PSIBLAST alignment of GI: 254780683 and protein with PDB id: 2b44

>gi|88192221|pdb|2B44|A Chain A, Truncated S. Aureus Lytm, P 32 2 1 Crystal Form Length = 133
>gi|88192222|pdb|2B44|B Chain B, Truncated S. Aureus Lytm, P 32 2 1 Crystal Form Length = 133
 Score = 60.5 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 5/86 (5%)

Query: 2   VIYVGNDLVELGNTILIRHDD-SIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           V+  G      GN + I+  + +    Y H +   V  G KV  G  I  SG +GN+  P
Sbjct: 48  VVQAGWSNYGGGNQVTIKEANSNNYQWYMHNNRLTVSAGDKVKAGDQIAYSGSTGNSTAP 107

Query: 61  QVHFELRKNAI----AMDPIKFLEEK 82
            VHF+     I    A+DP  +L+ +
Sbjct: 108 HVHFQRMSGGIGNQYAVDPTSYLQSR 133