus DSM 15470]
          Length = 372

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H + + ++Y H  +  V  G+ VS+G  I  +G +G +  P  HFE+R+N  A
Sbjct: 306 GNAVIIDHGNGLQSLYGHNSSLTVSVGETVSQGQIIAYAGSTGYSTGPHCHFEVRQNGEA 365

Query: 73  MDPIKFL 79
           +DP+ +L
Sbjct: 366 VDPMGYL 372


>gi|160901337|ref|YP_001566919.1| peptidase M23B [Delftia acidovorans SPH-1]
 gi|160366921|gb|ABX38534.1| peptidase M23B [Delftia acidovorans SPH-1]
          Length = 464

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 39/68 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I + H ++  TVY+H+    V +GQ+V +G  IG  G +G A  P +HFE R N   
Sbjct: 357 GNVIFVDHANNHTTVYAHLSHIGVTRGQRVEQGDIIGNVGSTGWATGPHLHFEFRVNGEH 416

Query: 73  MDPIKFLE 80
            DP+  ++
Sbjct: 417 RDPMTIVQ 424


>gi|114704659|ref|ZP_01437567.1| probable metalloendopeptidase protein [Fulvimarina pelagi HTCC2506]
 gi|114539444|gb|EAU42564.1| probable metalloendopeptidase protein [Fulvimarina pelagi HTCC2506]
          Length = 422

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H + I T + H+    V+ G +V RG  +G  G +G +  P +H+E+R+N  A
Sbjct: 346 GNLVEIDHGNGIKTRFGHMARIDVEVGDEVPRGAQLGTVGSTGRSTGPHLHYEVRRNGRA 405

Query: 73  MDPIKFL 79
           +DP++F+
Sbjct: 406 IDPMRFI 412


>gi|330470057|ref|YP_004407800.1| peptidase M23B [Verrucosispora maris AB-18-032]
 gi|328813028|gb|AEB47200.1| peptidase M23B [Verrucosispora maris AB-18-032]
          Length = 248

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 2/72 (2%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G +++I H +  +T Y+H+ T  V  G+KVS G TIGL G +G++  P +HFE+ +  + 
Sbjct: 171 GISVVIDHGNGYLTHYAHLSTARVSVGEKVSTGQTIGLEGSTGDSTGPHLHFEVHQGQMW 230

Query: 73  --MDPIKFLEEK 82
             +DP  FL  +
Sbjct: 231 NQIDPAPFLRAR 242


>gi|256751007|ref|ZP_05491890.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1]
 gi|256750117|gb|EEU63138.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1]
          Length = 301

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  L   G  ++I H   I +VY H     V+ GQ V RG  I  SG +G +  P 
Sbjct: 221 VTYAGW-LSGYGKVVIIDHGYGIQSVYGHNSEILVKVGQSVKRGDIIAKSGNTGRSTGPH 279

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           VHFE+R N   +DP+K+L +
Sbjct: 280 VHFEIRVNGNPVDPMKYLAK 299


>gi|146297340|ref|YP_001181111.1| peptidase M23B [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145410916|gb|ABP67920.1| peptidase M23B [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 378

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G TI++ +   I T+Y+H+ +  V  GQKV +G  IG  G +G +  P +HFE+R N   
Sbjct: 311 GKTIILDNGSGISTLYAHLSSINVSVGQKVKKGECIGNVGSTGYSTGPNLHFEVRINGDV 370

Query: 73  MDPIKFLE 80
           +DP+ +L+
Sbjct: 371 VDPLNYLK 378


>gi|119774406|ref|YP_927146.1| M24/M37 family peptidase [Shewanella amazonensis SB2B]
 gi|119766906|gb|ABL99476.1| peptidase, M23/M37 family [Shewanella amazonensis SB2B]
          Length = 419

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+I H +   T Y H+    V+KG +VSRG  I LSG +G +  P +H+E   N   
Sbjct: 324 GKYIVIEHGNKFRTRYLHLSKSLVRKGDRVSRGQVIALSGNTGRSTGPHLHYEFHVNGRP 383

Query: 73  MDPIK 77
           +DP+K
Sbjct: 384 VDPMK 388


>gi|260775504|ref|ZP_05884401.1| lipoprotein NlpD [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608685|gb|EEX34850.1| lipoprotein NlpD [Vibrio coralliilyticus ATCC BAA-450]
          Length = 303

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+D+ ++ Y+H +   V +GQ V  G  I   G SG     +
Sbjct: 226 VVYSGNALRGYGNLVIIKHNDNYLSAYAHNERLLVHEGQSVKAGQKIATMGSSG-TNSVR 284

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R    +++P ++L
Sbjct: 285 LHFEIRYQGKSVNPKRYL 302


>gi|260437820|ref|ZP_05791636.1| peptidase, M23B family [Butyrivibrio crossotus DSM 2876]
 gi|292809844|gb|EFF69049.1| peptidase, M23B family [Butyrivibrio crossotus DSM 2876]
          Length = 518

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + IRH D  +T Y H+++  V  GQ V++G  I  SG +G +  P +HFE+R N  +
Sbjct: 451 GYCVDIRHSDGSMTRYGHLNSIAVTYGQTVTQGQVIAYSGNTGYSTGPHLHFEIRINGQS 510

Query: 73  MDPIKFL 79
           ++P+ ++
Sbjct: 511 VNPLNYI 517


>gi|257092977|ref|YP_003166618.1| peptidase M23 [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257045501|gb|ACV34689.1| Peptidase M23 [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 329

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   G  ++++H+++ +T Y+H  T  V++GQ V +G  I   G + +A   +
Sbjct: 250 VVYSGAGLRGYGKLVIVKHNNNFLTAYAHNKTVLVKEGQSVGKGQKIAEMGDT-DADQVK 308

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+K L
Sbjct: 309 LHFEVRRQGKPVDPLKHL 326


>gi|239980860|ref|ZP_04703384.1| secreted peptidase [Streptomyces albus J1074]
 gi|291452721|ref|ZP_06592111.1| secreted peptidase [Streptomyces albus J1074]
 gi|291355670|gb|EFE82572.1| secreted peptidase [Streptomyces albus J1074]
          Length = 348

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI- 71
           G  +++RHD    + Y+H+  P V +G ++  G  IG SG +GN+  P +HFE+R     
Sbjct: 272 GIEVVVRHDGGYYSQYAHLSAPAVDQGDRIQAGDWIGQSGSTGNSTGPHLHFEIRLTPYY 331

Query: 72  --AMDPIKFLEEK 82
             A+DP  +  E+
Sbjct: 332 GSAVDPGPWFAER 344


>gi|103485523|ref|YP_615084.1| peptidase M23B [Sphingopyxis alaskensis RB2256]
 gi|98975600|gb|ABF51751.1| peptidase M23B [Sphingopyxis alaskensis RB2256]
          Length = 402

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 40/70 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + + H   I+T Y+H+     + G KV+ G  I   G +G +    +HFE+R N +A
Sbjct: 309 GNVVEVDHGQGIMTRYAHLSGFTTRAGVKVAAGQQIAKMGSTGRSTGSHLHFEVRLNGVA 368

Query: 73  MDPIKFLEEK 82
           ++P +FLE K
Sbjct: 369 VNPRRFLEAK 378


>gi|325962255|ref|YP_004240161.1| metalloendopeptidase-like membrane protein [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323468342|gb|ADX72027.1| metalloendopeptidase-like membrane protein [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 273

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VG      GN +++ H + + T Y+H+ +  V +GQ VSRG  + LSG +G +    
Sbjct: 196 VTFVGWHQYGGGNRVVVDHGNGLETTYNHLSSFNVTEGQTVSRGDVVALSGTTGASTGCH 255

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE++ N   +DP  +L
Sbjct: 256 LHFEVQVNGEVVDPTGWL 273


>gi|260753233|ref|YP_003226126.1| peptidase M23 [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|283856209|ref|YP_161951.2| peptidase M23 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258552596|gb|ACV75542.1| Peptidase M23 [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|283775204|gb|AAV88840.2| Peptidase M23 [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 523

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GN  LI H   I T Y+H+   +V +GQ VS+G  IG  G SG +  P 
Sbjct: 414 VIFAGRK-SGYGNFALIDHGQGIETAYAHMSCLHVHQGQSVSQGQVIGQIGTSGLSTGPH 472

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+EL  N++ ++P  F++
Sbjct: 473 LHYELHYNSVPVNPDHFVQ 491


>gi|94986913|ref|YP_594846.1| membrane proteins related to metalloendopeptidases [Lawsonia
           intracellularis PHE/MN1-00]
 gi|94731162|emb|CAJ54524.1| membrane proteins related to metalloendopeptidases [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 204

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 46/70 (65%), Gaps = 8/70 (11%)

Query: 10  VELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN 69
           +++GN +++R        Y+H+D  +V+KG +V +G  IG  G++G A  P +HFE+R N
Sbjct: 122 LDIGNGVILR--------YAHLDRLHVKKGVEVYQGQCIGKLGRTGRATAPHLHFEVRVN 173

Query: 70  AIAMDPIKFL 79
            I +DP++F+
Sbjct: 174 NIPVDPMQFI 183


>gi|91226424|ref|ZP_01261223.1| hypothetical protein V12G01_06446 [Vibrio alginolyticus 12G01]
 gi|91189238|gb|EAS75518.1| hypothetical protein V12G01_06446 [Vibrio alginolyticus 12G01]
          Length = 418

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H     T Y H+    V+KGQKVSRG  IGLSGK+G    P +H+EL +    
Sbjct: 318 GNYVVVEHGSKYKTRYLHLSKILVKKGQKVSRGQRIGLSGKTGRVTGPHLHYELIEYG-- 375

Query: 73  MDPIKFLEEKIP 84
             P+  +   IP
Sbjct: 376 -RPVNAMRANIP 386


>gi|298207537|ref|YP_003715716.1| putative peptidase [Croceibacter atlanticus HTCC2559]
 gi|83850173|gb|EAP88041.1| putative peptidase [Croceibacter atlanticus HTCC2559]
          Length = 325

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I I H     ++Y+H+    V+KGQ+V RG  IG  G +G +Q P +H+E+ K+   
Sbjct: 235 GNHIRIDHGYGYTSLYAHLYKYNVKKGQRVKRGDVIGFVGSTGRSQAPHLHYEIFKDGER 294

Query: 73  MDPIKF 78
           ++PI F
Sbjct: 295 INPINF 300


>gi|269966159|ref|ZP_06180249.1| hypothetical protein VMC_16790 [Vibrio alginolyticus 40B]
 gi|269829306|gb|EEZ83550.1| hypothetical protein VMC_16790 [Vibrio alginolyticus 40B]
          Length = 427

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H     T Y H+    V+KGQKVSRG  IGLSGK+G    P +H+EL +    
Sbjct: 327 GNYVVVEHGSKYKTRYLHLSKILVKKGQKVSRGQRIGLSGKTGRVTGPHLHYELIEYG-- 384

Query: 73  MDPIKFLEEKIP 84
             P+  +   IP
Sbjct: 385 -RPVNAMRANIP 395


>gi|291060221|gb|ADD72956.1| LysM/M23/M37 peptidase [Treponema pallidum subsp. pallidum str.
           Chicago]
          Length = 517

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H     T+Y H+ +  V +G +V +G TIG  G SG A  P +HF + KN   
Sbjct: 449 GNYLIIVHGGGYQTMYGHLSSVMVGRGARVVQGTTIGRVGASGRATGPHLHFSVFKNGSV 508

Query: 73  MDPIKFL 79
           ++P+K L
Sbjct: 509 VNPLKIL 515


>gi|290475242|ref|YP_003468128.1| putative peptidase protein YebA [Xenorhabdus bovienii SS-2004]
 gi|289174561|emb|CBJ81355.1| putative peptidase protein YebA [Xenorhabdus bovienii SS-2004]
          Length = 437

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 37/72 (51%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +HFE   N   
Sbjct: 342 GNFIAIRHGRQYTTRYMHLRKLLVKPGQKVKRGERIALSGNTGRSTGPHLHFEFWNN--- 398

Query: 73  MDPIKFLEEKIP 84
             P+  L  K+P
Sbjct: 399 QQPVNPLTAKLP 410


>gi|34499136|ref|NP_903351.1| lipoprotein nlpD [Chromobacterium violaceum ATCC 12472]
 gi|34104987|gb|AAQ61343.1| probable lipoprotein nlpD precursor [Chromobacterium violaceum ATCC
           12472]
          Length = 334

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   G  I+I+H+ + ++ Y+H     V++GQ V +G  I   G + +A   +
Sbjct: 254 VVYSGAGLRGYGKLIIIKHNKTFLSAYAHNSQLLVKEGQTVKKGQKIAEMGNT-DADQVK 312

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++LE K
Sbjct: 313 LHFEIRRYGKPVDPMQYLEHK 333


>gi|329298641|ref|ZP_08255977.1| putative peptidase [Plautia stali symbiont]
          Length = 442

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH    +T Y H+    V+ GQKV RG  I LSG +G +  P +H+E+  N  A
Sbjct: 347 GNYVAIRHGRQYMTRYMHLSKALVKPGQKVKRGDRIALSGNTGCSTGPHLHYEVWINNQA 406

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 407 VNP---LTAKLP 415


>gi|302557104|ref|ZP_07309446.1| secreted peptidase [Streptomyces griseoflavus Tu4000]
 gi|302474722|gb|EFL37815.1| secreted peptidase [Streptomyces griseoflavus Tu4000]
          Length = 309

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN ++I+ +D     Y+H+ +  V  GQ V+ G  +GLSG +GN   P +HFE+R     
Sbjct: 233 GNQVVIKLNDGYYAQYAHLSSLSVSAGQTVTAGQQVGLSGATGNVTGPHLHFEIRTTPDY 292

Query: 70  AIAMDPIKFLEEK 82
              +DP+ +L  K
Sbjct: 293 GSDVDPVSYLRGK 305


>gi|226939287|ref|YP_002794358.1| lipoprotein NlpD precursor [Laribacter hongkongensis HLHK9]
 gi|226714211|gb|ACO73349.1| probable lipoprotein NlpD precursor [Laribacter hongkongensis
           HLHK9]
          Length = 372

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 47/80 (58%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   G  I+I+H+ + ++ Y+H +T  V++GQ V +G  I   G S +A   +
Sbjct: 293 VVYSGTGLRGYGKLIIIKHNKAFLSAYAHNNTLLVKEGQAVRKGQKIAEMGNS-DADKTK 351

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFELR+    +DP  ++ +
Sbjct: 352 LHFELRRYGKPVDPYNYMPQ 371


>gi|225010001|ref|ZP_03700473.1| Peptidase M23 [Flavobacteria bacterium MS024-3C]
 gi|225005480|gb|EEG43430.1| Peptidase M23 [Flavobacteria bacterium MS024-3C]
          Length = 325

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 40/67 (59%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            G  I I H    VT+Y+H+    V++G+KV RG  IG  G +G +Q P +H+E+ K+  
Sbjct: 234 FGKHIRIDHGFGYVTIYAHLSQYNVRRGEKVKRGDIIGYVGSTGRSQAPHLHYEVWKDKK 293

Query: 72  AMDPIKF 78
            ++PI F
Sbjct: 294 KINPINF 300


>gi|29828962|ref|NP_823596.1| peptidase [Streptomyces avermitilis MA-4680]
 gi|29606067|dbj|BAC70131.1| putative peptidase [Streptomyces avermitilis MA-4680]
          Length = 258

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA-- 70
           GN I+I+ +D   T Y H+ +  V  GQ V+ G  IG+SG +GN   P +HFE R  A  
Sbjct: 182 GNNIVIKMNDGTYTQYGHLSSIGVSVGQTVTPGQQIGISGATGNTTGPHLHFEARTTAEY 241

Query: 71  -IAMDPIKFLEE 81
              +DP+ +L  
Sbjct: 242 GSDIDPVAYLRS 253


>gi|78188161|ref|YP_378499.1| membrane proteins related to metalloendopeptidase-like [Chlorobium
           chlorochromatii CaD3]
 gi|78170360|gb|ABB27456.1| metalloendopeptidases-like membarne protein [Chlorobium
           chlorochromatii CaD3]
          Length = 321

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V +VGN     G  I I H     T+Y+H+    VQ+G  V RG TIGLSG SG +   
Sbjct: 222 IVAFVGNS-KGYGQKITINHGYGYKTIYAHLSKMVVQQGDNVRRGDTIGLSGNSGTSTGA 280

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +H+E+ +    +DP  F  E+
Sbjct: 281 HLHYEVLRYNQRLDPSAFYFEE 302


>gi|83854839|ref|ZP_00948369.1| peptidase, M23/M37 family protein [Sulfitobacter sp. NAS-14.1]
 gi|83842682|gb|EAP81849.1| peptidase, M23/M37 family protein [Sulfitobacter sp. NAS-14.1]
          Length = 322

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 11  ELGNTILIRHDDSIVTVYSHID--TPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRK 68
           E GN +++ H +   T Y H+   +  V KGQ+V+ G TIG  G+SG A  P VH  +RK
Sbjct: 115 ECGNGVVLDHGNGWETQYCHLKQGSVSVTKGQEVASGDTIGFVGQSGKAAFPHVHLSVRK 174

Query: 69  NAIAMDP 75
           +   +DP
Sbjct: 175 DGAVVDP 181


>gi|153003660|ref|YP_001377985.1| peptidase M23B [Anaeromyxobacter sp. Fw109-5]
 gi|152027233|gb|ABS25001.1| peptidase M23B [Anaeromyxobacter sp. Fw109-5]
          Length = 284

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G D    G  ++++H + +VT+Y+H     V+ GQ+VSRG  I   G++G    P 
Sbjct: 207 VIFAG-DQPGYGALVILKHANDLVTLYAHNSRVLVKDGQRVSRGDPIARVGQTGRTTGPH 265

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+     +P+ FL
Sbjct: 266 LHFEVRQGTRPRNPLLFL 283


>gi|110597087|ref|ZP_01385376.1| Peptidase M23B [Chlorobium ferrooxidans DSM 13031]
 gi|110341278|gb|EAT59743.1| Peptidase M23B [Chlorobium ferrooxidans DSM 13031]
          Length = 260

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I I H     T+Y H+    V++GQ+V RG  I LSG +G +  P +H+E+RKN + 
Sbjct: 170 GQKITINHGYGYKTIYGHLSKALVRQGQRVKRGDIIALSGNTGVSTGPHLHYEVRKNNLL 229

Query: 73  MDPIKFL 79
           ++P  + 
Sbjct: 230 VNPTAYF 236


>gi|255321630|ref|ZP_05362787.1| peptidase, M23/M37 family [Campylobacter showae RM3277]
 gi|255301278|gb|EET80538.1| peptidase, M23/M37 family [Campylobacter showae RM3277]
          Length = 279

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 44/80 (55%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ +  D    G +++I H + I T Y H+    V+ GQ V +G TI LSG SG    P 
Sbjct: 194 VVVIAKDRYYAGGSVVIDHGEGIYTQYYHLSALNVKVGQSVKKGDTIALSGSSGRVSGPH 253

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HF +    + ++P+ F+++
Sbjct: 254 LHFGVIAGGVQVNPLNFVKK 273


>gi|320539862|ref|ZP_08039521.1| putative peptidase [Serratia symbiotica str. Tucson]
 gi|320030048|gb|EFW12068.1| putative peptidase [Serratia symbiotica str. Tucson]
          Length = 440

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + IRH     T Y H+    V+ GQKV RG  I LSG SG +  P +HFEL  N  A
Sbjct: 345 GYYVAIRHGRQYTTRYMHLKKLLVKPGQKVKRGERIALSGNSGRSTGPHLHFELWINQQA 404

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 405 VNP---LTAKLP 413


>gi|116329342|ref|YP_799062.1| metalloendopeptidase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116330055|ref|YP_799773.1| metalloendopeptidase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116122086|gb|ABJ80129.1| Metalloendopeptidase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116123744|gb|ABJ75015.1| Metalloendopeptidase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 372

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   GN ++I H D   T+Y+H    +VQ+G  V  G  I  SG +G +  P 
Sbjct: 284 VIYAGW-MGGYGNVVVIEHTDDFKTLYAHNSKLFVQRGDYVLAGKKIARSGSTGYSFGPH 342

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+ KN   ++P K+L+
Sbjct: 343 LHFEVIKNGKPVNPSKYLK 361


>gi|163742882|ref|ZP_02150266.1| peptidase, M23/M37 family protein [Phaeobacter gallaeciensis 2.10]
 gi|161383846|gb|EDQ08231.1| peptidase, M23/M37 family protein [Phaeobacter gallaeciensis 2.10]
          Length = 321

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 11  ELGNTILIRHDDSIVTVYSHID--TPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRK 68
           E GN +L+RH +   T Y H+   +  VQ G +V+ G  +G  G SGN Q P +HF +RK
Sbjct: 113 ECGNGVLLRHGEGWETQYCHMKRGSILVQSGDRVTAGTPLGEIGLSGNTQFPHLHFSVRK 172

Query: 69  NAIAMDP 75
           +   +DP
Sbjct: 173 DGKTVDP 179


>gi|167037898|ref|YP_001665476.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|320116313|ref|YP_004186472.1| peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166856732|gb|ABY95140.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|319929404|gb|ADV80089.1| Peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 301

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  L   G  ++I H   I +VY H     V+ GQ V RG  I  SG +G +  P 
Sbjct: 221 VTYAGW-LSGYGKVVIIDHGYGIQSVYGHNSEILVKVGQSVKRGDIIAKSGNTGRSTGPH 279

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           VHFE+R N   +DP+K+L +
Sbjct: 280 VHFEVRVNGNPVDPMKYLAK 299


>gi|294789000|ref|ZP_06754240.1| LysM domain/M23 peptidase domain protein [Simonsiella muelleri ATCC
           29453]
 gi|294483102|gb|EFG30789.1| LysM domain/M23 peptidase domain protein [Simonsiella muelleri ATCC
           29453]
          Length = 360

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY-VQKGQKVSRGHTIGLSGKSGNAQHP 60
           V+Y G  L + GN ++I+H+   +T Y   + P  V++GQ+V RG  I   G S      
Sbjct: 278 VVYSGKSLKDYGNLVIIQHNSKYLTAYGSNEAPLLVREGQQVKRGQQIATMGDSDKFGTL 337

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+R+N   ++P  F++
Sbjct: 338 KLHFEIRENGTPVNPSNFIK 357


>gi|134093530|ref|YP_001098605.1| putative endopeptidase [Herminiimonas arsenicoxydans]
 gi|133737433|emb|CAL60476.1| putative peptidase [Herminiimonas arsenicoxydans]
          Length = 456

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 13  GNTILIRHDDSIVTVYSHID--TPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           GN ++I+H     T Y+H+    P ++KG KVS+G  IG  G +G +  P +H+E R N 
Sbjct: 347 GNVVVIKHWSKYSTAYAHMSRFAPNMRKGTKVSQGQVIGYVGTTGWSTGPHLHYEFRVNN 406

Query: 71  IAMDPI 76
            A DP+
Sbjct: 407 EARDPM 412


>gi|238919507|ref|YP_002933022.1| hypothetical protein NT01EI_1603 [Edwardsiella ictaluri 93-146]
 gi|238869076|gb|ACR68787.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 439

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/64 (39%), Positives = 38/64 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++IRH     T + H+ T  V+ GQKV RG  + LSG +G +  P +H+E   N  A
Sbjct: 344 GNYVVIRHGRQYTTRFMHLKTILVKPGQKVKRGDRVALSGNTGRSTGPHLHYEFWVNNQA 403

Query: 73  MDPI 76
           ++P+
Sbjct: 404 VNPL 407


>gi|209520888|ref|ZP_03269629.1| Peptidase M23 [Burkholderia sp. H160]
 gi|209498695|gb|EDZ98809.1| Peptidase M23 [Burkholderia sp. H160]
          Length = 125

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++HD   +T Y+H    +V++G+ V RG  I   G + +     
Sbjct: 46  VVYAGNGLRGYGNLLILKHDADYLTAYAHNRALFVKEGESVKRGQKIAEMGDT-DTDRVM 104

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP K L  +
Sbjct: 105 LHFELRYQGRSIDPSKELPPR 125


>gi|90417702|ref|ZP_01225614.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337374|gb|EAS51025.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 465

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H + I T Y H+    V  G +V R   IG  G +G +  P +H+E+R++  A
Sbjct: 389 GNLVEIDHGNGITTRYGHMSRIDVSVGDEVGRSTRIGAVGSTGRSTGPHLHYEVRRDGKA 448

Query: 73  MDPIKFL 79
           +DP++FL
Sbjct: 449 VDPMRFL 455


>gi|294084374|ref|YP_003551132.1| peptidase, M23/M37 family [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663947|gb|ADE39048.1| peptidase, M23/M37 family, putative [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 528

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + GN     GN + +RH   I TV++H+    V+KGQ +S G  IG  G++G  +   
Sbjct: 433 VTFAGN-AGSFGNVVRVRHAFGIETVFAHLSKIRVKKGQDISEGTVIGNMGRTGRTEGAH 491

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R N  +++P  F +
Sbjct: 492 LHYEMRVNGQSLNPQLFFD 510


>gi|254467976|ref|ZP_05081382.1| peptidase M23B [beta proteobacterium KB13]
 gi|207086786|gb|EDZ64069.1| peptidase M23B [beta proteobacterium KB13]
          Length = 298

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (59%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           + GN + I+H   I T Y+H     V+KG  V++   I L G +G +  P +H+E+R N 
Sbjct: 227 DYGNYVKIKHGGGIETRYAHASKLLVKKGDLVNKDQVIALVGNTGRSTGPHLHYEIRLNG 286

Query: 71  IAMDPIKFLEEK 82
            ++DP K+L++K
Sbjct: 287 RSLDPRKYLKKK 298


>gi|158321282|ref|YP_001513789.1| peptidase M23B [Alkaliphilus oremlandii OhILAs]
 gi|158141481|gb|ABW19793.1| peptidase M23B [Alkaliphilus oremlandii OhILAs]
          Length = 376

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 40/70 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H   I+T+Y+H     V  G  V+ G  I L G +G +  P +HFE+RKN   
Sbjct: 307 GKAVIIDHGGGIMTLYAHNSKLLVSNGDTVTSGQVIALIGSTGASTGPHLHFEVRKNGQY 366

Query: 73  MDPIKFLEEK 82
           +DPI +L+ K
Sbjct: 367 VDPIPYLKGK 376


>gi|297156692|gb|ADI06404.1| putative peptidase [Streptomyces bingchenggensis BCW-1]
          Length = 274

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           GN I+I+ +D   T Y H+ +  V  GQ V+ G  IGLSG +GN   P +HFE R +   
Sbjct: 198 GNNIVIKMNDGTYTQYGHLSSIGVSVGQTVTPGQQIGLSGATGNVTGPHLHFEARTSPDY 257

Query: 70  AIAMDPIKFL 79
              +DP+ +L
Sbjct: 258 GSDIDPVAYL 267


>gi|222874902|gb|EEF12033.1| predicted protein [Populus trichocarpa]
          Length = 341

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 39/68 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I + H ++  TVY+H+    V +GQ+V +G  IG  G +G A  P +HFE R N   
Sbjct: 234 GNVIFVDHANNHTTVYAHLSHIGVTRGQRVEQGDIIGNVGSTGWATGPHLHFEFRVNGEH 293

Query: 73  MDPIKFLE 80
            DP+  ++
Sbjct: 294 RDPMTIVQ 301


>gi|187924815|ref|YP_001896457.1| peptidase M23 [Burkholderia phytofirmans PsJN]
 gi|187716009|gb|ACD17233.1| Peptidase M23 [Burkholderia phytofirmans PsJN]
          Length = 236

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+   +T Y+H  T  V++GQ V+RG  I   G + +     
Sbjct: 157 VVYAGNGLRGYGNLLILKHNAEYLTAYAHNRTLLVKEGQSVTRGEKIAEMGDT-DTDRVM 215

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP + L  +
Sbjct: 216 LHFELRYQGRSIDPSRALPPR 236


>gi|291612798|ref|YP_003522955.1| peptidase M23 [Sideroxydans lithotrophicus ES-1]
 gi|291582910|gb|ADE10568.1| Peptidase M23 [Sideroxydans lithotrophicus ES-1]
          Length = 317

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H+ + ++ Y+H D   V++GQ VS G  I   G +  +Q  +
Sbjct: 236 VVYSGSGLRGYGKLIIIKHNKTFLSAYAHNDRILVKEGQSVSSGQKIAEMGSTDTSQV-E 294

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RK    +DP ++L
Sbjct: 295 LHFEIRKFGKPVDPAQYL 312


>gi|167040796|ref|YP_001663781.1| peptidase M23B [Thermoanaerobacter sp. X514]
 gi|300914831|ref|ZP_07132147.1| Peptidase M23 [Thermoanaerobacter sp. X561]
 gi|307723935|ref|YP_003903686.1| peptidase M23 [Thermoanaerobacter sp. X513]
 gi|166855036|gb|ABY93445.1| peptidase M23B [Thermoanaerobacter sp. X514]
 gi|300889766|gb|EFK84912.1| Peptidase M23 [Thermoanaerobacter sp. X561]
 gi|307580996|gb|ADN54395.1| Peptidase M23 [Thermoanaerobacter sp. X513]
          Length = 301

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  L   G  ++I H   I +VY H     V+ GQ V RG  I  SG +G +  P 
Sbjct: 221 VTYAGW-LSGYGKVVIIDHGYGIQSVYGHNSEILVKVGQSVKRGDIIAKSGNTGRSTGPH 279

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           VHFE+R N   +DP+K+L +
Sbjct: 280 VHFEVRVNGNPVDPMKYLAK 299


>gi|262396723|ref|YP_003288576.1| cell wall endopeptidase family M23/M37 [Vibrio sp. Ex25]
 gi|262340317|gb|ACY54111.1| cell wall endopeptidase family M23/M37 [Vibrio sp. Ex25]
          Length = 404

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H     T Y H+    V+KGQKVSRG  IGLSGK+G    P +H+EL +    
Sbjct: 304 GNYVVVEHGSKYKTRYLHLSKILVKKGQKVSRGQRIGLSGKTGRVTGPHLHYELIEYG-- 361

Query: 73  MDPIKFLEEKIP 84
             P+  +   IP
Sbjct: 362 -RPVNAMRANIP 372


>gi|75910952|ref|YP_325248.1| peptidase M23B [Anabaena variabilis ATCC 29413]
 gi|75704677|gb|ABA24353.1| Peptidase M23B [Anabaena variabilis ATCC 29413]
          Length = 333

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 34/88 (38%), Positives = 46/88 (52%), Gaps = 5/88 (5%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G D   LGN I I+H +  VTVY H       KGQ+V +G  I   G +GN+  P 
Sbjct: 99  VVKAGWDEWGLGNAIEIKHPNGSVTVYGHNRRLLASKGQQVRQGQIIAEMGSTGNSTAPH 158

Query: 62  VHFELRKNA-IAMDPIKFLEE----KIP 84
           +HFE   N  +A++P+  L      KIP
Sbjct: 159 LHFEYYPNGKVAVNPMTVLASATANKIP 186


>gi|24213743|ref|NP_711224.1| M23 family metalloendopeptidase [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45658459|ref|YP_002545.1| membrane metalloendopeptidase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|24194565|gb|AAN48242.1| M23 family metalloendopeptidase [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45601702|gb|AAS71182.1| membrane metalloendopeptidase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 372

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   GN ++I H D   T+Y+H    +VQ+G  V  G  I  SG +G +  P 
Sbjct: 284 VIYAGW-MGGYGNVVVIEHTDDFKTLYAHNSKLFVQRGDYVLAGKKIARSGSTGYSFGPH 342

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+ KN   ++P K+L+
Sbjct: 343 LHFEVIKNGRPVNPSKYLK 361


>gi|295835538|ref|ZP_06822471.1| M23B family peptidase [Streptomyces sp. SPB74]
 gi|295825546|gb|EDY46362.2| M23B family peptidase [Streptomyces sp. SPB74]
          Length = 240

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN-AI 71
           GN I+I+H D   + Y+H+    V  GQ V  G  I LSG +GN   P +HFE+R   A 
Sbjct: 164 GNQIVIKHADGHYSQYAHLSVFKVSAGQSVGEGQQIALSGATGNVTGPHLHFEVRTGPAY 223

Query: 72  AMD--PIKFLEEK 82
             D  PI FL ++
Sbjct: 224 GSDVNPITFLAQR 236


>gi|224534558|ref|ZP_03675134.1| conserved hypothetical protein [Borrelia spielmanii A14S]
 gi|224514235|gb|EEF84553.1| conserved hypothetical protein [Borrelia spielmanii A14S]
          Length = 295

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 52/81 (64%), Gaps = 3/81 (3%)

Query: 1   MVIYVG-NDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQH 59
           +VI VG NDL   GN +++ H ++I ++Y H+++  V+ G  +  G  +G  G++G +  
Sbjct: 217 IVIKVGYNDLY--GNFVVVGHKNNIKSLYGHLNSYSVKIGDFIKSGEFLGRVGQTGRSTG 274

Query: 60  PQVHFELRKNAIAMDPIKFLE 80
           P +HFE+ K  I ++P+KFL+
Sbjct: 275 PHLHFEILKKNIPINPLKFLK 295


>gi|261410067|ref|YP_003246308.1| peptidase M23 [Paenibacillus sp. Y412MC10]
 gi|261286530|gb|ACX68501.1| Peptidase M23 [Paenibacillus sp. Y412MC10]
          Length = 522

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H +   T+Y H+    V  GQ V +G  +G+ G +G +    +HFE++KN +A
Sbjct: 456 GNVVIVDHGNGYRTLYGHMSKISVGNGQSVGQGSKLGVMGNTGRSTGTHLHFEVQKNGVA 515

Query: 73  MDPIKFL 79
            +P+K+L
Sbjct: 516 QNPMKYL 522


>gi|167751111|ref|ZP_02423238.1| hypothetical protein EUBSIR_02096 [Eubacterium siraeum DSM 15702]
 gi|167656029|gb|EDS00159.1| hypothetical protein EUBSIR_02096 [Eubacterium siraeum DSM 15702]
          Length = 628

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G D   LGN ++I H D   TVY+H    +V  GQ+V++G  I   G++G A    
Sbjct: 542 VIFAGWDNGGLGNAVMILHPDGYTTVYAHNSEIFVSAGQEVNQGECIAAVGETGLAYGCH 601

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R  +  ++P  +L
Sbjct: 602 CHFEVRYGSERLNPRYYL 619


>gi|332299390|ref|YP_004441311.1| Peptidase M23 [Porphyromonas asaccharolytica DSM 20707]
 gi|332176453|gb|AEE12143.1| Peptidase M23 [Porphyromonas asaccharolytica DSM 20707]
          Length = 348

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 39/68 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+IRH + + TVY H+     ++GQ V  G  IG  G +G +  P +HFE R   I 
Sbjct: 183 GNYIVIRHPNGLETVYGHMSRCIAKEGQIVKAGEVIGKGGSTGRSTGPHLHFETRFLGID 242

Query: 73  MDPIKFLE 80
           ++P K ++
Sbjct: 243 INPSKIID 250


>gi|328555360|gb|AEB25852.1| forespore protein required for alternative engulfment [Bacillus
           amyloliquefaciens TA208]
 gi|328913730|gb|AEB65326.1| forespore protein required for alternative engulfment [Bacillus
           amyloliquefaciens LL3]
          Length = 289

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 48/88 (54%), Gaps = 11/88 (12%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGK------SG 55
           V+    D V LG  + I H D + TVY  +    V +G KV +   IG SGK      SG
Sbjct: 142 VVKAAKDPV-LGYVVEIEHSDGLSTVYQSLSEVSVDQGDKVKQNQVIGKSGKNLYSEESG 200

Query: 56  NAQHPQVHFELRKNAIAMDPIKFLEEKI 83
           N     VHFE+RK+ +AM+P+ F+++ +
Sbjct: 201 N----HVHFEIRKDGVAMNPLNFMDKPV 224


>gi|291556872|emb|CBL33989.1| Membrane proteins related to metalloendopeptidases [Eubacterium
           siraeum V10Sc8a]
          Length = 628

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G D   LGN ++I H D   TVY+H    +V  GQ+V++G  I   G++G A    
Sbjct: 542 VIFAGWDNGGLGNAVMILHPDGYTTVYAHNSEIFVSAGQEVNQGECIAAVGETGLAYGCH 601

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R  +  ++P  +L
Sbjct: 602 CHFEVRYGSERLNPRYYL 619


>gi|329925022|ref|ZP_08279966.1| peptidase, M23 family [Paenibacillus sp. HGF5]
 gi|328940141|gb|EGG36473.1| peptidase, M23 family [Paenibacillus sp. HGF5]
          Length = 522

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H +   T+Y H+    V  GQ V +G  +G+ G +G +    +HFE++KN +A
Sbjct: 456 GNVVIVDHGNGYRTLYGHMSKISVGNGQSVGQGSKLGVMGNTGRSTGTHLHFEVQKNGVA 515

Query: 73  MDPIKFL 79
            +P+K+L
Sbjct: 516 QNPMKYL 522


>gi|90417982|ref|ZP_01225894.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337654|gb|EAS51305.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 350

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 46/77 (59%), Gaps = 4/77 (5%)

Query: 10  VELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR 67
           +E GN +++ H   + + Y H+   +  V+ G  V++   +GL G SG AQ P VHF ++
Sbjct: 137 IECGNGVVVEHGSGLTSQYCHLRMGSIVVRPGMPVTQSTQLGLIGSSGQAQFPHVHFAMQ 196

Query: 68  KNAIAMDPI--KFLEEK 82
           ++  A+DP+  +FL E+
Sbjct: 197 RDGAAIDPLTGRFLREE 213


>gi|297182118|gb|ADI18291.1| membrane proteins related to metalloendopeptidases [uncultured
           Chromatiales bacterium HF0200_41F04]
          Length = 507

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 52/86 (60%), Gaps = 4/86 (4%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHID--TPYVQKGQKVSRGHTIGLSGKSGNAQH 59
           +I+ GN     G T++I+H +S  T+++H+   +  V+ G ++ +G TIG  GK+G A  
Sbjct: 370 IIFAGNK-GGYGRTVVIQHGESYSTLFAHMSRISRGVKNGSRIKQGQTIGYVGKTGLATG 428

Query: 60  PQVHFELRKNAIAMDPIKF-LEEKIP 84
           P +H+E R N +  +P+K  L E +P
Sbjct: 429 PHLHYEFRINGVHRNPLKVRLPEALP 454


>gi|294630660|ref|ZP_06709220.1| peptidase [Streptomyces sp. e14]
 gi|292833993|gb|EFF92342.1| peptidase [Streptomyces sp. e14]
          Length = 193

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 3/79 (3%)

Query: 6   GNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFE 65
           G D    GN I+I+H +   + Y+H+    V+ GQ V+ G  I LSG +GN   P +HFE
Sbjct: 110 GGDGPAYGNAIVIKHGNGTYSQYAHLSRIDVKVGQVVATGQHIALSGNTGNTTGPHLHFE 169

Query: 66  LRKN---AIAMDPIKFLEE 81
           +R       A++P+ FL  
Sbjct: 170 IRTTPNYGSAVNPVVFLRA 188


>gi|34763967|ref|ZP_00144860.1| Cell wall endopeptidase, family M23/M37 [Fusobacterium nucleatum
           subsp. vincentii ATCC 49256]
 gi|27886258|gb|EAA23541.1| Cell wall endopeptidase, family M23/M37 [Fusobacterium nucleatum
           subsp. vincentii ATCC 49256]
          Length = 320

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRH++   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 242 VVTFAGN-MSGYGKIIIIRHENGYETRYAHLSVISTNVGEHVNQGDLIGKTGNSGRTTGA 300

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 301 HLHFEIRHNGVPKNPMKYLQ 320


>gi|310779247|ref|YP_003967580.1| Peptidase M23 [Ilyobacter polytropus DSM 2926]
 gi|309748570|gb|ADO83232.1| Peptidase M23 [Ilyobacter polytropus DSM 2926]
          Length = 325

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+I+H     T  +H++   V+ GQ V +G  IG +G +G    P +HFE+RKN + 
Sbjct: 257 GKIIIIKHSGGYETRAAHLNNINVKPGQYVKQGQVIGKTGMTGRVTGPHLHFEIRKNGVP 316

Query: 73  MDPIKFL 79
            +P+K+L
Sbjct: 317 YNPMKYL 323


>gi|167629006|ref|YP_001679505.1| peptidoglycan-binding peptidase m23b, putative [Heliobacterium
           modesticaldum Ice1]
 gi|167591746|gb|ABZ83494.1| peptidoglycan-binding peptidase m23b, putative [Heliobacterium
           modesticaldum Ice1]
          Length = 256

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G   V  G T++I H   + T+Y+H     V +G++V RG  I   G +G A  P 
Sbjct: 173 VVFAGWKAV-YGQTVIIEHPFGVATLYAHSSKILVNEGERVERGRPIAQVGATGVATGPH 231

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R ++ A++P  +L
Sbjct: 232 LHFEVRLDSRAVNPAAYL 249


>gi|145588651|ref|YP_001155248.1| peptidase M23B [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145047057|gb|ABP33684.1| peptidase M23B [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 484

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 12  LGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN 69
            GN I++ H  +  T Y+H+    P ++ G +V RG  IG  G +G +  P +HFELRK+
Sbjct: 386 FGNLIVLEHPGNYHTYYAHLSNYNPELELGNEVRRGLEIGYVGTTGRSTGPHLHFELRKD 445

Query: 70  AIAMDP 75
            I +DP
Sbjct: 446 GIYVDP 451


>gi|319786404|ref|YP_004145879.1| peptidase M23 [Pseudoxanthomonas suwonensis 11-1]
 gi|317464916|gb|ADV26648.1| Peptidase M23 [Pseudoxanthomonas suwonensis 11-1]
          Length = 278

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+++H++  ++ Y H     V +GQ V  G  I   G++G  +  
Sbjct: 198 VVVYSGAGLVGYGELIIVKHNEQWLSAYGHNRKRLVSEGQAVKAGQQIAEMGRTGTDRE- 256

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
           ++HFE+R N   +DP+ +L +K
Sbjct: 257 KLHFEIRYNGKPVDPLLYLPKK 278


>gi|319638144|ref|ZP_07992907.1| membrane peptidase [Neisseria mucosa C102]
 gi|317400417|gb|EFV81075.1| membrane peptidase [Neisseria mucosa C102]
          Length = 303

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S ++ Y H     V + Q V RG TI   G + +A   Q
Sbjct: 225 VVYAGSGLRGYGNLVIIQHNSSFLSAYGHNQRLLVNENQTVKRGQTIAHMGNT-DASRTQ 283

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 284 LHFEIRQNGKPVNPANYV 301


>gi|262279693|ref|ZP_06057478.1| peptidase M23/M37 family [Acinetobacter calcoaceticus RUH2202]
 gi|262260044|gb|EEY78777.1| peptidase M23/M37 family [Acinetobacter calcoaceticus RUH2202]
          Length = 269

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 42/69 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T+LI H   +++++ H+    V+KGQ + +G T+GL GK+G    P +H+ +  N   
Sbjct: 199 GQTVLIDHGQGLISMFCHLSAIKVEKGQHIRQGETLGLVGKTGRVTGPHLHWGMSLNNAR 258

Query: 73  MDPIKFLEE 81
           +DP  FL++
Sbjct: 259 VDPQLFLDK 267


>gi|218674641|ref|ZP_03524310.1| Peptidase M23 [Rhizobium etli GR56]
          Length = 440

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + + H + I T Y H+    V+ G  V R   IGL+G +G +    +H+E+R+N  A
Sbjct: 363 GNMVEVDHGNGISTRYGHMSQVLVKVGDTVGRNDVIGLAGSTGRSTGTHLHYEVRQNGQA 422

Query: 73  MDPIKFL 79
           +DP+ F+
Sbjct: 423 VDPVYFM 429


>gi|224531978|ref|ZP_03672610.1| M23 peptidase domain protein [Borrelia valaisiana VS116]
 gi|224511443|gb|EEF81849.1| M23 peptidase domain protein [Borrelia valaisiana VS116]
          Length = 410

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+ VG +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 331 IVVTVGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 390

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 391 HLHFTIFKNGKTENPMKYLR 410


>gi|160900459|ref|YP_001566041.1| peptidase M23B [Delftia acidovorans SPH-1]
 gi|160366043|gb|ABX37656.1| peptidase M23B [Delftia acidovorans SPH-1]
          Length = 292

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN I+++H+++ +T Y+H  T  V++ Q V +G  I   G S +A   +
Sbjct: 213 VVYAGAGLRGYGNLIILKHNNTYLTAYAHNQTLLVKEDQTVRKGQKIAEMG-STDADRVK 271

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 272 LHFEVRRQGKPVDPSRYLPSR 292


>gi|153870860|ref|ZP_02000169.1| Peptidase M23B [Beggiatoa sp. PS]
 gi|152072676|gb|EDN69833.1| Peptidase M23B [Beggiatoa sp. PS]
          Length = 329

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 1/69 (1%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIG-LSGKSGNAQHPQVHFELRKNAI 71
           G  + + H + + T+Y H+    V+ GQKV RG  IG + G  GNA  PQ+HFE++ N +
Sbjct: 225 GLYVKLHHGNQLYTLYIHLKKANVKVGQKVRRGDVIGKIDGPVGNAIAPQLHFEIKPNNL 284

Query: 72  AMDPIKFLE 80
           ++DP+  +E
Sbjct: 285 SIDPLPLIE 293


>gi|121535502|ref|ZP_01667311.1| peptidase M23B [Thermosinus carboxydivorans Nor1]
 gi|121305921|gb|EAX46854.1| peptidase M23B [Thermosinus carboxydivorans Nor1]
          Length = 373

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T++I H   I T+Y+H     V +GQ+V +G  I   G +G +  P +HFE+R+N   
Sbjct: 306 GKTVIIDHGGGISTLYAHNSELLVSEGQRVRKGQPIARVGSTGYSTGPHLHFEVRQNGSP 365

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 366 VNPLGYL 372


>gi|325103094|ref|YP_004272748.1| Peptidase M23 [Pedobacter saltans DSM 12145]
 gi|324971942|gb|ADY50926.1| Peptidase M23 [Pedobacter saltans DSM 12145]
          Length = 322

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  GN+    GN I+I H    VT Y+H+     +KG++V RG  IG  G +G +  P
Sbjct: 221 VVIAQGNER-GYGNRIMINHGYGYVTKYAHMSKFKAKKGERVKRGDLIGYVGNTGASTGP 279

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+ KN   ++P+ F 
Sbjct: 280 HLHYEVFKNGKVVNPMNFF 298


>gi|225076478|ref|ZP_03719677.1| hypothetical protein NEIFLAOT_01524 [Neisseria flavescens
           NRL30031/H210]
 gi|224952157|gb|EEG33366.1| hypothetical protein NEIFLAOT_01524 [Neisseria flavescens
           NRL30031/H210]
          Length = 319

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S ++ Y H     V + Q V RG TI   G + +A   Q
Sbjct: 241 VVYAGSGLRGYGNLVIIQHNSSFLSAYGHNQRLLVNENQTVKRGQTIAHMGNT-DASRTQ 299

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 300 LHFEIRQNGKPVNPANYV 317


>gi|224824775|ref|ZP_03697882.1| Peptidase M23 [Lutiella nitroferrum 2002]
 gi|224603268|gb|EEG09444.1| Peptidase M23 [Lutiella nitroferrum 2002]
          Length = 361

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   G  I+I+H+ + ++ Y+H     V++GQ V +G  I   G + +A   +
Sbjct: 281 VVYSGNGLRGYGKLIIIKHNKTFLSAYAHNSQLLVKEGQAVKKGQPIAEMGNT-DADQVK 339

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+++L+
Sbjct: 340 LHFEIRRFGKPVDPLQYLD 358


>gi|160931704|ref|ZP_02079098.1| hypothetical protein CLOLEP_00536 [Clostridium leptum DSM 753]
 gi|156869349|gb|EDO62721.1| hypothetical protein CLOLEP_00536 [Clostridium leptum DSM 753]
          Length = 443

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVE-LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           V+ +  DL +  GN ++I H +   T+Y+H    YV +GQ VS+G  I   G SGN+   
Sbjct: 363 VVTIAGDLNDGYGNYVVIDHGNGYKTLYAHGSAIYVTQGQYVSKGQPILAVGNSGNSYGS 422

Query: 61  QVHFELRKNAIAMDPIKF 78
            +HFE+ +N   ++P+ F
Sbjct: 423 HLHFEIIENGTEVNPLNF 440


>gi|154687772|ref|YP_001422933.1| SpoIIQ [Bacillus amyloliquefaciens FZB42]
 gi|154353623|gb|ABS75702.1| SpoIIQ [Bacillus amyloliquefaciens FZB42]
          Length = 289

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 48/88 (54%), Gaps = 11/88 (12%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGK------SG 55
           V+    D V LG  + I H D + TVY  +    V +G KV +   IG SGK      SG
Sbjct: 142 VVKAAKDPV-LGYVVEIEHSDGLSTVYQSLSEVSVDQGDKVKQNQVIGKSGKNLYSEESG 200

Query: 56  NAQHPQVHFELRKNAIAMDPIKFLEEKI 83
           N     VHFE+RK+ +AM+P+ F+++ +
Sbjct: 201 N----HVHFEIRKDGVAMNPLNFMDKPV 224


>gi|241760454|ref|ZP_04758547.1| membrane peptidase [Neisseria flavescens SK114]
 gi|241318958|gb|EER55460.1| membrane peptidase [Neisseria flavescens SK114]
          Length = 303

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S ++ Y H     V + Q V RG TI   G + +A   Q
Sbjct: 225 VVYAGSGLRGYGNLVIIQHNSSFLSAYGHNQRLLVNENQTVKRGQTIAHMGNT-DASRTQ 283

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 284 LHFEIRQNGKPVNPANYV 301


>gi|89075069|ref|ZP_01161510.1| hypothetical lipoprotein NlpD [Photobacterium sp. SKA34]
 gi|89049156|gb|EAR54721.1| hypothetical lipoprotein NlpD [Photobacterium sp. SKA34]
          Length = 293

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G+ L   GN ++I+H +  ++ Y+H D   V++ Q+V  G  I   G +G A   
Sbjct: 214 LVVYAGDALPGYGNLVIIKHGEDYLSAYAHNDKILVKEQQQVKAGQKIASMGSTG-ASSV 272

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+R    ++DP+++L +
Sbjct: 273 RLHFEIRYKGKSVDPMRYLPK 293


>gi|307719539|ref|YP_003875071.1| M23/M37 peptidase domain-containing protein [Spirochaeta
           thermophila DSM 6192]
 gi|306533264|gb|ADN02798.1| M23/M37 peptidase domain protein [Spirochaeta thermophila DSM 6192]
          Length = 344

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 46/78 (58%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+   +D +  GN ++IRH     T Y+H+    V+KGQ+V +G  IG+ G +G +    
Sbjct: 256 VVEAKSDPLGWGNYVVIRHRYGFYTRYAHLQYYLVKKGQEVHQGQVIGMMGSTGLSTGRH 315

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+   +  +DP+KFL
Sbjct: 316 LHYEVMIGSEVIDPLKFL 333


>gi|90580345|ref|ZP_01236152.1| hypothetical lipoprotein NlpD [Vibrio angustum S14]
 gi|90438647|gb|EAS63831.1| hypothetical lipoprotein NlpD [Vibrio angustum S14]
          Length = 283

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G+ L   GN ++I+H +  ++ Y+H D   V++ Q+V  G  I   G +G A   
Sbjct: 204 LVVYAGDALPGYGNLVIIKHGEDYLSAYAHNDKILVKEQQQVKAGQKIASMGSTG-ASSV 262

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+R    ++DP+++L +
Sbjct: 263 RLHFEIRYKGKSVDPMRYLPK 283


>gi|47176982|ref|YP_015593.1| periplasmic protein [Oligotropha carboxidovorans OM5]
 gi|47115384|emb|CAG28440.1| periplasmic protein [Oligotropha carboxidovorans OM5]
          Length = 325

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 11  ELGNTILIRHDDSIVTVYSHID--TPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRK 68
           E GN ++I H D   T Y H+   +  V+ GQ VS G +IGL G SG  + P +HF +R 
Sbjct: 113 ECGNGVVISHSDGWETQYCHLGEGSIRVKAGQPVSAGQSIGLVGLSGRTEFPHLHFTVRH 172

Query: 69  NAIAMDP 75
           N   +DP
Sbjct: 173 NGRVVDP 179


>gi|33519640|ref|NP_878472.1| lipoprotein NlpD precursor [Candidatus Blochmannia floridanus]
 gi|33517303|emb|CAD83688.1| lipoprotein NlpD precursor [Candidatus Blochmannia floridanus]
          Length = 315

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIYVG+ L   GN I+I+HD++ ++ Y+H +  +V + Q V+ G  I   G SG  +  +
Sbjct: 234 VIYVGDALQGYGNLIIIKHDNNYLSAYAHNNKVFVSEKQHVNVGDQIATMGNSGTNE-VK 292

Query: 62  VHFELRKNAIAMDPIKFL 79
           ++FE+R    ++DP+  +
Sbjct: 293 LYFEIRHKGKSVDPLHLM 310


>gi|228470761|ref|ZP_04055610.1| peptidase, M23/M37 family [Porphyromonas uenonis 60-3]
 gi|228307525|gb|EEK16527.1| peptidase, M23/M37 family [Porphyromonas uenonis 60-3]
          Length = 343

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 38/68 (55%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+IRH + + TVY H+     Q+GQ V  G  IG  G +G +  P +HFE R   I 
Sbjct: 181 GNYIVIRHPNGLETVYGHMSRCIAQEGQIVRAGEVIGKGGSTGRSTGPHLHFETRFLGID 240

Query: 73  MDPIKFLE 80
           ++P   ++
Sbjct: 241 INPAHIID 248


>gi|78485598|ref|YP_391523.1| peptidase M23B [Thiomicrospira crunogena XCL-2]
 gi|78363884|gb|ABB41849.1| M23B peptidase family protein with a LysM domain [Thiomicrospira
           crunogena XCL-2]
          Length = 239

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 43/73 (58%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +   GN ++I+HD+  +TVY+H  T  V++G +V +   +   G++G+   PQ
Sbjct: 160 VVYAGNGIAHYGNMVIIKHDNEYLTVYAHNRTLKVREGMRVEKRQLVATLGQTGSVSKPQ 219

Query: 62  VHFELRKNAIAMD 74
           ++ E R     +D
Sbjct: 220 LYVEARYRGRKVD 232


>gi|307266328|ref|ZP_07547867.1| Peptidase M23 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918635|gb|EFN48870.1| Peptidase M23 [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 66

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (57%)

Query: 18 IRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDPIK 77
          I H +  VT Y H     V+KG KV++G  I L G +G A    +HFE+RKN + ++P+ 
Sbjct: 3  IDHHNGYVTYYGHASKLLVKKGDKVAKGQKIALVGSTGRATGSHLHFEVRKNGVPVNPLS 62

Query: 78 FLEE 81
          +L  
Sbjct: 63 YLNR 66


>gi|239945836|ref|ZP_04697773.1| M23 family secreted peptidase [Streptomyces roseosporus NRRL 15998]
 gi|239992305|ref|ZP_04712969.1| M23 family secreted peptidase [Streptomyces roseosporus NRRL 11379]
 gi|291449292|ref|ZP_06588682.1| secreted protein [Streptomyces roseosporus NRRL 15998]
 gi|291352239|gb|EFE79143.1| secreted protein [Streptomyces roseosporus NRRL 15998]
          Length = 448

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           G  ++IRH D   + Y+H+   +V+ GQ VS G  I  SG +GN+  P +HFE+R     
Sbjct: 372 GYEVVIRHSDGKYSQYAHLSALHVRAGQSVSGGQRIARSGSTGNSTGPHLHFEIRTGPGY 431

Query: 70  AIAMDPIKFL 79
              +DP+ +L
Sbjct: 432 GSDVDPLAYL 441


>gi|219684568|ref|ZP_03539511.1| M23 peptidase domain protein [Borrelia garinii PBr]
 gi|219671930|gb|EED28984.1| M23 peptidase domain protein [Borrelia garinii PBr]
          Length = 417

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+ VG +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 IVVTVGFNAGGYGKYIIISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|152980876|ref|YP_001353825.1| lipoprotein nlpD precursor [Janthinobacterium sp. Marseille]
 gi|151280953|gb|ABR89363.1| lipoprotein nlpD precursor [Janthinobacterium sp. Marseille]
          Length = 317

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ +   GN ++++H  ++++ Y+H     V++GQ V++G  I   G S ++   +
Sbjct: 238 VMYAGSGIRGYGNLVIVKHTSNLLSAYAHNKAILVKEGQNVNKGQKIAEMGDS-DSDSVK 296

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP KFL  +
Sbjct: 297 LHFEIRQQGKPVDPSKFLPSR 317


>gi|29831243|ref|NP_825877.1| peptidase [Streptomyces avermitilis MA-4680]
 gi|29608358|dbj|BAC72412.1| putative peptidase [Streptomyces avermitilis MA-4680]
          Length = 203

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 3/78 (3%)

Query: 7   NDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFEL 66
            D    GN I+I+H +   + Y+H+    V+ GQ V+ G  I LSG +GN+  P +HFE+
Sbjct: 121 GDGPAYGNAIVIKHGNGTYSQYAHLSRIDVRIGQVVATGQHIALSGNTGNSSGPHLHFEI 180

Query: 67  RKN---AIAMDPIKFLEE 81
           R        +DP+ FL  
Sbjct: 181 RTTPNYGSGIDPVAFLRA 198


>gi|315186660|gb|EFU20419.1| Peptidase M23 [Spirochaeta thermophila DSM 6578]
          Length = 344

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 46/78 (58%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+   +D +  GN ++IRH     T Y+H+    V+KGQ+V +G  IG+ G +G +    
Sbjct: 256 VVEAKSDPLGWGNYVVIRHRYGFYTRYAHLQYYLVKKGQEVHQGQVIGMMGSTGLSTGRH 315

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+   +  +DP+KFL
Sbjct: 316 LHYEVMIGSEVIDPLKFL 333


>gi|227329519|ref|ZP_03833543.1| hypothetical protein PcarcW_20116 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 440

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH     T Y H+    V+ GQKV RG  IGLSG +G +  P +H+E   N  A
Sbjct: 345 GNYVAIRHGRQYTTRYMHMHRILVKPGQKVKRGDRIGLSGNTGRSTGPHLHYEFWINQQA 404

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 405 VNP---LTAKLP 413


>gi|284799933|ref|ZP_05985250.2| peptidase M23B [Neisseria subflava NJ9703]
 gi|284796385|gb|EFC51732.1| peptidase M23B [Neisseria subflava NJ9703]
          Length = 317

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S ++ Y H     V + Q V RG TI   G + +A   Q
Sbjct: 239 VVYAGSGLRGYGNLVIIQHNSSFLSAYGHNQRLLVNENQTVKRGQTIAHMGNT-DASRTQ 297

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 298 LHFEIRQNGKPVNPANYV 315


>gi|308175387|ref|YP_003922092.1| forespore protein [Bacillus amyloliquefaciens DSM 7]
 gi|307608251|emb|CBI44622.1| forespore protein required for alternative engulfment [Bacillus
           amyloliquefaciens DSM 7]
          Length = 289

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 48/88 (54%), Gaps = 11/88 (12%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGK------SG 55
           V+    D V LG  + I H D + TVY  +    V +G KV +   IG SGK      SG
Sbjct: 142 VVKAAKDPV-LGYMVEIEHSDGLSTVYQSLSEVSVDQGDKVKQNQVIGKSGKNLYSEESG 200

Query: 56  NAQHPQVHFELRKNAIAMDPIKFLEEKI 83
           N     VHFE+RK+ +AM+P+ F+++ +
Sbjct: 201 N----HVHFEIRKDGVAMNPLNFMDKPV 224


>gi|297155538|gb|ADI05250.1| hypothetical protein SBI_02129 [Streptomyces bingchenggensis BCW-1]
          Length = 430

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           G  +++RH D + + Y+H+    V  GQ VS G  +G SG +GN   P VHFE+R     
Sbjct: 354 GYQVVLRHSDGMYSQYAHMSALTVHVGQTVSAGQQLGRSGATGNVTGPHVHFEVRTGPDY 413

Query: 70  AIAMDPIKFLEEK 82
              ++P+ +L  K
Sbjct: 414 GSDVNPLAYLRSK 426


>gi|217967488|ref|YP_002352994.1| peptidase M23 [Dictyoglomus turgidum DSM 6724]
 gi|217336587|gb|ACK42380.1| Peptidase M23 [Dictyoglomus turgidum DSM 6724]
          Length = 375

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I+I H   I TVY H+    V+ G++++ G  IG  G +G +  P +HFE+R N   
Sbjct: 308 GNMIIIDHGGKISTVYGHLSKIVVKVGEEIAEGDVIGYVGSTGLSTGPHLHFEVRINGDP 367

Query: 73  MDPIKFLE 80
           +DP+ +L+
Sbjct: 368 VDPLTWLK 375


>gi|56698002|ref|YP_168373.1| M24/M37 family peptidase [Ruegeria pomeroyi DSS-3]
 gi|56679739|gb|AAV96405.1| peptidase, M23/M37 family [Ruegeria pomeroyi DSS-3]
          Length = 246

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 11  ELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRK 68
           E GN +++RH+D   T Y H+   +  V+KG +V  G  +G  G SG AQ P VH  +R 
Sbjct: 39  ECGNGVVVRHEDGWETQYCHLKQGSVRVRKGDRVQSGTVLGQVGISGKAQFPHVHLSVRH 98

Query: 69  NAIAMDPIKFLE 80
           N   +DP    E
Sbjct: 99  NGAVIDPFDTGE 110


>gi|325294919|ref|YP_004281433.1| peptidase M23 [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325065367|gb|ADY73374.1| Peptidase M23 [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 290

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 42/69 (60%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
           +G  I+I+H+    T Y H+   +V+KG+ V +G  IG++G SG +  P +H+ ++    
Sbjct: 219 MGKCIVIKHNKDFSTYYGHLAKIFVKKGEYVEKGQIIGITGNSGRSTGPHLHYTIKYKNK 278

Query: 72  AMDPIKFLE 80
            ++PI ++E
Sbjct: 279 IVNPIAYME 287


>gi|237741511|ref|ZP_04571992.1| cell wall endopeptidase [Fusobacterium sp. 4_1_13]
 gi|256844846|ref|ZP_05550304.1| M23B subfamily peptidase [Fusobacterium sp. 3_1_36A2]
 gi|294785873|ref|ZP_06751161.1| cell wall endopeptidase family M23/M37 [Fusobacterium sp. 3_1_27]
 gi|229429159|gb|EEO39371.1| cell wall endopeptidase [Fusobacterium sp. 4_1_13]
 gi|256718405|gb|EEU31960.1| M23B subfamily peptidase [Fusobacterium sp. 3_1_36A2]
 gi|294487587|gb|EFG34949.1| cell wall endopeptidase family M23/M37 [Fusobacterium sp. 3_1_27]
          Length = 373

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRH++   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 295 VVTFAGN-MSGYGKIIIIRHENGYETRYAHLSVISTNVGEHVNQGDLIGKTGNSGRTTGA 353

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 354 HLHFEIRHNGVPKNPMKYLQ 373


>gi|16080708|ref|NP_391536.1| forespore protein required for alternative engulfment [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|221311612|ref|ZP_03593459.1| required for completion of engulfment [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315939|ref|ZP_03597744.1| required for completion of engulfment [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221320851|ref|ZP_03602145.1| required for completion of engulfment [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221325136|ref|ZP_03606430.1| required for completion of engulfment [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|81345683|sp|P71044|SP2Q_BACSU RecName: Full=Stage II sporulation protein Q
 gi|1592705|emb|CAA69855.1| hypothetical protein [Bacillus subtilis subsp. subtilis str. 168]
 gi|2636180|emb|CAB15672.1| forespore protein required for alternative engulfment [Bacillus
           subtilis subsp. subtilis str. 168]
          Length = 283

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 43/75 (57%), Gaps = 10/75 (13%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGK------SGNAQHPQVHFE 65
           LG  + + H D + TVY  +    V++G KV +   IG SGK      SGN     VHFE
Sbjct: 151 LGYVVEVEHADGLSTVYQSLSEVSVEQGDKVKQNQVIGKSGKNLYSEDSGN----HVHFE 206

Query: 66  LRKNAIAMDPIKFLE 80
           +RK+ +AM+P+ F++
Sbjct: 207 IRKDGVAMNPLNFMD 221


>gi|319651391|ref|ZP_08005520.1| hypothetical protein HMPREF1013_02132 [Bacillus sp. 2_A_57_CT2]
 gi|317396922|gb|EFV77631.1| hypothetical protein HMPREF1013_02132 [Bacillus sp. 2_A_57_CT2]
          Length = 299

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I I+H++   TVY+H+D  +  +G+ V +G  IGL G +G++    +HFE+   A  
Sbjct: 92  GNVIFIKHNNRTETVYAHLDKRFSAEGESVGQGQKIGLMGSTGDSSGVHLHFEIHTQAWT 151

Query: 73  MDPIKFLEEKIP 84
            D I  ++  + 
Sbjct: 152 ADKINAVDPSVA 163


>gi|284006984|emb|CBA72261.1| peptidase [Arsenophonus nasoniae]
          Length = 451

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 36/64 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I IRH     T Y H+    V+ GQKV RG  I LSG +G    P +H+EL  N  A
Sbjct: 356 GNFIAIRHGRQYTTRYMHLRKLLVKPGQKVKRGERIALSGNTGRTTGPHLHYELWFNQRA 415

Query: 73  MDPI 76
           ++P+
Sbjct: 416 VNPL 419


>gi|239927312|ref|ZP_04684265.1| peptidase [Streptomyces ghanaensis ATCC 14672]
 gi|291435652|ref|ZP_06575042.1| secreted protein [Streptomyces ghanaensis ATCC 14672]
 gi|291338547|gb|EFE65503.1| secreted protein [Streptomyces ghanaensis ATCC 14672]
          Length = 418

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN-- 69
            G  +++RH D   + Y+H+    V+ GQ V+ G  IG SG +GN+  P +HFE+R    
Sbjct: 341 FGYQVVVRHADGRYSQYAHLSAISVRSGQSVAAGQRIGRSGSTGNSSGPHLHFEVRTGPG 400

Query: 70  -AIAMDPIKFL 79
               +DP+ +L
Sbjct: 401 FGSDVDPVAYL 411


>gi|227111599|ref|ZP_03825255.1| hypothetical protein PcarbP_01480 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 440

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH     T Y H+    V+ GQKV RG  IGLSG +G +  P +H+E   N  A
Sbjct: 345 GNYVAIRHGRQYTTRYMHMHRILVKPGQKVKRGDRIGLSGNTGRSTGPHLHYEFWINQQA 404

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 405 VNP---LTAKLP 413


>gi|119944448|ref|YP_942128.1| peptidase M23B [Psychromonas ingrahamii 37]
 gi|119863052|gb|ABM02529.1| peptidase M23B [Psychromonas ingrahamii 37]
          Length = 285

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN I+I+H+D  ++ Y+H +   + + Q+V  G  I   G SG     +
Sbjct: 206 VVYAGAGLRGFGNLIIIKHNDDYLSAYAHNEQLLISEKQQVKAGQKIATMGDSG-TDSVK 264

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L ++
Sbjct: 265 LHFEIRYQGKSIDPMRYLPKR 285


>gi|134301126|ref|YP_001114622.1| peptidase M23B [Desulfotomaculum reducens MI-1]
 gi|134053826|gb|ABO51797.1| peptidase M23B [Desulfotomaculum reducens MI-1]
          Length = 448

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H + IVT Y+H+ T  V  GQ V RG +IG  G +G +  P +HFE+  N + 
Sbjct: 382 GKCVDINHGNGIVTRYAHLSTINVSVGQNVERGQSIGNVGSTGRSTGPHLHFEVIVNGVP 441

Query: 73  MDPIKFL 79
            +P+ +L
Sbjct: 442 KNPVGYL 448


>gi|163782708|ref|ZP_02177704.1| lipoprotein NlpD fragment [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881829|gb|EDP75337.1| lipoprotein NlpD fragment [Hydrogenivirga sp. 128-5-R1-1]
          Length = 177

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 41/67 (61%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T++I H    +T+Y+H+ +  V++G++VS+   IG  G SG    P +H+E+ K  I 
Sbjct: 110 GKTVIIYHGYGYITLYAHMSSVVVKRGEEVSKNRVIGYVGSSGRTTGPHLHYEVIKYGIR 169

Query: 73  MDPIKFL 79
            +PI +L
Sbjct: 170 QNPIAYL 176


>gi|153870836|ref|ZP_02000150.1| Peptidase M23B [Beggiatoa sp. PS]
 gi|152072697|gb|EDN69849.1| Peptidase M23B [Beggiatoa sp. PS]
          Length = 325

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I+H +   T Y H     V  G +V +G  I L G +G +  P VHFE+R+  +A
Sbjct: 236 GRLVEIKHGELYTTRYGHNSRNLVNTGDRVRKGQIIALVGSTGRSTGPHVHFEVRQAGVA 295

Query: 73  MDPIKFL 79
           ++P+K+L
Sbjct: 296 INPVKYL 302


>gi|94500746|ref|ZP_01307275.1| peptidase M23/LysM domain protein [Oceanobacter sp. RED65]
 gi|94427068|gb|EAT12049.1| peptidase M23/LysM domain protein [Oceanobacter sp. RED65]
          Length = 271

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L+  GN ++I+H+   ++ Y+H     V++ Q+V     I   G SG  Q  +
Sbjct: 192 VVYAGSGLLGYGNLVIIKHNQEFLSAYAHNKKLLVKENQQVKARQPIAEIGSSGTDQ-VK 250

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+K+L +K
Sbjct: 251 LHFEIRRRGKPVDPLKYLPKK 271


>gi|302339124|ref|YP_003804330.1| peptidase M23 [Spirochaeta smaragdinae DSM 11293]
 gi|301636309|gb|ADK81736.1| Peptidase M23 [Spirochaeta smaragdinae DSM 11293]
          Length = 370

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ VG+     G  ++IRH     ++Y H+    V+KGQ +S+G  IG  G +G +  P 
Sbjct: 290 VVLVGDRPRGFGKYVVIRHSHGFQSLYGHLSRILVRKGQHISQGQQIGEMGSTGRSTGPH 349

Query: 62  VHFELRKNAIAMDPI 76
           +HF L +N + ++P+
Sbjct: 350 LHFALYRNNVPVNPL 364


>gi|194289274|ref|YP_002005181.1| peptidase; exported protein [Cupriavidus taiwanensis LMG 19424]
 gi|193223109|emb|CAQ69114.1| putative peptidase; putative exported protein [Cupriavidus
           taiwanensis LMG 19424]
          Length = 241

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 5/81 (6%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
            I+VGN L   G  ++++H+D  +TVY ++D P V +G +VS G  +G  G S +    +
Sbjct: 165 AIHVGN-LRGYGMLVIVKHNDDWLTVYGNLDQPLVSEGAQVSAGQDVGRMGASPS----E 219

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R N   ++P  +L  +
Sbjct: 220 LHFEVRGNGKPVNPAAYLPSR 240


>gi|85058508|ref|YP_454210.1| lipoprotein NlpD [Sodalis glossinidius str. 'morsitans']
 gi|84779028|dbj|BAE73805.1| lipoprotein [Sodalis glossinidius str. 'morsitans']
          Length = 362

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I  +  S      +
Sbjct: 283 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVRAGQKIA-TMGSTGTSTTR 341

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 342 LHFEIRYKGKSVNPLRYLPQR 362


>gi|325291332|ref|YP_004267513.1| Peptidase M23 [Syntrophobotulus glycolicus DSM 8271]
 gi|324966733|gb|ADY57512.1| Peptidase M23 [Syntrophobotulus glycolicus DSM 8271]
          Length = 378

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H + + ++Y H+ +  +  G  VS G TIG  G +G +  P +HFE+R+N   
Sbjct: 311 GNAVIINHGNGLSSLYGHMSSIAIANGAAVSPGQTIGYVGSTGWSTGPHLHFEIRQNGNP 370

Query: 73  MDPIKFLE 80
           ++P+ + +
Sbjct: 371 VNPLGYFQ 378


>gi|296331286|ref|ZP_06873758.1| forespore protein required for alternative engulfment [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305676272|ref|YP_003867944.1| forespore protein required for alternative engulfment [Bacillus
           subtilis subsp. spizizenii str. W23]
 gi|296151401|gb|EFG92278.1| forespore protein required for alternative engulfment [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305414516|gb|ADM39635.1| forespore protein required for alternative engulfment [Bacillus
           subtilis subsp. spizizenii str. W23]
          Length = 290

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 10/79 (12%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGK------SGNAQHPQVHFE 65
           LG  + + H D + TVY  +    V++G KV +   IG SGK      SGN     VHFE
Sbjct: 151 LGYVVEVEHADGLSTVYQSLSEVSVEQGDKVKQNQVIGKSGKNLYSEDSGN----HVHFE 206

Query: 66  LRKNAIAMDPIKFLEEKIP 84
           +RK+ +AM+P+ F+++ + 
Sbjct: 207 IRKDGVAMNPLNFMDKPVS 225


>gi|226940010|ref|YP_002795083.1| lipoprotein [Laribacter hongkongensis HLHK9]
 gi|226714936|gb|ACO74074.1| Probable lipoprotein [Laribacter hongkongensis HLHK9]
          Length = 233

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  +   GN +++RH D  +T Y+H     V++ Q V  G TI   G SG     +
Sbjct: 156 VVYAGAGIKSYGNLLILRHSDDWLTAYAHNQQLLVKENQTVKAGQTIARMGNSGT-DRVK 214

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFELR    A DP  +L 
Sbjct: 215 LHFELRYKGNATDPRPYLR 233


>gi|321313202|ref|YP_004205489.1| forespore protein [Bacillus subtilis BSn5]
 gi|291486229|dbj|BAI87304.1| stage II sporulation protein Q [Bacillus subtilis subsp. natto
           BEST195]
 gi|320019476|gb|ADV94462.1| forespore protein required for alternative engulfment [Bacillus
           subtilis BSn5]
          Length = 290

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 43/75 (57%), Gaps = 10/75 (13%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGK------SGNAQHPQVHFE 65
           LG  + + H D + TVY  +    V++G KV +   IG SGK      SGN     VHFE
Sbjct: 151 LGYVVEVEHADGLSTVYQSLSEVSVEQGDKVKQNQVIGKSGKNLYSEDSGN----HVHFE 206

Query: 66  LRKNAIAMDPIKFLE 80
           +RK+ +AM+P+ F++
Sbjct: 207 IRKDGVAMNPLNFMD 221


>gi|194335776|ref|YP_002017570.1| Peptidase M23 [Pelodictyon phaeoclathratiforme BU-1]
 gi|194308253|gb|ACF42953.1| Peptidase M23 [Pelodictyon phaeoclathratiforme BU-1]
          Length = 274

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           ++ Y G D    G  I I H     T+Y+H+    V++GQ+V RG  I LSG +G +  P
Sbjct: 173 VIAYSGYDR-GYGQKITINHGFGYQTIYAHLSKSLVRQGQRVKRGEIIALSGNTGLSTGP 231

Query: 61  QVHFELRKNAIAMDPIK-FLEEKIP 84
            +H+E++K+ + ++P   F +E  P
Sbjct: 232 HLHYEVQKDNVKVNPTAYFFDESNP 256


>gi|99081634|ref|YP_613788.1| peptidase M23B [Ruegeria sp. TM1040]
 gi|99037914|gb|ABF64526.1| LysM domain/M23/M37 peptidase [Ruegeria sp. TM1040]
          Length = 426

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 45/65 (69%), Gaps = 2/65 (3%)

Query: 16  ILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDP 75
           I+IRHD ++++VY+++D   VQKG +V+RG  I  +   G+A+   VHFE+R    ++DP
Sbjct: 364 IVIRHDRNLLSVYANVDGIRVQKGDRVNRGQNI--AKLRGSAEEAYVHFEVRDGFESVDP 421

Query: 76  IKFLE 80
           + +L+
Sbjct: 422 LPYLQ 426


>gi|86134547|ref|ZP_01053129.1| peptidase family M23 [Polaribacter sp. MED152]
 gi|85821410|gb|EAQ42557.1| peptidase family M23 [Polaribacter sp. MED152]
          Length = 320

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (53%)

Query: 3   IYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQV 62
           IY        G  I I H     T+Y+H+    V++G+ + RG  IG  G +G +  P +
Sbjct: 221 IYRAQRSSTFGKVIYIDHGYGYKTIYAHLSKMVVKRGETIKRGDLIGYVGNTGLSVAPHL 280

Query: 63  HFELRKNAIAMDPIKF 78
           H+E+ KN +A++PI F
Sbjct: 281 HYEVHKNDVALNPINF 296


>gi|114567978|ref|YP_755132.1| peptidase M23B [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114338913|gb|ABI69761.1| peptidase M23B [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 446

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I I H++ +VT Y+H  +  V +GQ VSRG  IG  G +G +  P +HFE+      
Sbjct: 379 GKFITINHNNGLVTRYAHCSSIAVSEGQSVSRGEVIGTVGSTGRSSGPHLHFEVLSGGSF 438

Query: 73  MDPIKFL 79
            +P+ +L
Sbjct: 439 QNPLNYL 445


>gi|255690505|ref|ZP_05414180.1| peptidase, M23/M37 family [Bacteroides finegoldii DSM 17565]
 gi|260623957|gb|EEX46828.1| peptidase, M23/M37 family [Bacteroides finegoldii DSM 17565]
          Length = 290

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++IRHD+ + TVY H+    V++ Q V  G  IGL G +G +    +HFE R   IA
Sbjct: 143 GKYVVIRHDNGLETVYGHLSKQLVEENQLVKAGEVIGLGGNTGRSTGSHLHFETRFLGIA 202

Query: 73  MDPIKFLE 80
           ++PI   +
Sbjct: 203 INPIYMFD 210


>gi|307720257|ref|YP_003891397.1| Peptidase M23 [Sulfurimonas autotrophica DSM 16294]
 gi|306978350|gb|ADN08385.1| Peptidase M23 [Sulfurimonas autotrophica DSM 16294]
          Length = 396

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 2/70 (2%)

Query: 13  GNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           GN I IRH+D   T Y+H+ +    + +G+ V +G TI   G +G +  P +HFELRK  
Sbjct: 271 GNLIKIRHNDGYETRYAHLKSFRKGIYRGKHVKKGQTIAYVGTTGRSTGPHLHFELRKRG 330

Query: 71  IAMDPIKFLE 80
            A++P++ ++
Sbjct: 331 RAINPLRVVQ 340


>gi|293368692|ref|ZP_06615298.1| peptidase, M23 family [Bacteroides ovatus SD CMC 3f]
 gi|298480240|ref|ZP_06998438.1| peptidase [Bacteroides sp. D22]
 gi|292636233|gb|EFF54719.1| peptidase, M23 family [Bacteroides ovatus SD CMC 3f]
 gi|295086532|emb|CBK68055.1| Membrane proteins related to metalloendopeptidases [Bacteroides
           xylanisolvens XB1A]
 gi|298273521|gb|EFI15084.1| peptidase [Bacteroides sp. D22]
          Length = 289

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++IRHD+ + TVY H+    V++ Q V  G  IGL G +G +    +HFE R   IA
Sbjct: 142 GKYVVIRHDNGLETVYGHLSKQLVEENQLVKAGEVIGLGGNTGRSTGSHLHFETRFLGIA 201

Query: 73  MDPIKFLE 80
           ++PI   +
Sbjct: 202 INPIYMFD 209


>gi|282862748|ref|ZP_06271809.1| Peptidase M23 [Streptomyces sp. ACTE]
 gi|282562434|gb|EFB67975.1| Peptidase M23 [Streptomyces sp. ACTE]
          Length = 427

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN--- 69
           G  I+IRH D   + Y+H+ + +V+ GQ+V  G  I  SG +GN+  P +HFE+R     
Sbjct: 351 GYEIVIRHADGKYSQYAHLSSLHVRAGQQVGSGQRIARSGTTGNSTGPHLHFEIRTGPGY 410

Query: 70  AIAMDPIKFL 79
              +DP+ +L
Sbjct: 411 GSDVDPLAYL 420


>gi|225181886|ref|ZP_03735321.1| Peptidase M23 [Dethiobacter alkaliphilus AHT 1]
 gi|225167400|gb|EEG76216.1| Peptidase M23 [Dethiobacter alkaliphilus AHT 1]
          Length = 291

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I H  +  T Y+H+ +  VQ G +V +G  IG  G +G +  P +HFE+ KN   
Sbjct: 219 GNLVIIDHG-TYSTHYAHLRSFEVQAGDRVEKGQIIGQVGNTGYSTGPHLHFEIHKNGSP 277

Query: 73  MDPIKFLEEKIP 84
           +DP+K +E + P
Sbjct: 278 IDPLKMIETEAP 289


>gi|157374436|ref|YP_001473036.1| peptidase M23B [Shewanella sediminis HAW-EB3]
 gi|157316810|gb|ABV35908.1| peptidase M23B [Shewanella sediminis HAW-EB3]
          Length = 304

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q V+ G T+   G +G      
Sbjct: 225 VVYAGSALRGYGNLVIIKHSDDYLSAYAHADKILVKEKQFVAVGQTLAKMGSTG-TDRVM 283

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+K+L ++
Sbjct: 284 LHFEIRYHGKSVNPLKYLPKQ 304


>gi|295132656|ref|YP_003583332.1| M23 family peptidase [Zunongwangia profunda SM-A87]
 gi|294980671|gb|ADF51136.1| M23 family peptidase [Zunongwangia profunda SM-A87]
          Length = 325

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 41/66 (62%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN I I H    V++Y+H+    V+KGQKV RG  IG  G +G ++ P +H+E+ K+   
Sbjct: 235 GNHIRIDHGYGYVSLYAHLYKYNVRKGQKVKRGDIIGFVGSTGRSEAPHLHYEIFKDDEH 294

Query: 73  MDPIKF 78
           ++PI F
Sbjct: 295 INPINF 300


>gi|15595106|ref|NP_212895.1| hypothetical protein BB0761 [Borrelia burgdorferi B31]
 gi|2688708|gb|AAC67117.1| conserved hypothetical protein [Borrelia burgdorferi B31]
          Length = 295

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 46/74 (62%), Gaps = 2/74 (2%)

Query: 7   NDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFEL 66
           NDL   GN +++ H ++I ++Y H++   V+ G  V  G  +G  G++G A  P +HFE+
Sbjct: 224 NDLY--GNFVVVGHKNNIKSLYGHLNLYSVKIGDFVKSGEFLGXVGQTGRATGPHLHFEI 281

Query: 67  RKNAIAMDPIKFLE 80
            K  I ++P+KFL+
Sbjct: 282 LKKNIPINPLKFLK 295


>gi|297204034|ref|ZP_06921431.1| secreted protein [Streptomyces sviceus ATCC 29083]
 gi|197714954|gb|EDY58988.1| secreted protein [Streptomyces sviceus ATCC 29083]
          Length = 377

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 38/71 (53%), Gaps = 3/71 (4%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN-- 69
            G  ++IRH D   T Y H+    V+ GQ V  G  IG SG +GN+  P +HFE+R    
Sbjct: 300 FGYQVVIRHSDGRYTQYGHLSAISVKAGQSVGGGQRIGRSGSTGNSSGPHLHFEVRTGPG 359

Query: 70  -AIAMDPIKFL 79
               +DP+ +L
Sbjct: 360 FGSDIDPLAYL 370


>gi|182437914|ref|YP_001825633.1| M23 family secreted peptidase [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326778550|ref|ZP_08237815.1| Peptidase M23 [Streptomyces cf. griseus XylebKG-1]
 gi|178466430|dbj|BAG20950.1| putative M23-family secreted peptidase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326658883|gb|EGE43729.1| Peptidase M23 [Streptomyces cf. griseus XylebKG-1]
          Length = 238

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 8   DLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR 67
           D    GN ++I+H +   + Y+H+    V+ GQ V  G  I LSG +GN+  P +HFE+R
Sbjct: 157 DGPAYGNAVVIKHSNGKYSQYAHLSKVNVKIGQTVKTGEKIALSGNTGNSSGPHLHFEIR 216

Query: 68  KN---AIAMDPIKFLEE 81
                  A++P  FL  
Sbjct: 217 TTPNYGSALNPAAFLRS 233


>gi|87124503|ref|ZP_01080352.1| putative peptidase [Synechococcus sp. RS9917]
 gi|86168075|gb|EAQ69333.1| putative peptidase [Synechococcus sp. RS9917]
          Length = 334

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRK-NAI 71
           G  + + H D   T Y+H     V+KGQ V +G TI L G +G +  P +HFE+RK    
Sbjct: 262 GYLVELAHGDGTATRYAHNSRLVVRKGQMVPQGTTISLMGSTGRSTGPHLHFEIRKPGGA 321

Query: 72  AMDPIKFLEEK 82
           A DP+ FL  +
Sbjct: 322 ATDPMPFLPSR 332


>gi|325121500|gb|ADY81023.1| peptidase M23B [Acinetobacter calcoaceticus PHEA-2]
          Length = 269

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T+LI H   +V+++ H+    V+KGQ + +G T+GL GK+G    P +H+ +  N   
Sbjct: 199 GQTVLIDHGQGLVSMFCHLSAIKVEKGQHIRQGETLGLVGKTGRVTGPHLHWGMSLNNAR 258

Query: 73  MDPIKFL 79
           +DP  FL
Sbjct: 259 VDPQLFL 265


>gi|291529988|emb|CBK95573.1| Membrane proteins related to metalloendopeptidases [Eubacterium
           siraeum 70/3]
          Length = 628

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G D   LGN ++I H D   TVY+H    +V  GQ+V++G  I   G++G A    
Sbjct: 542 VIFAGWDNGGLGNAVMILHPDGYTTVYAHNSEIFVSAGQEVNQGDCIAAVGETGLAYGCH 601

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R  +  ++P  +L
Sbjct: 602 CHFEVRYGSERLNPRYYL 619


>gi|229587072|ref|YP_002845573.1| Periplasmic protein [Rickettsia africae ESF-5]
 gi|228022122|gb|ACP53830.1| Periplasmic protein [Rickettsia africae ESF-5]
          Length = 284

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           + GN + I+H    VT Y+H+    V++G K+ RG  IG+ G +GNA    +HFE+  + 
Sbjct: 210 DYGNFVEIKHGRKFVTKYAHLKEMSVKEGNKIKRGQFIGIQGSTGNATGEHLHFEILLDN 269

Query: 71  IAMDPIKFL 79
            A++P  F+
Sbjct: 270 KAINPFDFI 278


>gi|218778806|ref|YP_002430124.1| peptidase M23 [Desulfatibacillum alkenivorans AK-01]
 gi|218760190|gb|ACL02656.1| Peptidase M23 [Desulfatibacillum alkenivorans AK-01]
          Length = 317

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (58%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            GN I+I H   I T Y+H+    ++KG KV RG  +G  G +G +  P +H+E+  N +
Sbjct: 248 FGNVIVIDHGHGISTRYAHLSKFKIKKGDKVQRGEIVGEVGNTGRSTGPHLHYEVHLNGV 307

Query: 72  AMDPIKFL 79
            M+P +++
Sbjct: 308 PMNPQRYI 315


>gi|33520758|gb|AAQ21217.1| NlpD [Borrelia burgdorferi 297]
          Length = 295

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 46/74 (62%), Gaps = 2/74 (2%)

Query: 7   NDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFEL 66
           NDL   GN +++ H ++I ++Y H++   V+ G  V  G  +G  G++G A  P +HFE+
Sbjct: 224 NDLY--GNFVVVGHKNNIKSLYGHLNLYSVKIGDFVKSGEFLGXVGQTGRATGPHLHFEI 281

Query: 67  RKNAIAMDPIKFLE 80
            K  I ++P+KFL+
Sbjct: 282 LKKNIPINPLKFLK 295


>gi|323494326|ref|ZP_08099438.1| hypothetical protein VIBR0546_07212 [Vibrio brasiliensis LMG 20546]
 gi|323311489|gb|EGA64641.1| hypothetical protein VIBR0546_07212 [Vibrio brasiliensis LMG 20546]
          Length = 416

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++I+H     T Y H+    V+KGQKVSRG  IGLSG +G    P +H+EL      
Sbjct: 307 GNYVVIQHGSRYKTRYLHLSKILVRKGQKVSRGQRIGLSGATGRVTGPHIHYELIDRG-- 364

Query: 73  MDPIKFLEEKIP 84
             P+  ++  IP
Sbjct: 365 -RPVNAMKANIP 375


>gi|219685571|ref|ZP_03540387.1| hypothetical protein BGAFAR04_0816 [Borrelia garinii Far04]
 gi|219672849|gb|EED29872.1| hypothetical protein BGAFAR04_0816 [Borrelia garinii Far04]
          Length = 295

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 52/81 (64%), Gaps = 3/81 (3%)

Query: 1   MVIYVG-NDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQH 59
           +VI VG NDL   GN +++ H ++I ++Y H+++  V+ G  +  G  +G+ G++G +  
Sbjct: 217 IVIEVGYNDLY--GNFVVVGHKNNIKSLYGHLNSYSVKIGDPIKSGELLGMVGQTGRSTG 274

Query: 60  PQVHFELRKNAIAMDPIKFLE 80
           P +HFE+ K  I ++P+K L+
Sbjct: 275 PHLHFEILKKNIPINPLKLLK 295


>gi|87198087|ref|YP_495344.1| peptidase M23B [Novosphingobium aromaticivorans DSM 12444]
 gi|87133768|gb|ABD24510.1| peptidase M23B [Novosphingobium aromaticivorans DSM 12444]
          Length = 387

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 39/68 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + + H + ++T Y+H+     + GQKV  G  IG  G +G +  P +HFE+R N   
Sbjct: 302 GNVVEVSHGNGLLTRYAHMSRTQARVGQKVDAGAEIGKIGNTGRSTGPHLHFEVRINDRP 361

Query: 73  MDPIKFLE 80
           ++P  FLE
Sbjct: 362 VNPRPFLE 369


>gi|120599370|ref|YP_963944.1| peptidase M23B [Shewanella sp. W3-18-1]
 gi|146292633|ref|YP_001183057.1| peptidase M23B [Shewanella putrefaciens CN-32]
 gi|120559463|gb|ABM25390.1| peptidase M23B [Shewanella sp. W3-18-1]
 gi|145564323|gb|ABP75258.1| peptidase M23B [Shewanella putrefaciens CN-32]
 gi|319425937|gb|ADV54011.1| Peptidase M23 [Shewanella putrefaciens 200]
          Length = 431

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 7/83 (8%)

Query: 2   VIYVGNDLVEL-------GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKS 54
           VI  G+ +V L       G  I+I H     T Y H+    V+KGQ+V+RG  I LSG +
Sbjct: 318 VIAPGDGVVSLVTDHQFAGKYIVIEHGGKYRTRYLHLSKSLVRKGQRVTRGQVIALSGNT 377

Query: 55  GNAQHPQVHFELRKNAIAMDPIK 77
           G +  P +H+E   N   +DP+K
Sbjct: 378 GRSTGPHLHYEFHINGKPVDPMK 400


>gi|326335985|ref|ZP_08202162.1| peptidase [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325691949|gb|EGD33911.1| peptidase [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 324

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I I H     T+Y+H+    V+ GQKV RG  IG  G +G ++ P +H+E++KN   
Sbjct: 234 GEHIRIDHGYGYETIYAHLSQYNVRPGQKVKRGDVIGYVGSTGRSEAPHLHYEVKKNGEH 293

Query: 73  MDPIKF 78
           ++PI F
Sbjct: 294 LNPINF 299


>gi|51599012|ref|YP_073200.1| hypothetical protein BG0785 [Borrelia garinii PBi]
 gi|51573583|gb|AAU07608.1| conserved hypothetical protein [Borrelia garinii PBi]
          Length = 294

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 52/81 (64%), Gaps = 3/81 (3%)

Query: 1   MVIYVG-NDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQH 59
           +VI VG NDL   GN +++ H ++I ++Y H+++  V+ G  +  G  +G+ G++G +  
Sbjct: 216 IVIEVGYNDLY--GNFVVVGHKNNIKSLYGHLNSYSVKIGDPIKSGELLGMVGQTGRSTG 273

Query: 60  PQVHFELRKNAIAMDPIKFLE 80
           P +HFE+ K  I ++P+K L+
Sbjct: 274 PHLHFEILKKNIPINPLKLLK 294


>gi|323703289|ref|ZP_08114940.1| Peptidase M23 [Desulfotomaculum nigrificans DSM 574]
 gi|323531754|gb|EGB21642.1| Peptidase M23 [Desulfotomaculum nigrificans DSM 574]
          Length = 449

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H + +VT Y+H+ +  V  GQ VS+G  IG  G +G +  P +HFE+  N + 
Sbjct: 383 GNCVDISHGNGVVTRYAHMSSIGVMVGQTVSKGQVIGRIGSTGRSTGPHLHFEVIVNGVP 442

Query: 73  MDPIKFL 79
            +P+ +L
Sbjct: 443 RNPLAYL 449


>gi|253996110|ref|YP_003048174.1| peptidase M23 [Methylotenera mobilis JLW8]
 gi|253982789|gb|ACT47647.1| Peptidase M23 [Methylotenera mobilis JLW8]
          Length = 352

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 50/78 (64%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G+DL   G  ++++H  + ++VY++     V++GQ+V+ G  I   G + ++   +
Sbjct: 273 VIYSGSDLRGYGKLVIVKHSATYLSVYANNSLILVKEGQQVTSGQKIAEMGDT-DSNTVK 331

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+   ++DP+KFL
Sbjct: 332 LHFEIRQQGKSVDPMKFL 349


>gi|326391191|ref|ZP_08212735.1| Peptidase M23 [Thermoanaerobacter ethanolicus JW 200]
 gi|325992760|gb|EGD51208.1| Peptidase M23 [Thermoanaerobacter ethanolicus JW 200]
          Length = 451

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + I H +  VT Y H      +KG KV++G  I L G +G A    +HFE+RKN + 
Sbjct: 383 GYLVKIDHHNGYVTYYGHASKLLAKKGDKVAKGQKIALVGSTGRATGSHLHFEVRKNGVP 442

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 443 VNPLSYL 449


>gi|319790541|ref|YP_004152174.1| Peptidase M23 [Thermovibrio ammonificans HB-1]
 gi|317115043|gb|ADU97533.1| Peptidase M23 [Thermovibrio ammonificans HB-1]
          Length = 272

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 42/71 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GNT++I H   I T+Y+H+    V++GQ V RG  +G  G +G +  P +HF    + + 
Sbjct: 202 GNTVVIDHGLGIHTLYAHLSRITVKEGQFVKRGQVVGRVGSTGRSTGPHLHFGFYVDDVK 261

Query: 73  MDPIKFLEEKI 83
            DP+  L+E++
Sbjct: 262 ADPMLVLKEQL 272


>gi|51598522|ref|YP_072710.1| hypothetical protein BG0265 [Borrelia garinii PBi]
 gi|51573093|gb|AAU07118.1| conserved hypothetical protein [Borrelia garinii PBi]
          Length = 417

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+ VG +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 IVVTVGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|301628965|ref|XP_002943617.1| PREDICTED: uncharacterized metalloprotease yebA-like [Xenopus
           (Silurana) tropicalis]
          Length = 457

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + ++H +   TVY+H+    V KGQ V++G  +G  G +G A  P +HFE R     
Sbjct: 351 GNVVFVKHGNGHETVYAHLSRMDVHKGQSVAQGDILGAVGATGWATGPHLHFEFRVKGQQ 410

Query: 73  MDPI 76
            DP+
Sbjct: 411 QDPM 414


>gi|299770935|ref|YP_003732961.1| metalloendopeptidase-like membrane protein [Acinetobacter sp. DR1]
 gi|298701023|gb|ADI91588.1| metalloendopeptidase-like membrane protein [Acinetobacter sp. DR1]
          Length = 269

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (59%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G T+LI H   +V+++ H+    V+KGQ + +G T+GL GK+G    P +H+ +  N   
Sbjct: 199 GQTVLIDHGQGLVSMFCHLSAIKVEKGQHIRQGETLGLVGKTGRVTGPHLHWGMSLNNAR 258

Query: 73  MDPIKFL 79
           +DP  FL
Sbjct: 259 VDPQLFL 265


>gi|282858676|ref|ZP_06267832.1| peptidase, M23 family [Prevotella bivia JCVIHMP010]
 gi|282588529|gb|EFB93678.1| peptidase, M23 family [Prevotella bivia JCVIHMP010]
          Length = 339

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 39/68 (57%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  I+IRH++ + T+Y H+    V++ Q V  G  IGL G +G +    +HFE R   +A
Sbjct: 142 GKYIVIRHNNGLETIYGHLSRQLVRENQYVQAGQPIGLGGNTGRSTGSHLHFETRLCGVA 201

Query: 73  MDPIKFLE 80
           ++P  F +
Sbjct: 202 LNPALFFD 209


>gi|15893016|ref|NP_360730.1| putative periplasmic protein [Rickettsia conorii str. Malish 7]
 gi|34581291|ref|ZP_00142771.1| putative periplasmic protein [Rickettsia sibirica 246]
 gi|15620216|gb|AAL03631.1| putative periplasmic protein [Rickettsia conorii str. Malish 7]
 gi|28262676|gb|EAA26180.1| putative periplasmic protein [Rickettsia sibirica 246]
          Length = 284

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           + GN + I+H    VT Y+H+    V++G K+ RG  IG+ G +GNA    +HFE+  + 
Sbjct: 210 DYGNFVEIKHGRKFVTKYAHLKEMSVKEGNKIKRGQFIGIQGSTGNATGEHLHFEILLDN 269

Query: 71  IAMDPIKFL 79
            A++P  F+
Sbjct: 270 KAINPFDFI 278


>gi|83592995|ref|YP_426747.1| peptidase M23B [Rhodospirillum rubrum ATCC 11170]
 gi|83575909|gb|ABC22460.1| Peptidase M23B [Rhodospirillum rubrum ATCC 11170]
          Length = 348

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 37/69 (53%), Gaps = 2/69 (2%)

Query: 11  ELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRK 68
           E GN +++ H D   T Y H+   +  V+ GQK+  G  +G  G SGN +HP +H  +R+
Sbjct: 134 ECGNGVVLDHGDGWTTQYCHLRKGSIAVKAGQKIPVGQRLGAVGLSGNTEHPHLHMTVRR 193

Query: 69  NAIAMDPIK 77
                DP K
Sbjct: 194 GTTVFDPFK 202


>gi|84502648|ref|ZP_01000767.1| LysM domain/M23/M37 peptidase [Oceanicola batsensis HTCC2597]
 gi|84389043|gb|EAQ01841.1| LysM domain/M23/M37 peptidase [Oceanicola batsensis HTCC2597]
          Length = 412

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 3/65 (4%)

Query: 16  ILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDP 75
           I++RH   ++T+YS++D   VQ+GQ V+RG  I    +SG  + P VHFE+RK   A DP
Sbjct: 351 IVVRHAGKLLTIYSNVDGIAVQEGQTVARGQKIA-EIRSG--ESPYVHFEVRKGLEATDP 407

Query: 76  IKFLE 80
           + +L+
Sbjct: 408 MDYLQ 412


>gi|238650376|ref|YP_002916228.1| putative periplasmic protein [Rickettsia peacockii str. Rustic]
 gi|238624474|gb|ACR47180.1| putative periplasmic protein [Rickettsia peacockii str. Rustic]
          Length = 284

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           + GN + I+H    VT Y+H+    V++G K+ RG  IG+ G +GNA    +HFE+  + 
Sbjct: 210 DYGNFVEIKHGRKFVTKYAHLKEMSVKEGNKIKRGQFIGIQGSTGNATGEHLHFEILLDN 269

Query: 71  IAMDPIKFL 79
            A++P  F+
Sbjct: 270 KAINPFDFI 278


>gi|149366009|ref|ZP_01888044.1| putative M23/M37 peptidase-family protein [Yersinia pestis
           CA88-4125]
 gi|115347780|emb|CAL20697.1| putative M23/M37 peptidase-family protein [Yersinia pestis CO92]
 gi|149292422|gb|EDM42496.1| putative M23/M37 peptidase-family protein [Yersinia pestis
           CA88-4125]
          Length = 417

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +H+E   N  A
Sbjct: 322 GNYVVIRHGRQYTTHYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEFWMNQQA 381

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 382 VNP---LTAKLP 390


>gi|332528452|ref|ZP_08404444.1| peptidase M23B [Hylemonella gracilis ATCC 19624]
 gi|332042131|gb|EGI78465.1| peptidase M23B [Hylemonella gracilis ATCC 19624]
          Length = 370

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 38/69 (55%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           + GN + I H   ++T Y+H     V+KG  V RG  + LSG +G +  P +HFE+    
Sbjct: 232 DYGNLVEIDHGKDMITRYAHNSKLLVKKGDLVKRGQHVALSGNTGRSTGPHMHFEVLVRG 291

Query: 71  IAMDPIKFL 79
           +  DP KF+
Sbjct: 292 VPQDPNKFM 300


>gi|296282107|ref|ZP_06860105.1| membrane protein [Citromicrobium bathyomarinum JL354]
          Length = 234

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 42/76 (55%)

Query: 6   GNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFE 65
            N     GN I I H ++I T Y+H+    V  GQ+V +G  IG  G +G +  P +H+E
Sbjct: 136 ANWFSSYGNYIQIGHGNAIETRYAHLSRIIVADGQQVRKGDLIGYVGSTGRSTGPHLHYE 195

Query: 66  LRKNAIAMDPIKFLEE 81
           +R +  A+DP  F+ E
Sbjct: 196 VRIDGRAVDPRPFMVE 211


>gi|224534310|ref|ZP_03674888.1| M23 peptidase domain protein [Borrelia spielmanii A14S]
 gi|224514412|gb|EEF84728.1| M23 peptidase domain protein [Borrelia spielmanii A14S]
          Length = 417

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+ VG +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 IVVTVGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|45657033|ref|YP_001119.1| membrane metalloendopeptidase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|45600270|gb|AAS69756.1| membrane metalloendopeptidase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 271

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 13  GNTILIRHD--DSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           GN IL+ H   + I T+Y+H    YV++G KV +G  I LSG +G+   P +HFE+R   
Sbjct: 183 GNKILLSHPGINGINTLYAHNSVLYVKEGDKVKKGQIIALSGNTGHTTGPHLHFEVRYQN 242

Query: 71  IAMDPIKFL 79
           + ++P  +L
Sbjct: 243 VVLNPEHYL 251


>gi|51894461|ref|YP_077152.1| putative peptidase [Symbiobacterium thermophilum IAM 14863]
 gi|51858150|dbj|BAD42308.1| putative peptidase [Symbiobacterium thermophilum IAM 14863]
          Length = 349

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 41/70 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  ++I H     T+Y+H+    V +GQ+V RG  IG  G SG +  P +H+E+  N +A
Sbjct: 277 GRCVIIDHGYGYRTLYAHLQDWNVFEGQEVERGDLIGWVGSSGLSTGPHLHYEVLVNGVA 336

Query: 73  MDPIKFLEEK 82
           +DP  +LE +
Sbjct: 337 VDPEPYLESR 346


>gi|124006218|ref|ZP_01691053.1| peptidase, M23/M37 family [Microscilla marina ATCC 23134]
 gi|123988142|gb|EAY27800.1| peptidase, M23/M37 family [Microscilla marina ATCC 23134]
          Length = 352

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 39/65 (60%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            GN +++RH + + T+Y H+    V+ GQ V  G  IGL G +G +  P +HFE+R    
Sbjct: 208 FGNYVVVRHYNGLETLYGHMSIRKVEVGQVVKAGQLIGLGGSTGWSTGPHLHFEVRYQGN 267

Query: 72  AMDPI 76
           ++DP+
Sbjct: 268 SIDPL 272


>gi|123442629|ref|YP_001006606.1| hypothetical protein YE2387 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089590|emb|CAL12439.1| putative M23/M37 peptidase-family protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 417

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +H+E   N  A
Sbjct: 322 GNYVAIRHGRQYTTRYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEFWMNQQA 381

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 382 VNP---LTAKLP 390


>gi|74316855|ref|YP_314595.1| peptidoglycan-binding protein LysM [Thiobacillus denitrificans ATCC
           25259]
 gi|74056350|gb|AAZ96790.1| peptidoglycan-binding protein LysM [Thiobacillus denitrificans ATCC
           25259]
          Length = 309

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++++H    ++ Y+H +T  V++G  V+ G  I L G S +A   +
Sbjct: 229 VVYSGSGLRGYGRLLIVKHAGEYLSAYAHNETILVKEGDAVAAGQKIALMGDS-DADRVK 287

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ +L E+
Sbjct: 288 LHFEIRRYGKPLDPLNYLPER 308


>gi|22126134|ref|NP_669557.1| hypothetical protein y2248 [Yersinia pestis KIM 10]
 gi|45441707|ref|NP_993246.1| hypothetical protein YP_1905 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51596371|ref|YP_070562.1| hypothetical protein YPTB2045 [Yersinia pseudotuberculosis IP
           32953]
 gi|108807441|ref|YP_651357.1| hypothetical protein YPA_1445 [Yersinia pestis Antiqua]
 gi|108811702|ref|YP_647469.1| hypothetical protein YPN_1539 [Yersinia pestis Nepal516]
 gi|145598355|ref|YP_001162431.1| hypothetical protein YPDSF_1060 [Yersinia pestis Pestoides F]
 gi|153949611|ref|YP_001400999.1| hypothetical protein YpsIP31758_2026 [Yersinia pseudotuberculosis
           IP 31758]
 gi|170024373|ref|YP_001720878.1| hypothetical protein YPK_2139 [Yersinia pseudotuberculosis YPIII]
 gi|186895412|ref|YP_001872524.1| hypothetical protein YPTS_2104 [Yersinia pseudotuberculosis PB1/+]
 gi|218929169|ref|YP_002347044.1| hypothetical protein YPO2062 [Yersinia pestis CO92]
 gi|229894776|ref|ZP_04509956.1| predicted peptidase [Yersinia pestis Pestoides A]
 gi|229897479|ref|ZP_04512635.1| predicted peptidase [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229898125|ref|ZP_04513274.1| predicted peptidase [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229901985|ref|ZP_04517106.1| predicted peptidase [Yersinia pestis Nepal516]
 gi|21959094|gb|AAM85808.1|AE013827_9 hypothetical protein y2248 [Yersinia pestis KIM 10]
 gi|45436569|gb|AAS62123.1| putative M23/M37 peptidase-family protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51589653|emb|CAH21283.1| putative M23/M37 peptidase-family protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|108775350|gb|ABG17869.1| M23/M37 peptidase-family protein [Yersinia pestis Nepal516]
 gi|108779354|gb|ABG13412.1| putative M23/M37 peptidase-family protein [Yersinia pestis Antiqua]
 gi|145210051|gb|ABP39458.1| M23/M37 peptidase-family protein [Yersinia pestis Pestoides F]
 gi|152961106|gb|ABS48567.1| peptidase, M23 family [Yersinia pseudotuberculosis IP 31758]
 gi|169750907|gb|ACA68425.1| peptidase M23B [Yersinia pseudotuberculosis YPIII]
 gi|186698438|gb|ACC89067.1| Peptidase M23 [Yersinia pseudotuberculosis PB1/+]
 gi|229680881|gb|EEO76976.1| predicted peptidase [Yersinia pestis Nepal516]
 gi|229688841|gb|EEO80908.1| predicted peptidase [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229693816|gb|EEO83865.1| predicted peptidase [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229702249|gb|EEO90268.1| predicted peptidase [Yersinia pestis Pestoides A]
 gi|320015260|gb|ADV98831.1| putative peptidase [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 438

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN ++IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +H+E   N  A
Sbjct: 343 GNYVVIRHGRQYTTHYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEFWMNQQA 402

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 403 VNP---LTAKLP 411


>gi|318605506|emb|CBY27004.1| cell wall endopeptidase, family M23/M37 [Yersinia enterocolitica
           subsp. palearctica Y11]
          Length = 410

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +H+E   N  A
Sbjct: 315 GNYVAIRHGRQYTTRYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEFWMNQQA 374

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 375 VNP---LTAKLP 383


>gi|302669930|ref|YP_003829890.1| metallopeptidase M23 family protein [Butyrivibrio proteoclasticus
           B316]
 gi|302394403|gb|ADL33308.1| metallopeptidase M23 family [Butyrivibrio proteoclasticus B316]
          Length = 529

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + IRH D   T Y H+    V  GQKVS+G  I LSG +G +  P +HFE+  N   
Sbjct: 462 GYCVYIRHADGRETRYGHLSKVLVSVGQKVSQGQKIALSGNTGVSTGPHLHFEILINGSQ 521

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 522 VNPLNYL 528


>gi|238756976|ref|ZP_04618164.1| Uncharacterized metalloprotease yebA [Yersinia aldovae ATCC 35236]
 gi|238704806|gb|EEP97335.1| Uncharacterized metalloprotease yebA [Yersinia aldovae ATCC 35236]
          Length = 417

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +H+E   N  A
Sbjct: 322 GNYVAIRHGRQYTTRYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEFWMNQQA 381

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 382 VNP---LTAKLP 390


>gi|238762964|ref|ZP_04623931.1| Uncharacterized metalloprotease yebA [Yersinia kristensenii ATCC
           33638]
 gi|238698722|gb|EEP91472.1| Uncharacterized metalloprotease yebA [Yersinia kristensenii ATCC
           33638]
          Length = 410

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +H+E   N  A
Sbjct: 315 GNYVAIRHGRQYTTRYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEFWMNQQA 374

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 375 VNP---LTAKLP 383


>gi|238788514|ref|ZP_04632307.1| Uncharacterized metalloprotease yebA [Yersinia frederiksenii ATCC
           33641]
 gi|238723427|gb|EEQ15074.1| Uncharacterized metalloprotease yebA [Yersinia frederiksenii ATCC
           33641]
          Length = 417

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +H+E   N  A
Sbjct: 322 GNYVAIRHGRQYTTRYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEFWMNQQA 381

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 382 VNP---LTAKLP 390


>gi|294828207|ref|NP_713082.2| M23 family metalloendopeptidase [Leptospira interrogans serovar Lai
           str. 56601]
 gi|293386057|gb|AAN50100.2| M23 family metalloendopeptidase [Leptospira interrogans serovar Lai
           str. 56601]
          Length = 262

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 13  GNTILIRHD--DSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           GN IL+ H   + I T+Y+H    YV++G KV +G  I LSG +G+   P +HFE+R   
Sbjct: 174 GNKILLSHPGINGINTLYAHNSVLYVKEGDKVKKGQIIALSGNTGHTTGPHLHFEVRYQN 233

Query: 71  IAMDPIKFL 79
           + ++P  +L
Sbjct: 234 VVLNPEHYL 242


>gi|238796301|ref|ZP_04639810.1| Uncharacterized metalloprotease yebA [Yersinia mollaretii ATCC
           43969]
 gi|238719746|gb|EEQ11553.1| Uncharacterized metalloprotease yebA [Yersinia mollaretii ATCC
           43969]
          Length = 417

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +H+E   N  A
Sbjct: 322 GNYVAIRHGRQYTTRYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEFWMNQQA 381

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 382 VNP---LTAKLP 390


>gi|225175302|ref|ZP_03729297.1| Peptidase M23 [Dethiobacter alkaliphilus AHT 1]
 gi|225169054|gb|EEG77853.1| Peptidase M23 [Dethiobacter alkaliphilus AHT 1]
          Length = 401

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 41/68 (60%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN +++ H   + T Y+H+   +V  G+ V RG  +G+ G +G +  P +HFE+R N   
Sbjct: 334 GNLVIVDHGGGVATAYAHLARFHVSNGETVGRGQPLGVIGSTGASTGPHLHFEVRINGER 393

Query: 73  MDPIKFLE 80
           ++P+ +++
Sbjct: 394 VNPLPYIQ 401


>gi|238782516|ref|ZP_04626547.1| Uncharacterized metalloprotease yebA [Yersinia bercovieri ATCC
           43970]
 gi|238716443|gb|EEQ08424.1| Uncharacterized metalloprotease yebA [Yersinia bercovieri ATCC
           43970]
          Length = 410

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +H+E   N  A
Sbjct: 315 GNYVAIRHGRQYTTRYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEFWMNQQA 374

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 375 VNP---LTAKLP 383


>gi|310815671|ref|YP_003963635.1| LysM domain protein [Ketogulonicigenium vulgare Y25]
 gi|308754406|gb|ADO42335.1| LysM domain protein [Ketogulonicigenium vulgare Y25]
          Length = 391

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 40/64 (62%), Gaps = 3/64 (4%)

Query: 16  ILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDP 75
           ++IRHD +++TVY+H+D   V +G  VSRG  I   GK  +   P +HFE+R+   ++DP
Sbjct: 330 VVIRHDGNLMTVYTHLDRLTVARGASVSRGQVI---GKVADGATPYLHFEVRRGLDSVDP 386

Query: 76  IKFL 79
              L
Sbjct: 387 STML 390


>gi|157804101|ref|YP_001492650.1| periplasmic protein [Rickettsia canadensis str. McKiel]
 gi|157785364|gb|ABV73865.1| Periplasmic protein [Rickettsia canadensis str. McKiel]
          Length = 284

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 42/69 (60%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
           + GN + I+H    +T Y+H+    +++G K+ RG  IG+ G++GNA    +HFE+  + 
Sbjct: 210 DYGNFVEIKHGHKFITKYAHLKEIQIKEGNKIKRGQLIGIQGRTGNATGEHLHFEILLDN 269

Query: 71  IAMDPIKFL 79
            A++P  F+
Sbjct: 270 KAINPFDFI 278


>gi|238751596|ref|ZP_04613086.1| Uncharacterized metalloprotease yebA [Yersinia rohdei ATCC 43380]
 gi|238710158|gb|EEQ02386.1| Uncharacterized metalloprotease yebA [Yersinia rohdei ATCC 43380]
          Length = 438

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +H+E   N  A
Sbjct: 343 GNYVAIRHGRQYTTRYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEFWMNQQA 402

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 403 VNP---LTAKLP 411


>gi|170769414|ref|ZP_02903867.1| metalloprotease, opacity-associated protein A family [Escherichia
           albertii TW07627]
 gi|170121738|gb|EDS90669.1| metalloprotease, opacity-associated protein A family [Escherichia
           albertii TW07627]
          Length = 440

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  + IRH  S  T Y H+    V++GQKV RG  I LSG +G +  P +H+E+  N  A
Sbjct: 345 GYYVAIRHGRSYTTRYMHLRKILVKQGQKVKRGDRIALSGNTGRSTGPHLHYEVWINQQA 404

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 405 VNP---LTAKLP 413


>gi|238792589|ref|ZP_04636222.1| Uncharacterized metalloprotease yebA [Yersinia intermedia ATCC
           29909]
 gi|238728224|gb|EEQ19745.1| Uncharacterized metalloprotease yebA [Yersinia intermedia ATCC
           29909]
          Length = 417

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +H+E   N  A
Sbjct: 322 GNYVAIRHGRQYTTRYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEFWMNQQA 381

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 382 VNP---LTAKLP 390


>gi|111115087|ref|YP_709705.1| hypothetical protein BAPKO_0272 [Borrelia afzelii PKo]
 gi|216263981|ref|ZP_03435975.1| M23 peptidase domain protein [Borrelia afzelii ACA-1]
 gi|110890361|gb|ABH01529.1| conserved hypothetical protein [Borrelia afzelii PKo]
 gi|215980025|gb|EEC20847.1| M23 peptidase domain protein [Borrelia afzelii ACA-1]
          Length = 417

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+ VG +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 IVVTVGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAIIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|92114750|ref|YP_574678.1| peptidase M23B [Chromohalobacter salexigens DSM 3043]
 gi|91797840|gb|ABE59979.1| peptidase M23B [Chromohalobacter salexigens DSM 3043]
          Length = 367

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G+ +   GN I+++H+D  ++ Y+H DT  V++   V  G  I   G++ +A   
Sbjct: 287 IVVYAGSGVRGYGNLIILKHNDHFLSAYAHNDTLRVEENDVVDAGDVIATMGET-DADRV 345

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
           ++HFE+R++    DP+++L  +
Sbjct: 346 KLHFEVRQDGQPQDPMEYLPAR 367


>gi|332161524|ref|YP_004298101.1| hypothetical protein YE105_C1902 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325665754|gb|ADZ42398.1| hypothetical protein YE105_C1902 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330860800|emb|CBX71087.1| uncharacterized metalloprotease yebA [Yersinia enterocolitica
           W22703]
          Length = 410

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + IRH     T Y H+    V+ GQKV RG  I LSG +G +  P +H+E   N  A
Sbjct: 315 GNYVAIRHGRQYTTRYMHLKKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEFWMNQQA 374

Query: 73  MDPIKFLEEKIP 84
           ++P   L  K+P
Sbjct: 375 VNP---LTAKLP 383


>gi|304312493|ref|YP_003812091.1| hypothetical protein HDN1F_28650 [gamma proteobacterium HdN1]
 gi|301798226|emb|CBL46448.1| Hypothetical protein HDN1F_28650 [gamma proteobacterium HdN1]
          Length = 269

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G+ +V  GN I+I+H+D  ++ Y+H     V +G  V  G  I   G +G AQ  
Sbjct: 189 VVAYSGSGIVGYGNLIIIKHNDVYLSAYAHNSRLLVAEGNNVKAGQKIAEIGSTG-AQGN 247

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
           ++HFE+R+    +DP+ +L ++
Sbjct: 248 RLHFEIRRYGRPV