BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780683|ref|YP_003065096.1| lipoprotein [Candidatus
Liberibacter asiaticus str. psy62]
         (84 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|121535502|ref|ZP_01667311.1| peptidase M23B [Thermosinus carboxydivorans Nor1]
 gi|121305921|gb|EAX46854.1| peptidase M23B [Thermosinus carboxydivorans Nor1]
          Length = 373

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y    +   G T++I H   I T+Y+H     V +GQ+V +G  I   G +G +  P
Sbjct: 295 VVVYADW-MGGYGKTVIIDHGGGISTLYAHNSELLVSEGQRVRKGQPIARVGSTGYSTGP 353

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R+N   ++P+ +L 
Sbjct: 354 HLHFEVRQNGSPVNPLGYLP 373


>gi|220910260|ref|YP_002485571.1| peptidase M23 [Cyanothece sp. PCC 7425]
 gi|219866871|gb|ACL47210.1| Peptidase M23 [Cyanothece sp. PCC 7425]
          Length = 411

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GNT++I H   + T+Y+H    YV++GQ V RG  I   G +G +  P 
Sbjct: 333 VIFAGW-YGGYGNTVIIDHGGGLTTLYAHTSQMYVREGQTVQRGEAIAAVGSTGLSTGPH 391

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P+ +L
Sbjct: 392 LHFEVRENGEPVNPLNYL 409


>gi|289578003|ref|YP_003476630.1| peptidase M23 [Thermoanaerobacter italicus Ab9]
 gi|289527716|gb|ADD02068.1| Peptidase M23 [Thermoanaerobacter italicus Ab9]
          Length = 301

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  L   G  ++I H   I +VY H     V+ GQ V RG  I  SG +G +  P
Sbjct: 220 VVTYAGW-LSGYGKVVIIDHGYGIKSVYGHNSEILVRVGQSVKRGDIIAKSGNTGRSTGP 278

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+R N   ++P+K+L +
Sbjct: 279 HVHFEIRVNGNPVNPMKYLAK 299


>gi|307267155|ref|ZP_07548664.1| Peptidase M23 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306917840|gb|EFN48105.1| Peptidase M23 [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 301

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  L   GN ++I H   I +VY H     V+  Q V RG  I  SG +G +  P
Sbjct: 220 VVTYAGW-LSGYGNVVIIDHGYGIQSVYGHNSQILVKVSQSVKRGDIIAKSGNTGRSTGP 278

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+R N   +DP+K+L +
Sbjct: 279 HVHFEIRVNGNPVDPMKYLAK 299


>gi|326390699|ref|ZP_08212253.1| Peptidase M23 [Thermoanaerobacter ethanolicus JW 200]
 gi|325993236|gb|EGD51674.1| Peptidase M23 [Thermoanaerobacter ethanolicus JW 200]
          Length = 301

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  L   GN ++I H   I +VY H     V+ GQ V RG  I  SG +G +  P
Sbjct: 220 VVTYAGW-LSGYGNVVIIDHGYGIQSVYGHNSQILVKVGQSVKRGDIIAKSGNTGRSTGP 278

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+R N   +DP+K+L +
Sbjct: 279 HVHFEIRVNGNPVDPMKYLAK 299


>gi|289522334|ref|ZP_06439188.1| LysM domain/M23/M37 peptidase domain protein [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289504170|gb|EFD25334.1| LysM domain/M23/M37 peptidase domain protein [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 474

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G  +   G T++I H     T+Y H ++  V++GQ+VS G  I   G +G A  P 
Sbjct: 397 VVHAGW-MGGYGRTVVIDHGRGYRTLYGHCNSISVKRGQRVSAGQVIATVGATGRATGPH 455

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+RKN   ++P+K+L 
Sbjct: 456 LHFEVRKNNSPVNPLKYLR 474


>gi|150390901|ref|YP_001320950.1| peptidase M23B [Alkaliphilus metalliredigens QYMF]
 gi|149950763|gb|ABR49291.1| peptidase M23B [Alkaliphilus metalliredigens QYMF]
          Length = 307

 Score =  110 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G +    GN I+I H     +VY+H     V +G  V +   I   G +G +  P
Sbjct: 229 IVTYSGYN-GGYGNMIIINHGYGYTSVYAHNRENLVSQGDSVEKEELIAKMGSTGRSTGP 287

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N   ++P+  ++
Sbjct: 288 HLHFEIRYNGTPVNPLSIIK 307


>gi|297544273|ref|YP_003676575.1| peptidase M23 [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
 gi|296842048|gb|ADH60564.1| Peptidase M23 [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
          Length = 301

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  L   G  ++I H   I +VY H     V+ GQ V RG  I  SG +G +  P
Sbjct: 220 VVTYAGW-LSGYGKVVIIDHGYGIQSVYGHNSEILVRVGQSVKRGDIIAKSGNTGRSSGP 278

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+R N   ++P+K+L +
Sbjct: 279 HVHFEIRVNGNPVNPMKYLAK 299


>gi|51894461|ref|YP_077152.1| putative peptidase [Symbiobacterium thermophilum IAM 14863]
 gi|51858150|dbj|BAD42308.1| putative peptidase [Symbiobacterium thermophilum IAM 14863]
          Length = 349

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 44/81 (54%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y        G  ++I H     T+Y+H+    V +GQ+V RG  IG  G SG +  P 
Sbjct: 266 VVYADWLEGGYGRCVIIDHGYGYRTLYAHLQDWNVFEGQEVERGDLIGWVGSSGLSTGPH 325

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +H+E+  N +A+DP  +LE +
Sbjct: 326 LHYEVLVNGVAVDPEPYLESR 346


>gi|186684743|ref|YP_001867939.1| peptidase M23B [Nostoc punctiforme PCC 73102]
 gi|186467195|gb|ACC82996.1| peptidase M23B [Nostoc punctiforme PCC 73102]
          Length = 401

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      G  ++I H + + T+Y H    YV +GQ V RG  IG  G +G +  P 
Sbjct: 325 VIFAGW-YGGYGRAVIIDHGNGLTTLYGHTSELYVSEGQAVERGQAIGAVGSTGFSTGPH 383

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   +DP  +L
Sbjct: 384 LHFEVRRNGTPVDPANYL 401


>gi|312876998|ref|ZP_07736972.1| Peptidase M23 [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796229|gb|EFR12584.1| Peptidase M23 [Caldicellulosiruptor lactoaceticus 6A]
          Length = 582

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  I+I H +   T Y H+    V  GQKV++G  I  SG +G +  P
Sbjct: 504 VVEFAGWS-GGYGKLIIINHQNGYQTYYGHLSRFLVNPGQKVAKGQLIAKSGSTGRSTGP 562

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+RKN +  +P+++L 
Sbjct: 563 HLHFEVRKNGVPQNPLRYLR 582


>gi|313896857|ref|ZP_07830404.1| peptidase, M23 family [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312974304|gb|EFR39772.1| peptidase, M23 family [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 301

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 40/79 (50%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      GN + I H + ++T Y H     V  G++V RG  I   G +G++  P
Sbjct: 223 VVTAAGWSGSGYGNMVDIDHGNGVMTRYGHASAVAVTAGEQVRRGQIIAYVGSTGHSTGP 282

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R N   ++P  +L
Sbjct: 283 HLHYEVRLNGQPVNPAPYL 301


>gi|312792425|ref|YP_004025348.1| peptidase M23 [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312179565|gb|ADQ39735.1| Peptidase M23 [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 582

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  I+I H +   T Y H+    V  GQKV++G  I  SG +G +  P
Sbjct: 504 VVEFAGWS-GGYGKLIIINHQNGYQTYYGHLSRFLVSPGQKVAKGQLIAKSGSTGRSTGP 562

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+RKN +  +P+++L+
Sbjct: 563 HLHFEVRKNGVPQNPLRYLQ 582


>gi|320531019|ref|ZP_08032051.1| peptidase, M23 family [Selenomonas artemidis F0399]
 gi|320136768|gb|EFW28718.1| peptidase, M23 family [Selenomonas artemidis F0399]
          Length = 337

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 40/79 (50%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      GN + I H + ++T Y H     V  G++V RG  I   G +G++  P
Sbjct: 259 VVTAAGWSGSGYGNMVDIDHGNGVMTRYGHASAVAVTAGEQVRRGQIIAYVGSTGHSTGP 318

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R N   ++P  +L
Sbjct: 319 HLHYEVRLNGQPVNPAPYL 337


>gi|217967488|ref|YP_002352994.1| peptidase M23 [Dictyoglomus turgidum DSM 6724]
 gi|217336587|gb|ACK42380.1| Peptidase M23 [Dictyoglomus turgidum DSM 6724]
          Length = 375

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GN I+I H   I TVY H+    V+ G++++ G  IG  G +G +  P 
Sbjct: 298 VIFAGW-YGGYGNMIIIDHGGKISTVYGHLSKIVVKVGEEIAEGDVIGYVGSTGLSTGPH 356

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N   +DP+ +L+
Sbjct: 357 LHFEVRINGDPVDPLTWLK 375


>gi|332710065|ref|ZP_08430020.1| membrane-bound metallopeptidase [Lyngbya majuscula 3L]
 gi|332351208|gb|EGJ30793.1| membrane-bound metallopeptidase [Lyngbya majuscula 3L]
          Length = 392

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GNT++I H DSI T+Y H     V KG+ V RG+ I   G +G +  P 
Sbjct: 316 VIFAGW-YGGYGNTVIIDHGDSIATLYGHASRILVSKGESVKRGNAIATVGSTGFSTGPH 374

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RKN   +DP  +L
Sbjct: 375 LHFEVRKNGEPVDPTSYL 392


>gi|167037898|ref|YP_001665476.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|320116313|ref|YP_004186472.1| peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166856732|gb|ABY95140.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|319929404|gb|ADV80089.1| Peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 301

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  L   G  ++I H   I +VY H     V+ GQ V RG  I  SG +G +  P 
Sbjct: 221 VTYAGW-LSGYGKVVIIDHGYGIQSVYGHNSEILVKVGQSVKRGDIIAKSGNTGRSTGPH 279

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           VHFE+R N   +DP+K+L +
Sbjct: 280 VHFEVRVNGNPVDPMKYLAK 299


>gi|256751007|ref|ZP_05491890.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1]
 gi|256750117|gb|EEU63138.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1]
          Length = 301

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  L   G  ++I H   I +VY H     V+ GQ V RG  I  SG +G +  P 
Sbjct: 221 VTYAGW-LSGYGKVVIIDHGYGIQSVYGHNSEILVKVGQSVKRGDIIAKSGNTGRSTGPH 279

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           VHFE+R N   +DP+K+L +
Sbjct: 280 VHFEIRVNGNPVDPMKYLAK 299


>gi|167040796|ref|YP_001663781.1| peptidase M23B [Thermoanaerobacter sp. X514]
 gi|300914831|ref|ZP_07132147.1| Peptidase M23 [Thermoanaerobacter sp. X561]
 gi|307723935|ref|YP_003903686.1| peptidase M23 [Thermoanaerobacter sp. X513]
 gi|166855036|gb|ABY93445.1| peptidase M23B [Thermoanaerobacter sp. X514]
 gi|300889766|gb|EFK84912.1| Peptidase M23 [Thermoanaerobacter sp. X561]
 gi|307580996|gb|ADN54395.1| Peptidase M23 [Thermoanaerobacter sp. X513]
          Length = 301

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  L   G  ++I H   I +VY H     V+ GQ V RG  I  SG +G +  P 
Sbjct: 221 VTYAGW-LSGYGKVVIIDHGYGIQSVYGHNSEILVKVGQSVKRGDIIAKSGNTGRSTGPH 279

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           VHFE+R N   +DP+K+L +
Sbjct: 280 VHFEVRVNGNPVDPMKYLAK 299


>gi|20807323|ref|NP_622494.1| membrane proteins related to metalloendopeptidase
           [Thermoanaerobacter tengcongensis MB4]
 gi|20515836|gb|AAM24098.1| Membrane proteins related to metalloendopeptidases
           [Thermoanaerobacter tengcongensis MB4]
          Length = 301

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  L   G  ++I H   I +VY H     V+ GQ V+RG  I  SG +G +  P
Sbjct: 220 VVVYAGW-LAGYGKAVIIDHGYGIESVYGHNSQILVKVGQTVNRGDVIAKSGNTGRSTGP 278

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+R N   ++P+K+L +
Sbjct: 279 HVHFEIRANGSPVNPMKYLAK 299


>gi|254478304|ref|ZP_05091684.1| M23 peptidase domain protein [Carboxydibrachium pacificum DSM
           12653]
 gi|214035769|gb|EEB76463.1| M23 peptidase domain protein [Carboxydibrachium pacificum DSM
           12653]
          Length = 317

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  L   G  ++I H   I +VY H     V+ GQ V+RG  I  SG +G +  P
Sbjct: 236 VVVYAGW-LAGYGKAVIIDHGYGIESVYGHNSQILVKVGQTVNRGDVIAKSGNTGRSTGP 294

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+R N   ++P+K+L +
Sbjct: 295 HVHFEIRVNGSPVNPMKYLAK 315


>gi|313893525|ref|ZP_07827095.1| peptidase, M23 family [Veillonella sp. oral taxon 158 str. F0412]
 gi|313441968|gb|EFR60390.1| peptidase, M23 family [Veillonella sp. oral taxon 158 str. F0412]
          Length = 297

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 39/80 (48%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + I H +  VT Y H     V  G  V +G TI L G +G +   
Sbjct: 215 VVTFAGYTDGGYGNLVEIDHGNGFVTRYGHNSAVLVTVGMSVKQGQTIALMGSTGKSTGA 274

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            VH+E+R N   +DP+ FL 
Sbjct: 275 HVHYEVRLNGAPVDPMIFLP 294


>gi|56750934|ref|YP_171635.1| putative peptidase [Synechococcus elongatus PCC 6301]
 gi|81299409|ref|YP_399617.1| peptidoglycan-binding LysM [Synechococcus elongatus PCC 7942]
 gi|56685893|dbj|BAD79115.1| putative peptidase [Synechococcus elongatus PCC 6301]
 gi|81168290|gb|ABB56630.1| Peptidoglycan-binding LysM [Synechococcus elongatus PCC 7942]
          Length = 590

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    GN + I+H +  +T+Y+H +   V+ G++V +G  +   G +G +  P
Sbjct: 508 VVVTAGWNSGGYGNLVEIQHPNGSLTLYAHNNRILVRPGERVQQGQIVAEMGSTGRSTGP 567

Query: 61  QVHFELRKNAI-AMDPIKFLEEK 82
            +HFE+      A++PI +L  +
Sbjct: 568 HLHFEVHPRGNGAVNPIAYLPSR 590


>gi|294792413|ref|ZP_06757560.1| M23 peptidase domain protein [Veillonella sp. 6_1_27]
 gi|294456312|gb|EFG24675.1| M23 peptidase domain protein [Veillonella sp. 6_1_27]
          Length = 318

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 39/80 (48%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + I H +  VT Y H     V  G  V +G TI L G +G +   
Sbjct: 236 VVTFAGYTSGGYGNLVEIDHGNGFVTRYGHNSAVLVTVGMSVKQGQTIALMGSTGKSTGA 295

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            VH+E+R N   +DP+ FL 
Sbjct: 296 HVHYEVRLNNTPVDPMIFLP 315


>gi|294794219|ref|ZP_06759355.1| M23 peptidase domain protein [Veillonella sp. 3_1_44]
 gi|294454549|gb|EFG22922.1| M23 peptidase domain protein [Veillonella sp. 3_1_44]
          Length = 318

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 39/80 (48%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + I H +  VT Y H     V  G  V +G TI L G +G +   
Sbjct: 236 VVTFAGYTSGGYGNLVEIDHGNGFVTRYGHNSAVLVTVGMSVKQGQTIALMGSTGKSTGA 295

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            VH+E+R N   +DP+ FL 
Sbjct: 296 HVHYEVRLNNTPVDPMIFLP 315


>gi|282849488|ref|ZP_06258872.1| peptidase, M23 family [Veillonella parvula ATCC 17745]
 gi|282580425|gb|EFB85824.1| peptidase, M23 family [Veillonella parvula ATCC 17745]
          Length = 318

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 39/80 (48%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + I H +  VT Y H     V  G  V +G TI L G +G +   
Sbjct: 236 VVTFAGYTSGGYGNLVEIDHGNGFVTRYGHNSAVLVTVGMSVKQGQTIALMGSTGKSTGA 295

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            VH+E+R N   +DP+ FL 
Sbjct: 296 HVHYEVRLNNTPVDPMIFLP 315


>gi|269798898|ref|YP_003312798.1| peptidase M23 [Veillonella parvula DSM 2008]
 gi|269095527|gb|ACZ25518.1| Peptidase M23 [Veillonella parvula DSM 2008]
          Length = 318

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 39/80 (48%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + I H +  VT Y H     V  G  V +G TI L G +G +   
Sbjct: 236 VVTFAGYTSGGYGNLVEIDHGNGFVTRYGHNSAVLVTVGMSVKQGQTIALMGSTGKSTGA 295

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            VH+E+R N   +DP+ FL 
Sbjct: 296 HVHYEVRLNNTPVDPMIFLP 315


>gi|146297400|ref|YP_001181171.1| peptidase M23B [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145410976|gb|ABP67980.1| peptidase M23B [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 574

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  ++I H +   T Y H+    V  GQKV +G  I  SG +G +  P
Sbjct: 496 VVEFTGWS-GGYGKLVIINHKNGYQTYYGHLSRILVSPGQKVVKGQLIAKSGSTGRSTGP 554

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+RKN +  +P+++L 
Sbjct: 555 HLHFEVRKNGVPQNPLRYLR 574


>gi|304316538|ref|YP_003851683.1| peptidase M23 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778040|gb|ADL68599.1| Peptidase M23 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 311

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  L   GN ++I H   I +VY H     V+ GQ V+RG  I  SG +G +  P
Sbjct: 232 VVTYAGW-LSGYGNVVMINHGYGITSVYGHNSQLLVKVGQTVNRGDIIAKSGSTGRSTGP 290

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+R N  A+DP+K+L +
Sbjct: 291 HVHFEIRLNGNAVDPLKYLGK 311


>gi|292669347|ref|ZP_06602773.1| M23/M37 family peptidase [Selenomonas noxia ATCC 43541]
 gi|292648982|gb|EFF66954.1| M23/M37 family peptidase [Selenomonas noxia ATCC 43541]
          Length = 307

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 37/79 (46%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      GN + I H   I+T Y H     V  GQ+V RG  I   G +G +  P
Sbjct: 229 VVTTAGWTSSGYGNMVDIDHGGGIMTRYGHASAVAVTAGQQVRRGQIIAYVGSTGYSTGP 288

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R     ++P  +L
Sbjct: 289 HLHYEVRVGGQPVNPASYL 307


>gi|90417702|ref|ZP_01225614.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337374|gb|EAS51025.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 465

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      GN + I H + I T Y H+    V  G +V R   IG  G +G +  P 
Sbjct: 379 VVRAGRA-GGYGNLVEIDHGNGITTRYGHMSRIDVSVGDEVGRSTRIGAVGSTGRSTGPH 437

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +H+E+R++  A+DP++FL  +
Sbjct: 438 LHYEVRRDGKAVDPMRFLRIR 458


>gi|282858013|ref|ZP_06267214.1| peptidase M23B [Pyramidobacter piscolens W5455]
 gi|282584167|gb|EFB89534.1| peptidase M23B [Pyramidobacter piscolens W5455]
          Length = 399

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G  +   G  ++I H     TVY+H+    V +G  V +G  IG  G +G A  P 
Sbjct: 323 VIFAGW-MRGYGQVVIIDHGGGYATVYAHMSRIQVDEGDIVKKGAMIGKVGMTGVATGPH 381

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N  A +P+K+L
Sbjct: 382 LHFEVRVNGEARNPLKYL 399


>gi|255659847|ref|ZP_05405256.1| peptidoglycan-binding LysM [Mitsuokella multacida DSM 20544]
 gi|260847924|gb|EEX67931.1| peptidoglycan-binding LysM [Mitsuokella multacida DSM 20544]
          Length = 375

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 39/78 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G +    GN + I H + I T Y H     V  GQ V RG  I   G +G +  P 
Sbjct: 298 VTTAGWNSGGYGNMVDIDHGNGITTRYGHAMQVVVSAGQHVRRGQIIAYMGSTGFSTGPH 357

Query: 62  VHFELRKNAIAMDPIKFL 79
           VH+E+R N  A++P+ +L
Sbjct: 358 VHYEVRVNGQAVNPVSYL 375


>gi|303229894|ref|ZP_07316670.1| peptidase, M23 family [Veillonella atypica ACS-134-V-Col7a]
 gi|302515450|gb|EFL57416.1| peptidase, M23 family [Veillonella atypica ACS-134-V-Col7a]
          Length = 398

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G  +   G  ++I H + + T+Y H     V +GQ V++G  I  +G +GN+  P
Sbjct: 321 VVVWSGW-MGGYGYAVVIDHGNGLSTLYGHNSELAVDEGQSVAKGQVISYAGSTGNSTGP 379

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+R N   +DP+ +L
Sbjct: 380 HVHFEVRVNGDPVDPMGYL 398


>gi|303232144|ref|ZP_07318847.1| peptidase, M23 family [Veillonella atypica ACS-049-V-Sch6]
 gi|302513250|gb|EFL55289.1| peptidase, M23 family [Veillonella atypica ACS-049-V-Sch6]
          Length = 398

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G  +   G  ++I H + + T+Y H     V +GQ V++G  I  +G +GN+  P
Sbjct: 321 VVVWSGW-MGGYGYAVVIDHGNGLSTLYGHNSELAVDEGQSVAKGQVISYAGSTGNSTGP 379

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+R N   +DP+ +L
Sbjct: 380 HVHFEVRVNGDPVDPMGYL 398


>gi|16331215|ref|NP_441943.1| lipoprotein NlpD [Synechocystis sp. PCC 6803]
 gi|1653709|dbj|BAA18621.1| lipoprotein; NlpD [Synechocystis sp. PCC 6803]
          Length = 715

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G +    GN + IRH D  VT Y+H +   V++G+ V +G  I   G +G +  P 
Sbjct: 633 VVFSGWNSGGFGNLVKIRHGDGSVTYYAHNNRLLVRRGEYVEQGQQIAEMGSTGRSTGPH 692

Query: 62  VHFELRKNAI-AMDPIKFLEE 81
           +HFE+R     A++P+  L  
Sbjct: 693 LHFEIRVGGTNAVNPVALLPR 713


>gi|312134198|ref|YP_004001536.1| peptidase M23 [Caldicellulosiruptor owensensis OL]
 gi|311774249|gb|ADQ03736.1| Peptidase M23 [Caldicellulosiruptor owensensis OL]
          Length = 583

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V +VG  L   G  I+I H +   T Y H+    V  GQKV++G  I  SG +G +  P
Sbjct: 504 VVEFVGW-LGGYGKLIIINHQNGYKTYYGHLSRFLVSPGQKVAKGQLIAKSGSTGRSTGP 562

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +HFE+RKN +  +P+ +L +
Sbjct: 563 HLHFEVRKNGVPQNPLVYLRQ 583


>gi|323704329|ref|ZP_08115908.1| Peptidase M23 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323536395|gb|EGB26167.1| Peptidase M23 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 304

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  L   GN ++I H   I +VY H     V+ GQ V+RG  I  SG +G +  P
Sbjct: 225 IVTYAGW-LSGYGNVVMINHGYGITSVYGHNSQLLVRVGQTVNRGDVIAKSGSTGRSTGP 283

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+R N   +DP+K+L +
Sbjct: 284 HVHFEIRLNGNPVDPMKYLTK 304


>gi|319651064|ref|ZP_08005198.1| hypothetical protein HMPREF1013_01808 [Bacillus sp. 2_A_57_CT2]
 gi|317397234|gb|EFV77938.1| hypothetical protein HMPREF1013_01808 [Bacillus sp. 2_A_57_CT2]
          Length = 493

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 50/80 (62%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  GND    GN I+I H++   TVY+H+D+  V  GQ VS+G  IG+ G +G++    
Sbjct: 414 VVSAGNDGGGYGNKIVIDHNNGFRTVYAHLDSISVSVGQTVSKGSKIGIMGSTGDSTGVH 473

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+ KN    +P+K++ +
Sbjct: 474 LHFEVYKNGKMQNPLKYINK 493


>gi|326790682|ref|YP_004308503.1| peptidase M23 [Clostridium lentocellum DSM 5427]
 gi|326541446|gb|ADZ83305.1| Peptidase M23 [Clostridium lentocellum DSM 5427]
          Length = 595

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 40/74 (54%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G +    G  I+I H +   T Y+H  + YV  G  VS+G  I   G +G++    
Sbjct: 518 VIYSGYNNGGYGKLIIIDHGNGYQTYYAHCSSLYVNVGAYVSQGQNIAGVGSTGDSTGNH 577

Query: 62  VHFELRKNAIAMDP 75
           +HFE+RKN   ++P
Sbjct: 578 LHFEVRKNGTPINP 591


>gi|312623409|ref|YP_004025022.1| peptidase M23 [Caldicellulosiruptor kronotskyensis 2002]
 gi|312203876|gb|ADQ47203.1| Peptidase M23 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 600

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V +VG  L   G  I+I H +   T Y H+    V  GQKV++G  I  SG +G +  P
Sbjct: 522 VVEFVGW-LGGYGKLIIINHQNGYKTYYGHLSRFLVSPGQKVAKGQLIAKSGSTGRSTGP 580

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+RKN +  +P+ +L
Sbjct: 581 HLHFEVRKNGVPQNPLAYL 599


>gi|325291332|ref|YP_004267513.1| Peptidase M23 [Syntrophobotulus glycolicus DSM 8271]
 gi|324966733|gb|ADY57512.1| Peptidase M23 [Syntrophobotulus glycolicus DSM 8271]
          Length = 378

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GN ++I H + + ++Y H+ +  +  G  VS G TIG  G +G +  P 
Sbjct: 301 VIFAGW-YGAYGNAVIINHGNGLSSLYGHMSSIAIANGAAVSPGQTIGYVGSTGWSTGPH 359

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+N   ++P+ + +
Sbjct: 360 LHFEIRQNGNPVNPLGYFQ 378


>gi|329925022|ref|ZP_08279966.1| peptidase, M23 family [Paenibacillus sp. HGF5]
 gi|328940141|gb|EGG36473.1| peptidase, M23 family [Paenibacillus sp. HGF5]
          Length = 522

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      GN +++ H +   T+Y H+    V  GQ V +G  +G+ G +G +    
Sbjct: 446 VVFAG-QQSGYGNVVIVDHGNGYRTLYGHMSKISVGNGQSVGQGSKLGVMGNTGRSTGTH 504

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE++KN +A +P+K+L
Sbjct: 505 LHFEVQKNGVAQNPMKYL 522


>gi|256751921|ref|ZP_05492792.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1]
 gi|256749226|gb|EEU62259.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1]
          Length = 452

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G +    G  + I H +  VT Y H     V+KG KV++G  I L G +G A  P 
Sbjct: 373 VIFSGWE-SGYGYLVKIDHHNGYVTYYGHASKLLVKKGDKVAKGQKIALVGSTGRATGPH 431

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN + +DP+ FL  +
Sbjct: 432 LHFEVRKNGVPIDPMPFLNRR 452


>gi|150392437|ref|YP_001322486.1| peptidase M23B [Alkaliphilus metalliredigens QYMF]
 gi|149952299|gb|ABR50827.1| peptidase M23B [Alkaliphilus metalliredigens QYMF]
          Length = 481

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G +    GN ++I H++   T Y+H  +  V+KG +V +G  I   G +G +  P 
Sbjct: 403 VSFAGYN-GAYGNLVIINHENGYQTYYAHNSSLLVKKGDRVYKGEQIAKMGSTGRSTGPH 461

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+RKN   ++P+ F++
Sbjct: 462 LHFEVRKNGSPVNPLSFVK 480


>gi|167036532|ref|YP_001664110.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167040956|ref|YP_001663941.1| peptidase M23B [Thermoanaerobacter sp. X514]
 gi|300913833|ref|ZP_07131150.1| Peptidase M23 [Thermoanaerobacter sp. X561]
 gi|307725481|ref|YP_003905232.1| peptidase M23 [Thermoanaerobacter sp. X513]
 gi|320114964|ref|YP_004185123.1| peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166855196|gb|ABY93605.1| peptidase M23B [Thermoanaerobacter sp. X514]
 gi|166855366|gb|ABY93774.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|300890518|gb|EFK85663.1| Peptidase M23 [Thermoanaerobacter sp. X561]
 gi|307582542|gb|ADN55941.1| Peptidase M23 [Thermoanaerobacter sp. X513]
 gi|319928055|gb|ADV78740.1| Peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 452

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G +    G  + I H +  VT Y H     V+KG KV++G  I L G +G A  P 
Sbjct: 373 VIFSGWE-SGYGYLVKIDHHNGYVTYYGHASKLLVKKGDKVAKGQKIALVGSTGRATGPH 431

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN + +DP+ FL  +
Sbjct: 432 LHFEVRKNGVPIDPMPFLNRR 452


>gi|113474136|ref|YP_720197.1| peptidase M23B [Trichodesmium erythraeum IMS101]
 gi|110165184|gb|ABG49724.1| peptidase M23B [Trichodesmium erythraeum IMS101]
          Length = 824

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y   D    G  + I+H +  +T+Y+H     V++GQKVS+G  I   G +G +  P
Sbjct: 738 IVTYADWDGSGYGYLVEIKHPNGSLTLYAHNSEILVREGQKVSQGELIAKMGSTGRSTGP 797

Query: 61  QVHFELRKNAI-AMDPIKFLEEKI 83
            +HFE+      A+DP+ +L  +I
Sbjct: 798 HLHFEIHPQGNGAVDPMAYLPSRI 821


>gi|312128630|ref|YP_003993504.1| peptidase M23 [Caldicellulosiruptor hydrothermalis 108]
 gi|311778649|gb|ADQ08135.1| Peptidase M23 [Caldicellulosiruptor hydrothermalis 108]
          Length = 582

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  I+I H +   T Y H+    V  GQKV++G  I  SG +G +  P
Sbjct: 504 VVEFAGWS-GGYGKLIIINHQNGYKTYYGHLSRFLVSPGQKVAKGQLIAKSGSTGRSTGP 562

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+RKN +  +P+ +L 
Sbjct: 563 HLHFEVRKNGVPQNPLVYLR 582


>gi|302870891|ref|YP_003839527.1| Peptidase M23 [Caldicellulosiruptor obsidiansis OB47]
 gi|302573750|gb|ADL41541.1| Peptidase M23 [Caldicellulosiruptor obsidiansis OB47]
          Length = 582

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V +VG  L   G  I+I H +   T Y H+    V  GQKV++G  I  SG +G +  P
Sbjct: 504 IVEFVGW-LGGYGKLIIINHQNGYKTYYGHLSRFLVSPGQKVAKGQLIAKSGSTGRSTGP 562

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+RKN I  +P+++L 
Sbjct: 563 HLHFEVRKNGIPQNPLRYLN 582


>gi|254413069|ref|ZP_05026841.1| M23 peptidase domain protein [Microcoleus chthonoplastes PCC 7420]
 gi|196180233|gb|EDX75225.1| M23 peptidase domain protein [Microcoleus chthonoplastes PCC 7420]
          Length = 819

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    G  + I+H D  +T+Y+H +   V++GQ+V +G  I   G +G +  P
Sbjct: 736 VVVTAGWNSGGYGKLVEIKHPDGSLTLYAHNNRILVRRGQEVDQGQQISEMGSTGYSTGP 795

Query: 61  QVHFELRKNAI-AMDPIKFLEE 81
            +HFE+      A++P+ FL +
Sbjct: 796 HLHFEVHPGGRGAVNPMAFLPK 817


>gi|307154693|ref|YP_003890077.1| peptidase M23 [Cyanothece sp. PCC 7822]
 gi|306984921|gb|ADN16802.1| Peptidase M23 [Cyanothece sp. PCC 7822]
          Length = 747

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G +    GN + IRH D  +T Y+H     V++GQ+V +G  I   G +G +  P 
Sbjct: 665 VISAGWNSGGYGNLVKIRHADGSITFYAHNSRIMVRQGQQVEQGELISQMGSTGFSTGPH 724

Query: 62  VHFELRKNA-IAMDPIKFLEEK 82
           +HFE+  N   A++P+ FL +K
Sbjct: 725 LHFEVHPNGQQAVNPMAFLPKK 746


>gi|261410067|ref|YP_003246308.1| peptidase M23 [Paenibacillus sp. Y412MC10]
 gi|261286530|gb|ACX68501.1| Peptidase M23 [Paenibacillus sp. Y412MC10]
          Length = 522

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      GN +++ H +   T+Y H+    V  GQ V +G  +G+ G +G +    
Sbjct: 446 VVFAG-QQSGYGNVVIVDHGNGYRTLYGHMSKISVGNGQSVGQGSKLGVMGNTGRSTGTH 504

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE++KN +A +P+K+L
Sbjct: 505 LHFEVQKNGVAQNPMKYL 522


>gi|315644227|ref|ZP_07897397.1| Peptidase M23 [Paenibacillus vortex V453]
 gi|315280602|gb|EFU43891.1| Peptidase M23 [Paenibacillus vortex V453]
          Length = 524

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      GN +++ H +   T+Y H+    V  GQ V +G  +G+ G +G +    
Sbjct: 448 VVFAG-QQSGYGNVVIVDHGNGYRTLYGHMSKISVSNGQSVGQGSKLGVMGNTGRSTGTH 506

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE++KN +A +P+ +L
Sbjct: 507 LHFEVQKNGVAQNPMNYL 524


>gi|168334534|ref|ZP_02692695.1| Membrane proteins related to metalloendopeptidase [Epulopiscium sp.
           'N.t. morphotype B']
          Length = 544

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y   +    GN ++I H +   T Y+H    YV+ G KVS+G  I   G +G++    
Sbjct: 465 VTYSTYNYGGYGNLVIIDHGNGYETYYAHNSRNYVKVGDKVSKGQHIAEVGSTGDSTGNH 524

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RKN +  +P  ++
Sbjct: 525 IHFEIRKNGVRQNPANYI 542


>gi|163759549|ref|ZP_02166634.1| hypothetical protein HPDFL43_09357 [Hoeflea phototrophica DFL-43]
 gi|162283146|gb|EDQ33432.1| hypothetical protein HPDFL43_09357 [Hoeflea phototrophica DFL-43]
          Length = 434

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G +    G  + I H   + T Y+H+    V KG  V  G  IG +G +G +  P
Sbjct: 344 VVVHAGRN-GGYGKMVEIDHGGGVKTRYAHLSKILVSKGDHVVIGERIGKAGSTGRSTGP 402

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R+N  A+DP++FL+
Sbjct: 403 HLHYEVRRNGNAVDPMRFLK 422


>gi|254422379|ref|ZP_05036097.1| M23 peptidase domain protein [Synechococcus sp. PCC 7335]
 gi|196189868|gb|EDX84832.1| M23 peptidase domain protein [Synechococcus sp. PCC 7335]
          Length = 424

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ G      GN +++ H   + T+Y H     V +G  V +G  IG  G +G +  P
Sbjct: 347 IVIFAGW-YGGYGNALILDHGGGLTTLYGHASKLNVAEGATVRQGDVIGAIGTTGLSTGP 405

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+RK    ++P+ FL
Sbjct: 406 HLHFEVRKAGKPINPMNFL 424


>gi|291544459|emb|CBL17568.1| Membrane proteins related to metalloendopeptidases [Ruminococcus
           sp. 18P13]
          Length = 587

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 42/79 (53%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G +    G  +++ H +  VTVY H    YV +GQ+VSRG  +   G +G +    
Sbjct: 505 VTYAGWNAGGYGYLVMVDHGNGYVTVYGHCSMIYVSEGQEVSRGQRMAAVGSTGRSTGNH 564

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N +  DP  FL 
Sbjct: 565 LHFEVRYNGMYCDPTGFLR 583


>gi|170079355|ref|YP_001735993.1| M23 peptidase domain-containing protein [Synechococcus sp. PCC
           7002]
 gi|169887024|gb|ACB00738.1| M23 peptidase domain protein [Synechococcus sp. PCC 7002]
          Length = 653

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G +    GN + IRH D  VT+Y+H     V+KGQ+V +G  I   G +G +  P 
Sbjct: 572 VITAGWNSGGYGNLVKIRHGDGSVTLYAHNSRIMVRKGQQVKQGQQIAAMGSTGFSTGPH 631

Query: 62  VHFELRKNAI-AMDPIKFLEEK 82
           +HFE+      A++P+ FL ++
Sbjct: 632 LHFEIHPKGQGAVNPMAFLPKR 653


>gi|308071609|ref|YP_003873214.1| membrane protein [Paenibacillus polymyxa E681]
 gi|305860888|gb|ADM72676.1| Membrane protein [Paenibacillus polymyxa E681]
          Length = 506

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN I+I H +   TVY H+ +  V  GQ V +G +IG+ G +G +   
Sbjct: 428 VVSFAGQQN-GYGNVIMIDHGNGYQTVYGHLSSIGVHVGQVVQQGESIGVMGNTGRSTGT 486

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+RK+    +P+ +L 
Sbjct: 487 HLHFEIRKDNTPRNPMTYLR 506


>gi|260887091|ref|ZP_05898354.1| membrane protein metalloendopeptidase [Selenomonas sputigena ATCC
           35185]
 gi|330839133|ref|YP_004413713.1| Peptidase M23 [Selenomonas sputigena ATCC 35185]
 gi|260863153|gb|EEX77653.1| membrane protein metalloendopeptidase [Selenomonas sputigena ATCC
           35185]
 gi|329746897|gb|AEC00254.1| Peptidase M23 [Selenomonas sputigena ATCC 35185]
          Length = 381

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  +   G  ++I H   I T+Y H     V +GQ VS+G  I   G +GN+  P
Sbjct: 304 IVSYAGW-ISGYGYAVIIDHGGGISTLYGHNQALLVSEGQSVSQGQAIAECGSTGNSTGP 362

Query: 61  QVHFELRKNAIAMDPIKFL 79
             HFE+R +   +DP+ +L
Sbjct: 363 HCHFEVRVDGEPVDPMGYL 381


>gi|222528232|ref|YP_002572114.1| peptidase M23 [Caldicellulosiruptor bescii DSM 6725]
 gi|222455079|gb|ACM59341.1| Peptidase M23 [Caldicellulosiruptor bescii DSM 6725]
          Length = 582

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  I+I H +   T Y H+    V  GQKV++G  I  SG +G +  P
Sbjct: 504 VVEFAGWS-GGYGKLIIINHQNGYKTYYGHLSRFLVSPGQKVAKGQLIAKSGSTGRSTGP 562

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+RKN +  +P+ +L
Sbjct: 563 HLHFEVRKNGVPQNPLVYL 581


>gi|238927951|ref|ZP_04659711.1| peptidase M23B [Selenomonas flueggei ATCC 43531]
 gi|238884186|gb|EEQ47824.1| peptidase M23B [Selenomonas flueggei ATCC 43531]
          Length = 371

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  +   GN ++I H   I T+Y H  +  V  G+ VS+G  I   G +GN+  P 
Sbjct: 295 VEYAGW-ISGYGNAVIINHGGGISTLYGHCQSLNVSVGESVSQGDVIAYCGSTGNSTGPH 353

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R+N   ++P+ +L
Sbjct: 354 CHFEVRENGEPVNPLSYL 371


>gi|125974362|ref|YP_001038272.1| peptidase M23B [Clostridium thermocellum ATCC 27405]
 gi|256005559|ref|ZP_05430519.1| Peptidase M23 [Clostridium thermocellum DSM 2360]
 gi|281418909|ref|ZP_06249927.1| Peptidase M23 [Clostridium thermocellum JW20]
 gi|125714587|gb|ABN53079.1| peptidase M23B [Clostridium thermocellum ATCC 27405]
 gi|255990467|gb|EEU00589.1| Peptidase M23 [Clostridium thermocellum DSM 2360]
 gi|281407366|gb|EFB37626.1| Peptidase M23 [Clostridium thermocellum JW20]
 gi|316941520|gb|ADU75554.1| Peptidase M23 [Clostridium thermocellum DSM 1313]
          Length = 375

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G      G T+++ H   I T+Y+H     V+ G  V+ G TI   G +G A  P
Sbjct: 296 VVIMSGWQN-GYGYTVVVDHGGGISTLYAHCSKLLVKVGDSVNAGDTIAKVGSTGLATGP 354

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+RKN   ++P+ +++
Sbjct: 355 HLHFEVRKNGTPVNPLDYVK 374


>gi|304436981|ref|ZP_07396944.1| peptidase M23B [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304369932|gb|EFM23594.1| peptidase M23B [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 371

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  +   GN ++I H   I T+Y H  +  V  G+ V +G  I   G +GN+  P 
Sbjct: 295 VEYAGW-ISGYGNAVIINHGGGISTLYGHCQSLNVSVGESVLQGDVIAYCGSTGNSTGPH 353

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R+N   ++P+ +L
Sbjct: 354 CHFEVRENGEPVNPLSYL 371


>gi|298493154|ref|YP_003723331.1| peptidase M23 ['Nostoc azollae' 0708]
 gi|298235072|gb|ADI66208.1| Peptidase M23 ['Nostoc azollae' 0708]
          Length = 404

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      G  ++I H   I T+Y H    YV +GQ V +G  I   G +G +  P 
Sbjct: 325 VIFAGW-YGGYGKAVIISHGKGITTLYGHTSELYVTEGQSVQKGLAIAAVGFTGLSTGPH 383

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   +DP  +L
Sbjct: 384 LHFEVRRNGTPVDPANYL 401


>gi|304437856|ref|ZP_07397804.1| M23/M37 family peptidase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369156|gb|EFM22833.1| M23/M37 family peptidase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 306

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 39/79 (49%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    GN + I H   + T Y H     V  GQ+V RG  I   G +G++  P
Sbjct: 228 VVTIAGWNAGGYGNMVDIDHGSGVSTRYGHASAVVVTPGQRVRRGQIIAYVGSTGHSTGP 287

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R +   ++P  +L
Sbjct: 288 HLHYEVRLSGQPVNPSSYL 306


>gi|312898639|ref|ZP_07758029.1| peptidase, M23 family [Megasphaera micronuciformis F0359]
 gi|310620558|gb|EFQ04128.1| peptidase, M23 family [Megasphaera micronuciformis F0359]
          Length = 392

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+     L   G  ++I H + + TVY H  +  V  GQ VS+G  I  SG +GN+  P
Sbjct: 315 VVVDADW-LGGYGYAVIIDHGNGLSTVYGHNSSLNVSPGQSVSKGQIIAYSGSTGNSTGP 373

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+R     +DP+ +L
Sbjct: 374 HVHFEVRSGGEPVDPMGYL 392


>gi|238926668|ref|ZP_04658428.1| peptidase M23B [Selenomonas flueggei ATCC 43531]
 gi|238885614|gb|EEQ49252.1| peptidase M23B [Selenomonas flueggei ATCC 43531]
          Length = 317

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 39/79 (49%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    GN + I H   + T Y H     V  GQ+V RG  I   G +G++  P
Sbjct: 239 VVTIAGWNAGGYGNMVDIDHGSGVSTRYGHASAVVVTPGQRVRRGQIIAYVGSTGHSTGP 298

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R +   ++P  +L
Sbjct: 299 HLHYEVRLSGQPVNPTSYL 317


>gi|238018241|ref|ZP_04598667.1| hypothetical protein VEIDISOL_00065 [Veillonella dispar ATCC 17748]
 gi|237864712|gb|EEP66002.1| hypothetical protein VEIDISOL_00065 [Veillonella dispar ATCC 17748]
          Length = 317

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 38/80 (47%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + I H +  VT Y H     V  G  V +G TI L G +G +   
Sbjct: 235 VVTFAGYTEGGYGNLVEIDHGNGFVTRYGHNSAVLVTVGMSVKQGQTIALMGSTGKSTGA 294

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            VH+E+R N    DP+ FL 
Sbjct: 295 HVHYEVRLNGSPTDPMIFLP 314


>gi|332295062|ref|YP_004436985.1| Peptidase M23 [Thermodesulfobium narugense DSM 14796]
 gi|332178165|gb|AEE13854.1| Peptidase M23 [Thermodesulfobium narugense DSM 14796]
          Length = 377

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G      G  I+I H   + T+Y+H        G+ V +G  IG  G +G A  P 
Sbjct: 300 VVYSGW-YDGYGKAIIIDHGGGVSTLYAHASRLVAYVGENVRQGQVIGYVGDTGYATGPH 358

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N   ++P+ +L 
Sbjct: 359 LHFEIRINGKPVNPLLYLP 377


>gi|222148398|ref|YP_002549355.1| membrane protein associated metalloendopeptidase [Agrobacterium
           vitis S4]
 gi|221735386|gb|ACM36349.1| membrane protein associated metalloendopeptidase [Agrobacterium
           vitis S4]
          Length = 430

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN + I H   + T Y H+    V+ G+K+  G  IGLSG +G +  P 
Sbjct: 343 VITAGP-TGGYGNMVEIDHGQGLSTRYGHMSKILVRPGEKIEVGQLIGLSGSTGRSTGPH 401

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+RKN   ++P+ FL
Sbjct: 402 LHYEIRKNGNPINPMSFL 419


>gi|260460872|ref|ZP_05809122.1| Peptidase M23 [Mesorhizobium opportunistum WSM2075]
 gi|259033449|gb|EEW34710.1| Peptidase M23 [Mesorhizobium opportunistum WSM2075]
          Length = 434

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    G  + + H +   T Y H+    V  G+KV  G  +G +G SG +  P
Sbjct: 347 VVTKAGWN-GGYGRMVEVDHGNGFATRYGHLSEIDVTVGEKVDAGAVLGKTGSSGRSTGP 405

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R N  A+DP++FL
Sbjct: 406 HLHYEVRHNGEAIDPLRFL 424


>gi|149911459|ref|ZP_01900076.1| hypothetical lipoprotein NlpD [Moritella sp. PE36]
 gi|149805490|gb|EDM65497.1| hypothetical lipoprotein NlpD [Moritella sp. PE36]
          Length = 310

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 46/81 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y++     V++ Q V  G  I   G SG     +
Sbjct: 230 VVYSGNGLRGYGNLIIIKHNDDYLSAYAYNQKLLVKEQQWVKAGQKIATMGNSGPNSGAE 289

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           ++FE+R     ++P+++L ++
Sbjct: 290 LYFEIRYRGKPVNPMRYLPKR 310


>gi|167628817|ref|YP_001679316.1| peptidase m23, putative [Heliobacterium modesticaldum Ice1]
 gi|167591557|gb|ABZ83305.1| peptidase m23, putative [Heliobacterium modesticaldum Ice1]
          Length = 391

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      GNT++I H     T+Y H+    V  GQ V +G  IG  G +G +  P
Sbjct: 312 VVAMAGY-YGAYGNTVIIDHGGGTATLYGHMSVINVSDGQTVQKGDIIGQVGSTGWSTGP 370

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R N    +P+ ++
Sbjct: 371 HLHFEVRVNGNHTNPMPYI 389


>gi|121535375|ref|ZP_01667187.1| peptidase M23B [Thermosinus carboxydivorans Nor1]
 gi|121306067|gb|EAX46997.1| peptidase M23B [Thermosinus carboxydivorans Nor1]
          Length = 309

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      G  + I H + IVT+Y H     V+ GQ+V +G  I   G +G +  P
Sbjct: 232 VVTYSGW-YGGYGKMVEIDHGNGIVTIYGHNSQNLVETGQRVKKGEIIAYMGSTGISTGP 290

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VH+E+R N  A++P  FL
Sbjct: 291 HVHYEVRVNGTAVNPANFL 309


>gi|288572950|ref|ZP_06391307.1| Peptidase M23 [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288568691|gb|EFC90248.1| Peptidase M23 [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 488

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  +   G  ++++HD +  T+Y+H    YV+KGQKVS G  +   G SG +  P 
Sbjct: 411 VVYAGW-MGGYGRVVVVKHDSTYSTLYAHCQKLYVRKGQKVSAGKVVATVGTSGRSTGPH 469

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N   ++P+K+L 
Sbjct: 470 LHFEIRINNKPVNPLKYLR 488


>gi|294102458|ref|YP_003554316.1| Peptidase M23 [Aminobacterium colombiense DSM 12261]
 gi|293617438|gb|ADE57592.1| Peptidase M23 [Aminobacterium colombiense DSM 12261]
          Length = 503

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  +   G  +++ H     T+Y+H  +  V+KGQ+VS+G  IGL G SG A  P 
Sbjct: 426 VVYSGW-MGGYGRVVVLSHGQGYSTLYAHCSSLSVKKGQRVSQGQVIGLVGTSGRATGPH 484

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+RKN   ++P+K L 
Sbjct: 485 LHFEVRKNNSPINPLKVLR 503


>gi|168070335|ref|XP_001786775.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162660511|gb|EDQ48411.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 438

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 45/79 (56%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    G  +++ H D + T Y+H+ +  V  GQ V  G  +G  G +G++   
Sbjct: 359 VVVEAGANRSGYGRMVVLDHGDGLQTFYAHMRSIIVAPGQSVDAGEMLGYMGHTGDSTGY 418

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R++ + ++P+ +L
Sbjct: 419 HLHFEVRQDDVPINPLPYL 437


>gi|303228567|ref|ZP_07315394.1| peptidase, M23 family [Veillonella atypica ACS-134-V-Col7a]
 gi|302516746|gb|EFL58661.1| peptidase, M23 family [Veillonella atypica ACS-134-V-Col7a]
          Length = 325

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 38/79 (48%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      GN + I H +  VT Y H     V  G  V +G  I L G +G +    
Sbjct: 244 VTFAGYTEGGYGNLVEIDHGNGFVTRYGHNSAVLVTPGMTVKQGQVIALMGSTGKSTGAH 303

Query: 62  VHFELRKNAIAMDPIKFLE 80
           VH+E+R N  A+DP+ FL 
Sbjct: 304 VHYEVRINGSAVDPMVFLP 322


>gi|303230643|ref|ZP_07317393.1| peptidase, M23 family [Veillonella atypica ACS-049-V-Sch6]
 gi|302514698|gb|EFL56690.1| peptidase, M23 family [Veillonella atypica ACS-049-V-Sch6]
          Length = 325

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 38/79 (48%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      GN + I H +  VT Y H     V  G  V +G  I L G +G +    
Sbjct: 244 VTFAGYTEGGYGNLVEIDHGNGFVTRYGHNSAVLVTPGMTVKQGQVIALMGSTGKSTGAH 303

Query: 62  VHFELRKNAIAMDPIKFLE 80
           VH+E+R N  A+DP+ FL 
Sbjct: 304 VHYEVRINGSAVDPMVFLP 322


>gi|75906408|ref|YP_320704.1| peptidase M23B [Anabaena variabilis ATCC 29413]
 gi|75700133|gb|ABA19809.1| Peptidase M23B [Anabaena variabilis ATCC 29413]
          Length = 400

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      G  ++I H   I T+Y H    YV +GQ V RG  I   G +G +  P 
Sbjct: 324 VIFAGW-YGGYGRAVIINHGGGITTLYGHASELYVAEGQPVQRGQAIAAVGSTGLSTGPH 382

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  +L
Sbjct: 383 LHFEVRRNGTPVNPGDYL 400


>gi|310644838|ref|YP_003949597.1| peptidase m23b [Paenibacillus polymyxa SC2]
 gi|309249789|gb|ADO59356.1| Peptidase M23B [Paenibacillus polymyxa SC2]
          Length = 507

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN I+I H +   TVY H+ +  V  GQ V +G +IG+ G +G +   
Sbjct: 429 VVSFAGQQN-GYGNVIMIDHGNGYQTVYGHLSSIGVHVGQVVQQGESIGVMGSTGRSTGT 487

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+RK+  A +P+ +L 
Sbjct: 488 HLHFEIRKDNTARNPMTYLR 507


>gi|13477076|ref|NP_108647.1| hypothetical protein mll8577 [Mesorhizobium loti MAFF303099]
 gi|14027840|dbj|BAB54433.1| mll8577 [Mesorhizobium loti MAFF303099]
          Length = 434

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    G  + + H +   T Y H+    V  G+K+  G  IG +G SG +  P
Sbjct: 347 IVTKAGWN-GGYGRMVEVDHGNGFATRYGHLSEIDVTVGEKLDAGAIIGKTGSSGRSTGP 405

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R N  A+DP++FL
Sbjct: 406 HLHYEVRHNGEAIDPLRFL 424


>gi|269792103|ref|YP_003317007.1| Peptidase M23 [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269099738|gb|ACZ18725.1| Peptidase M23 [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 404

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   G  I++ H   + TVY+H+    V +G+KVSRG  IG  G +G A  P 
Sbjct: 327 VLYAGW-LRGYGQVIILDHGRDLTTVYAHLSKIEVNEGEKVSRGEQIGRVGSTGIATGPH 385

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N  A++P+ +L+
Sbjct: 386 LHFEVRVNGKAVNPMGYLK 404


>gi|119511326|ref|ZP_01630440.1| Peptidase M23B [Nodularia spumigena CCY9414]
 gi|119464032|gb|EAW44955.1| Peptidase  M23B [Nodularia spumigena CCY9414]
          Length = 394

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      G T++I H     T+Y+H    YV +GQ V RG  I   G +G +  P 
Sbjct: 318 VIFAGW-YGGYGRTVIIDHGQDKTTLYAHASELYVSEGQSVERGQAIASVGSTGLSTGPH 376

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  +L
Sbjct: 377 LHFEVRRNGTPVNPADYL 394


>gi|260887465|ref|ZP_05898728.1| membrane protein metalloendopeptidase [Selenomonas sputigena ATCC
           35185]
 gi|260862752|gb|EEX77252.1| membrane protein metalloendopeptidase [Selenomonas sputigena ATCC
           35185]
          Length = 331

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 41/79 (51%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    GN + I H + I+T Y H  +  V+ GQ V RG  I   G +G +  P
Sbjct: 253 VVTDAGWNAGGYGNKVDIDHGNGIMTRYGHAQSIVVRTGQHVRRGQIIAYMGSTGFSTGP 312

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VH+E+R +   ++P  +L
Sbjct: 313 HVHYEVRIHGEPVNPAPYL 331


>gi|86609277|ref|YP_478039.1| M23B family peptidase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557819|gb|ABD02776.1| peptidase, M23B family [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 539

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ GN     GN + IRH + IVT Y+H    YV  GQ V +G TI   G +G +  P
Sbjct: 459 VVIFAGNAGDGYGNRVDIRHPNGIVTRYAHGHQIYVSTGQYVQQGQTIMSRGSTGWSTGP 518

Query: 61  QVHFELRK-NAIAMDPIKFLE 80
            +HFE+R      +DP  +L 
Sbjct: 519 HLHFEVRPGGGAPVDPRPYLP 539


>gi|188586803|ref|YP_001918348.1| Peptidase M23 [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179351490|gb|ACB85760.1| Peptidase M23 [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 412

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 50/83 (60%), Gaps = 3/83 (3%)

Query: 1   MVIYVG---NDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNA 57
           +VIY G   +     G  +++ H     T Y+H+++  V +G++VSRG  +GL G +G++
Sbjct: 330 VVIYAGIMGSLNSGYGRIVIVDHGGGYSTWYAHLNSILVSEGEEVSRGQPVGLIGSTGSS 389

Query: 58  QHPQVHFELRKNAIAMDPIKFLE 80
             P +HFE+RKN    +P+++L 
Sbjct: 390 TGPHLHFEVRKNDNPQNPLEYLN 412


>gi|119487745|ref|ZP_01621254.1| hypothetical protein L8106_29725 [Lyngbya sp. PCC 8106]
 gi|119455578|gb|EAW36715.1| hypothetical protein L8106_29725 [Lyngbya sp. PCC 8106]
          Length = 745

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           ++ Y G +    GN + I H D  +T+Y+H     V KGQKV++GH I   G +G +  P
Sbjct: 656 VITYAGWNSGGYGNLVEIEHPDGSLTLYAHNSRVLVNKGQKVAQGHQIAEMGSTGRSTGP 715

Query: 61  QVHFELRKNAI-AMDPIKFLEE 81
            +HFE+  +   A++P+  L  
Sbjct: 716 HLHFEIHPSGQGAVNPMALLPS 737


>gi|306820490|ref|ZP_07454124.1| peptidase M23B [Eubacterium yurii subsp. margaretiae ATCC 43715]
 gi|304551476|gb|EFM39433.1| peptidase M23B [Eubacterium yurii subsp. margaretiae ATCC 43715]
          Length = 373

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G      GN ++I H   IVT+Y H  +  VQ GQ V RG  +   G +G +  P 
Sbjct: 294 VIYAGPK-GTYGNAVMIDHGAGIVTLYGHCSSVAVQVGQIVKRGELVAYMGSTGRSTGPH 352

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N   +DP+ +L 
Sbjct: 353 LHFEVRLNGEFVDPMPYLR 371


>gi|254422640|ref|ZP_05036358.1| M23 peptidase domain protein [Synechococcus sp. PCC 7335]
 gi|196190129|gb|EDX85093.1| M23 peptidase domain protein [Synechococcus sp. PCC 7335]
          Length = 628

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    GN + IRH D  +T+Y+H +   V  GQ V +G  I   G +G +  P
Sbjct: 546 IVEKAGWNSGGYGNLVEIRHPDGSLTLYAHNNRLNVSTGQAVKQGQKIAEMGSTGYSTGP 605

Query: 61  QVHFELRKNAI-AMDPIKFLEEK 82
            +HFE+  +   A++PI +L  +
Sbjct: 606 HLHFEVHVSGRGAVNPIAYLPNR 628


>gi|22299697|ref|NP_682944.1| putative peptidase [Thermosynechococcus elongatus BP-1]
 gi|22295881|dbj|BAC09706.1| tlr2154 [Thermosynechococcus elongatus BP-1]
          Length = 420

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y   +    GN + IRH D  +T+Y+H     V+ GQ V +G  I   G +G +  P
Sbjct: 336 VVTYSQWNSGGYGNLVEIRHADGTLTLYAHNHRNLVRVGQYVEQGQQIAEMGSTGRSTGP 395

Query: 61  QVHFELRKNAI-AMDPIKFLEE 81
            VHFE+      A++P+ FL+ 
Sbjct: 396 HVHFEVHPQGQGAVNPMIFLQR 417


>gi|290968812|ref|ZP_06560349.1| peptidase, M23 family [Megasphaera genomosp. type_1 str. 28L]
 gi|290781108|gb|EFD93699.1| peptidase, M23 family [Megasphaera genomosp. type_1 str. 28L]
          Length = 415

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G  +   G  ++I H   I T+Y+H  +  V  GQ V++G  +  SG +GN   P
Sbjct: 338 IVVSAGW-ISGYGYAVIIDHGGGISTLYAHNSSLLVHAGQSVAKGQVVARSGATGNVTGP 396

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R+N   ++P+ FL
Sbjct: 397 HIHFEVRRNGTPVNPLSFL 415


>gi|330840105|ref|YP_004414685.1| Peptidase M23 [Selenomonas sputigena ATCC 35185]
 gi|329747869|gb|AEC01226.1| Peptidase M23 [Selenomonas sputigena ATCC 35185]
          Length = 344

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 41/79 (51%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    GN + I H + I+T Y H  +  V+ GQ V RG  I   G +G +  P
Sbjct: 266 VVTDAGWNAGGYGNKVDIDHGNGIMTRYGHAQSIVVRTGQHVRRGQIIAYMGSTGFSTGP 325

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VH+E+R +   ++P  +L
Sbjct: 326 HVHYEVRIHGEPVNPAPYL 344


>gi|323706153|ref|ZP_08117721.1| Peptidase M23 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534446|gb|EGB24229.1| Peptidase M23 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 401

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G +    GN + + H +  VT Y H     V+KG KV++G  I L G +GN   P 
Sbjct: 324 VVFAGWEN-GYGNLVEVDHGNGYVTYYGHASKLLVKKGDKVNKGQEIALVGMTGNTTGPH 382

Query: 62  VHFELRKNAIAMDPIKFLE 80
           VHFE+RKN + ++P+ +L+
Sbjct: 383 VHFEVRKNGVPVNPMMYLK 401


>gi|218439055|ref|YP_002377384.1| peptidase M23 [Cyanothece sp. PCC 7424]
 gi|218171783|gb|ACK70516.1| Peptidase M23 [Cyanothece sp. PCC 7424]
          Length = 751

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G +    GN + +RH D  VT+Y+H     V++GQ+V +G  I   G +G +  P 
Sbjct: 668 VISAGWNSGGYGNLVKVRHTDGSVTLYAHNSRILVRRGQQVEQGQLIAEMGSTGYSTGPH 727

Query: 62  VHFELRKNA-IAMDPIKFLEE 81
           +HFE+  +   A++P+ FL +
Sbjct: 728 LHFEIHPDGSKAVNPMAFLPK 748


>gi|125974261|ref|YP_001038171.1| peptidase M23B [Clostridium thermocellum ATCC 27405]
 gi|256003522|ref|ZP_05428512.1| Peptidase M23 [Clostridium thermocellum DSM 2360]
 gi|281418314|ref|ZP_06249334.1| Peptidase M23 [Clostridium thermocellum JW20]
 gi|125714486|gb|ABN52978.1| peptidase M23B [Clostridium thermocellum ATCC 27405]
 gi|255992546|gb|EEU02638.1| Peptidase M23 [Clostridium thermocellum DSM 2360]
 gi|281409716|gb|EFB39974.1| Peptidase M23 [Clostridium thermocellum JW20]
 gi|316941410|gb|ADU75444.1| Peptidase M23 [Clostridium thermocellum DSM 1313]
          Length = 309

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V          G  ++I H   + T+Y H  T  V++GQ V +G  I   G +G +  P 
Sbjct: 230 VTLSDW-YGNYGKCVIIDHGYGLSTLYGHCQTLLVKEGQTVKKGDKIATVGSTGRSTGPH 288

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R N + +DP+++L+ K
Sbjct: 289 LHFEVRLNGVPVDPLQYLDNK 309


>gi|260887513|ref|ZP_05898776.1| peptidase, M23/M37 family [Selenomonas sputigena ATCC 35185]
 gi|330837893|ref|YP_004412473.1| Peptidase M23 [Selenomonas sputigena ATCC 35185]
 gi|260862800|gb|EEX77300.1| peptidase, M23/M37 family [Selenomonas sputigena ATCC 35185]
 gi|329745657|gb|AEB99013.1| Peptidase M23 [Selenomonas sputigena ATCC 35185]
          Length = 308

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 39/79 (49%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    GN + I H + I+T Y H     V +GQ V RG  I   G +G +  P
Sbjct: 230 VVTTAGWNGGGYGNMVDIDHGNGILTRYGHASEVVVHEGQHVKRGEVIAYMGSTGFSTGP 289

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VH+E+  N   ++P  +L
Sbjct: 290 HVHYEIHVNGETVNPASYL 308


>gi|292670319|ref|ZP_06603745.1| M23B family peptidase [Selenomonas noxia ATCC 43541]
 gi|292648050|gb|EFF66022.1| M23B family peptidase [Selenomonas noxia ATCC 43541]
          Length = 371

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  +   GN ++I H   I T+Y H  +  V  GQ V++G  I   G +GN+  P 
Sbjct: 295 VEYAGW-ISGYGNAVIINHGGGISTLYGHCQSLEVSTGQSVAQGELIAECGSTGNSTGPH 353

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R N   ++P+ +L
Sbjct: 354 CHFEVRVNGEPVNPLAYL 371


>gi|297587265|ref|ZP_06945910.1| cell wall-binding protein [Finegoldia magna ATCC 53516]
 gi|297575246|gb|EFH93965.1| cell wall-binding protein [Finegoldia magna ATCC 53516]
          Length = 407

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++VG      GN + ++HD+  +T Y H+       GQ+V RG  I   G +G +  P
Sbjct: 329 VVVHVGWS-GGYGNLVKVQHDNGALTYYGHLSGFNCSVGQRVKRGQLIAYMGSTGYSTGP 387

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N    DP+ +L 
Sbjct: 388 HLHFEVRFNGQHTDPLNYLR 407


>gi|302390755|ref|YP_003826576.1| Peptidase M23 [Thermosediminibacter oceani DSM 16646]
 gi|302201383|gb|ADL08953.1| Peptidase M23 [Thermosediminibacter oceani DSM 16646]
          Length = 451

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G +    G  +++ H     T Y+H++T  V  G++V +G  +G  G +G    P 
Sbjct: 373 VTFAGWN-GGYGKLVIVNHGGGFETYYAHLNTISVSVGERVEKGEVLGTVGSTGRTTGPH 431

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R N    +P+ +L +
Sbjct: 432 LHFEVRVNGTPKNPLLYLGK 451


>gi|84515551|ref|ZP_01002913.1| peptidase, M23/M37 family [Loktanella vestfoldensis SKA53]
 gi|84510834|gb|EAQ07289.1| peptidase, M23/M37 family [Loktanella vestfoldensis SKA53]
          Length = 430

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    G  I IRHD  + T Y+H++T  V+ GQ+VSRG  IG  G SG +  P
Sbjct: 346 VVVKAGWE-SSYGRLITIRHDFGLETRYAHLNTIDVRVGQRVSRGDRIGAMGNSGRSTGP 404

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R N   ++P+ ++ 
Sbjct: 405 HLHYEVRVNGNPVNPMTYIR 424


>gi|226315069|ref|YP_002774965.1| hypothetical protein BBR47_54840 [Brevibacillus brevis NBRC 100599]
 gi|226098019|dbj|BAH46461.1| hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 300

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 45/81 (55%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    G  I+I H D + T Y+H+    V  GQ V  G  +G  G++GN+   
Sbjct: 220 VVVEAGANRSGYGRMIVIDHGDGLQTFYAHMRLLLVSPGQTVEAGEVLGYMGQTGNSTGY 279

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +HFE+R++ + ++P+ +L  
Sbjct: 280 HLHFEVRQDDVPINPLPYLGR 300


>gi|158321282|ref|YP_001513789.1| peptidase M23B [Alkaliphilus oremlandii OhILAs]
 gi|158141481|gb|ABW19793.1| peptidase M23B [Alkaliphilus oremlandii OhILAs]
          Length = 376

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G  L   G  ++I H   I+T+Y+H     V  G  V+ G  I L G +G +  P 
Sbjct: 297 VITAGT-LGSYGKAVIIDHGGGIMTLYAHNSKLLVSNGDTVTSGQVIALIGSTGASTGPH 355

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN   +DPI +L+ K
Sbjct: 356 LHFEVRKNGQYVDPIPYLKGK 376


>gi|158340041|ref|YP_001521211.1| peptidase M23 domain-containing protein [Acaryochloris marina
           MBIC11017]
 gi|158310282|gb|ABW31897.1| peptidase M23 domain protein [Acaryochloris marina MBIC11017]
          Length = 386

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI         GNT+++ H + + T+Y H    YV  GQ V RG TI   G +G +  P 
Sbjct: 310 VIVAEW-YGGYGNTVIVDHGNGLTTLYGHCSELYVTVGQGVQRGQTIAAIGSTGLSTGPH 368

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+    +DP+ +L
Sbjct: 369 LHFEVRQQGEPVDPLAYL 386


>gi|110803840|ref|YP_698903.1| peptidase, M23/M37 family protein [Clostridium perfringens SM101]
 gi|110684341|gb|ABG87711.1| peptidase, M23/M37 family protein [Clostridium perfringens SM101]
          Length = 431

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G +    GN ++I H D   T+Y H     VQ GQ VS+G  I   G +G +  P 
Sbjct: 354 VVEAGWNTA-YGNMVIIDHGDGTSTLYGHSSRLAVQAGQHVSQGQVIAYVGSTGYSTGPH 412

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HF +  N   ++P+ ++ 
Sbjct: 413 LHFGIMINGQWVNPMNYIN 431


>gi|146312854|ref|YP_001177928.1| lipoprotein NlpD [Enterobacter sp. 638]
 gi|145319730|gb|ABP61877.1| peptidase M23B [Enterobacter sp. 638]
          Length = 374

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q++  G  I   G +G +   +
Sbjct: 295 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEIKAGQKIATMGSTGTSS-TR 353

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 354 LHFEIRYKGKSVNPLQYLPQR 374


>gi|323978650|gb|EGB73732.1| peptidase M23 [Escherichia coli TW10509]
          Length = 379

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|323966894|gb|EGB62323.1| peptidase M23 [Escherichia coli M863]
 gi|327251470|gb|EGE63156.1| lipoprotein nlpD [Escherichia coli STEC_7v]
          Length = 379

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|322614254|gb|EFY11185.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322621682|gb|EFY18535.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322624543|gb|EFY21376.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322633399|gb|EFY30141.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322636025|gb|EFY32733.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322639618|gb|EFY36304.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322646917|gb|EFY43420.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322652218|gb|EFY48577.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322654703|gb|EFY51022.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322658924|gb|EFY55177.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322664509|gb|EFY60703.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322668242|gb|EFY64399.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322673778|gb|EFY69879.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322677839|gb|EFY73902.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322681331|gb|EFY77363.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322683733|gb|EFY79743.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323193879|gb|EFZ79082.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323200348|gb|EFZ85430.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323202370|gb|EFZ87414.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323205604|gb|EFZ90569.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323216418|gb|EGA01145.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323220765|gb|EGA05206.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323226391|gb|EGA10599.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323230729|gb|EGA14847.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323234920|gb|EGA19006.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323238959|gb|EGA23009.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323241659|gb|EGA25690.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323248194|gb|EGA32130.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323251222|gb|EGA35095.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323257394|gb|EGA41090.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323263242|gb|EGA46780.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323264256|gb|EGA47762.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323271082|gb|EGA54510.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 377

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|293449063|ref|ZP_06663484.1| nlpD [Escherichia coli B088]
 gi|291322153|gb|EFE61582.1| nlpD [Escherichia coli B088]
          Length = 379

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|254511787|ref|ZP_05123854.1| peptidase, M23/M37 family [Rhodobacteraceae bacterium KLH11]
 gi|221535498|gb|EEE38486.1| peptidase, M23/M37 family [Rhodobacteraceae bacterium KLH11]
          Length = 441

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I+H   I T+Y+H     V+KGQ+VSRG  I   G +G +   
Sbjct: 357 VVTHAGWQ-SGFGRLVKIKHAFGIETLYAHNTKILVKKGQRVSRGDHIADMGSTGRSTGT 415

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R N   ++P+ +++
Sbjct: 416 HLHYEVRVNGKPVNPMTYIK 435


>gi|168463935|ref|ZP_02697852.1| lipoprotein [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|195633684|gb|EDX52098.1| lipoprotein [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
          Length = 373

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 294 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 352

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 353 LHFEIRYKGKSVNPLRYLPQR 373


>gi|167993164|ref|ZP_02574259.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205328712|gb|EDZ15476.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|332989796|gb|AEF08779.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 373

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 294 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 352

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 353 LHFEIRYKGKSVNPLRYLPQR 373


>gi|62181427|ref|YP_217844.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62129060|gb|AAX66763.1| lipoprotein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322715911|gb|EFZ07482.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 373

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 294 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 352

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 353 LHFEIRYKGKSVNPLRYLPQR 373


>gi|56414873|ref|YP_151948.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197363801|ref|YP_002143438.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|56129130|gb|AAV78636.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197095278|emb|CAR60831.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 377

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|16761697|ref|NP_457314.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|29143181|ref|NP_806523.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|213619185|ref|ZP_03373011.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-2068]
 gi|213648320|ref|ZP_03378373.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
 gi|213859420|ref|ZP_03385124.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. M223]
 gi|289829789|ref|ZP_06547304.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-3139]
 gi|17433727|sp|Q56131|NLPD_SALTI RecName: Full=Lipoprotein nlpD; Flags: Precursor
 gi|25316608|pir||AH0855 lipoprotein NlpD precursor [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16503998|emb|CAD06031.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138814|gb|AAO70383.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 373

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 294 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 352

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 353 LHFEIRYKGKSVNPLRYLPQR 373


>gi|16766231|ref|NP_461846.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167550224|ref|ZP_02343981.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|168230999|ref|ZP_02656057.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168242665|ref|ZP_02667597.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168261947|ref|ZP_02683920.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|168820375|ref|ZP_02832375.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194444146|ref|YP_002042166.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194451660|ref|YP_002046883.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194471325|ref|ZP_03077309.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|197251233|ref|YP_002147822.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197264254|ref|ZP_03164328.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|200386978|ref|ZP_03213590.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205353866|ref|YP_002227667.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207858185|ref|YP_002244836.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|20141556|sp|P40827|NLPD_SALTY RecName: Full=Lipoprotein nlpD; Flags: Precursor
 gi|16421474|gb|AAL21805.1| lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|194402809|gb|ACF63031.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194409964|gb|ACF70183.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194457689|gb|EDX46528.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|197214936|gb|ACH52333.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197242509|gb|EDY25129.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|199604076|gb|EDZ02621.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205273647|emb|CAR38636.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205324818|gb|EDZ12657.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205334456|gb|EDZ21220.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205337974|gb|EDZ24738.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205342848|gb|EDZ29612.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205349313|gb|EDZ35944.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|206709988|emb|CAR34343.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261248061|emb|CBG25895.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995055|gb|ACY89940.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301159484|emb|CBW19003.1| lipoprotein NlpD precursor [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312913943|dbj|BAJ37917.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|320087328|emb|CBY97093.1| DNA-directed RNA polymerase subunit beta RNAP subunit beta;
           Transcriptase subunit beta; RNA polymerase subunit beta
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|323131277|gb|ADX18707.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|326628976|gb|EGE35319.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 377

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|198243830|ref|YP_002216891.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|13432179|sp|P39700|NLPD_SALDU RecName: Full=Lipoprotein nlpD; Flags: Precursor
 gi|3150246|emb|CAA06881.1| nlpD [Salmonella enterica subsp. enterica serovar Dublin]
 gi|197938346|gb|ACH75679.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|326624654|gb|EGE30999.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 377

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|218547742|ref|YP_002381533.1| lipoprotein NlpD [Escherichia fergusonii ATCC 35469]
 gi|218355283|emb|CAQ87890.1| outer membrane lipoprotein [Escherichia fergusonii ATCC 35469]
 gi|325496209|gb|EGC94068.1| lipoprotein NlpD [Escherichia fergusonii ECD227]
          Length = 380

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 301 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 359

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 360 LHFEIRYKGKSVNPLRYLPQR 380


>gi|172036729|ref|YP_001803230.1| peptidoglycan-binding M23B family peptidase [Cyanothece sp. ATCC
           51142]
 gi|171698183|gb|ACB51164.1| putative peptidoglycan-binding peptidase, M23B family [Cyanothece
           sp. ATCC 51142]
          Length = 192

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/85 (38%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G     LG  + IRH D  V+VY H     V  GQ V RG  I   G +G +  P
Sbjct: 96  VVVFAGWSNKGLGYQVSIRHPDGNVSVYGHNQRLLVTSGQTVERGQQIAEMGSTGFSTGP 155

Query: 61  QVHFELRKNA-IAMDPIKFLEEKIP 84
            +HFE+R N   A++PI FL  + P
Sbjct: 156 HLHFEIRPNGKKAVNPIAFLPGQRP 180


>gi|295097323|emb|CBK86413.1| Membrane proteins related to metalloendopeptidases [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 374

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 295 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 353

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 354 LHFEIRYKGKSVNPLQYLPQR 374


>gi|238896222|ref|YP_002920958.1| lipoprotein NlpD [Klebsiella pneumoniae NTUH-K2044]
 gi|238548540|dbj|BAH64891.1| lipoprotein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 376

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 297 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 355

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 356 LHFEIRYKGKSVNPLQYLPQR 376


>gi|206580086|ref|YP_002236888.1| lipoprotein NlpD [Klebsiella pneumoniae 342]
 gi|288933842|ref|YP_003437901.1| peptidase M23 [Klebsiella variicola At-22]
 gi|290511077|ref|ZP_06550446.1| lipoprotein NlpD [Klebsiella sp. 1_1_55]
 gi|206569144|gb|ACI10920.1| lipoprotein NlpD [Klebsiella pneumoniae 342]
 gi|288888571|gb|ADC56889.1| Peptidase M23 [Klebsiella variicola At-22]
 gi|289776070|gb|EFD84069.1| lipoprotein NlpD [Klebsiella sp. 1_1_55]
          Length = 378

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 299 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 357

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 358 LHFEIRYKGKSVNPLQYLPQR 378


>gi|152971626|ref|YP_001336735.1| lipoprotein NlpD [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|150956475|gb|ABR78505.1| lipoprotein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
          Length = 378

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 299 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 357

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 358 LHFEIRYKGKSVNPLQYLPQR 378


>gi|204928307|ref|ZP_03219507.1| lipoprotein [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|204322629|gb|EDZ07826.1| lipoprotein [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
          Length = 377

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|168235963|ref|ZP_02661021.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194737503|ref|YP_002115874.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|194713005|gb|ACF92226.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197290900|gb|EDY30254.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
          Length = 377

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|157158958|ref|YP_001464065.1| lipoprotein NlpD [Escherichia coli E24377A]
 gi|157162190|ref|YP_001459508.1| lipoprotein NlpD [Escherichia coli HS]
 gi|170019012|ref|YP_001723966.1| lipoprotein NlpD [Escherichia coli ATCC 8739]
 gi|191166807|ref|ZP_03028633.1| lipoprotein NlpD [Escherichia coli B7A]
 gi|193064994|ref|ZP_03046069.1| lipoprotein NlpD [Escherichia coli E22]
 gi|193069679|ref|ZP_03050631.1| lipoprotein NlpD [Escherichia coli E110019]
 gi|194427802|ref|ZP_03060348.1| lipoprotein NlpD [Escherichia coli B171]
 gi|194438973|ref|ZP_03071057.1| lipoprotein NlpD [Escherichia coli 101-1]
 gi|209920185|ref|YP_002294269.1| lipoprotein NlpD [Escherichia coli SE11]
 gi|218696340|ref|YP_002404007.1| lipoprotein NlpD [Escherichia coli 55989]
 gi|253772402|ref|YP_003035233.1| lipoprotein NlpD [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254037784|ref|ZP_04871842.1| lipoprotein nlpD [Escherichia sp. 1_1_43]
 gi|254162673|ref|YP_003045781.1| lipoprotein NlpD [Escherichia coli B str. REL606]
 gi|256024750|ref|ZP_05438615.1| lipoprotein NlpD [Escherichia sp. 4_1_40B]
 gi|260845389|ref|YP_003223167.1| putative outer membrane lipoprotein NlpD [Escherichia coli O103:H2
           str. 12009]
 gi|260856853|ref|YP_003230744.1| putative outer membrane lipoprotein NlpD [Escherichia coli O26:H11
           str. 11368]
 gi|297518366|ref|ZP_06936752.1| lipoprotein NlpD [Escherichia coli OP50]
 gi|307139430|ref|ZP_07498786.1| lipoprotein NlpD [Escherichia coli H736]
 gi|312973047|ref|ZP_07787220.1| lipoprotein nlpD [Escherichia coli 1827-70]
 gi|331643428|ref|ZP_08344559.1| lipoprotein NlpD [Escherichia coli H736]
 gi|157067870|gb|ABV07125.1| lipoprotein NlpD [Escherichia coli HS]
 gi|157080988|gb|ABV20696.1| lipoprotein NlpD [Escherichia coli E24377A]
 gi|169753940|gb|ACA76639.1| peptidase M23B [Escherichia coli ATCC 8739]
 gi|190903178|gb|EDV62901.1| lipoprotein NlpD [Escherichia coli B7A]
 gi|192927291|gb|EDV81910.1| lipoprotein NlpD [Escherichia coli E22]
 gi|192957042|gb|EDV87493.1| lipoprotein NlpD [Escherichia coli E110019]
 gi|194414035|gb|EDX30311.1| lipoprotein NlpD [Escherichia coli B171]
 gi|194422094|gb|EDX38097.1| lipoprotein NlpD [Escherichia coli 101-1]
 gi|209913444|dbj|BAG78518.1| lipoprotein [Escherichia coli SE11]
 gi|218353072|emb|CAU98897.1| outer membrane lipoprotein [Escherichia coli 55989]
 gi|226839408|gb|EEH71429.1| lipoprotein nlpD [Escherichia sp. 1_1_43]
 gi|242378297|emb|CAQ33074.1| NlpD putative outer membrane lipoprotein [Escherichia coli
           BL21(DE3)]
 gi|253323446|gb|ACT28048.1| Peptidase M23 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974574|gb|ACT40245.1| predicted outer membrane lipoprotein [Escherichia coli B str.
           REL606]
 gi|253978741|gb|ACT44411.1| predicted outer membrane lipoprotein [Escherichia coli BL21(DE3)]
 gi|257755502|dbj|BAI27004.1| predicted outer membrane lipoprotein NlpD [Escherichia coli O26:H11
           str. 11368]
 gi|257760536|dbj|BAI32033.1| predicted outer membrane lipoprotein NlpD [Escherichia coli O103:H2
           str. 12009]
 gi|309703101|emb|CBJ02433.1| lipoprotein [Escherichia coli ETEC H10407]
 gi|310332989|gb|EFQ00203.1| lipoprotein nlpD [Escherichia coli 1827-70]
 gi|315062023|gb|ADT76350.1| predicted outer membrane lipoprotein [Escherichia coli W]
 gi|315615131|gb|EFU95768.1| lipoprotein nlpD [Escherichia coli 3431]
 gi|320202393|gb|EFW76963.1| Lipoprotein NlpD [Escherichia coli EC4100B]
 gi|323183274|gb|EFZ68671.1| lipoprotein nlpD [Escherichia coli 1357]
 gi|323377394|gb|ADX49662.1| Peptidase M23 [Escherichia coli KO11]
 gi|323935701|gb|EGB32015.1| peptidase M23 [Escherichia coli E1520]
 gi|323941427|gb|EGB37610.1| peptidase M23 [Escherichia coli E482]
 gi|323946372|gb|EGB42400.1| peptidase M23 [Escherichia coli H120]
 gi|323960598|gb|EGB56224.1| peptidase M23 [Escherichia coli H489]
 gi|323971529|gb|EGB66762.1| peptidase M23 [Escherichia coli TA007]
 gi|324119996|gb|EGC13874.1| peptidase M23 [Escherichia coli E1167]
 gi|331036899|gb|EGI09123.1| lipoprotein NlpD [Escherichia coli H736]
          Length = 379

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|82545185|ref|YP_409132.1| lipoprotein NlpD [Shigella boydii Sb227]
 gi|187730414|ref|YP_001881515.1| lipoprotein NlpD [Shigella boydii CDC 3083-94]
 gi|81246596|gb|ABB67304.1| lipoprotein [Shigella boydii Sb227]
 gi|187427406|gb|ACD06680.1| lipoprotein NlpD [Shigella boydii CDC 3083-94]
 gi|320173408|gb|EFW48607.1| Lipoprotein NlpD [Shigella dysenteriae CDC 74-1112]
 gi|320186526|gb|EFW61254.1| Lipoprotein NlpD [Shigella flexneri CDC 796-83]
          Length = 363

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 284 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 342

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 343 LHFEIRYKGKSVNPLRYLPQR 363


>gi|126659783|ref|ZP_01730910.1| lipoprotein; NlpD [Cyanothece sp. CCY0110]
 gi|126618935|gb|EAZ89677.1| lipoprotein; NlpD [Cyanothece sp. CCY0110]
          Length = 192

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/85 (38%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G     LG  + IRH D  V+VY H     V  GQ V RG  I   G +G +  P
Sbjct: 96  VVVFAGWSNKGLGYQVSIRHPDGNVSVYGHNQRLLVTSGQTVERGQQIAEMGSTGFSTGP 155

Query: 61  QVHFELRKNA-IAMDPIKFLEEKIP 84
            +HFE+R N   A++PI FL  + P
Sbjct: 156 HLHFEIRPNGRKAVNPIAFLPGQRP 180


>gi|283786706|ref|YP_003366571.1| lipoprotein [Citrobacter rodentium ICC168]
 gi|282950160|emb|CBG89796.1| lipoprotein [Citrobacter rodentium ICC168]
          Length = 375

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 296 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 354

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 355 LHFEIRYKGKSVNPLRYLPQR 375


>gi|116329342|ref|YP_799062.1| metalloendopeptidase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116330055|ref|YP_799773.1| metalloendopeptidase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116122086|gb|ABJ80129.1| Metalloendopeptidase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116123744|gb|ABJ75015.1| Metalloendopeptidase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 372

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   GN ++I H D   T+Y+H    +VQ+G  V  G  I  SG +G +  P 
Sbjct: 284 VIYAGW-MGGYGNVVVIEHTDDFKTLYAHNSKLFVQRGDYVLAGKKIARSGSTGYSFGPH 342

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+ KN   ++P K+L+
Sbjct: 343 LHFEVIKNGKPVNPSKYLK 361


>gi|260869421|ref|YP_003235823.1| putative outer membrane lipoprotein NlpD [Escherichia coli O111:H-
           str. 11128]
 gi|257765777|dbj|BAI37272.1| predicted outer membrane lipoprotein NlpD [Escherichia coli O111:H-
           str. 11128]
 gi|323180168|gb|EFZ65720.1| lipoprotein nlpD [Escherichia coli 1180]
          Length = 379

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|22299392|ref|NP_682639.1| hypothetical protein tlr1849 [Thermosynechococcus elongatus BP-1]
 gi|22295575|dbj|BAC09401.1| tlr1849 [Thermosynechococcus elongatus BP-1]
          Length = 384

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      G T+++ H   + T+Y+H     V++GQ V +G  I   G +G +  P 
Sbjct: 308 VIFAGWS-GGYGQTVILDHGGGMTTLYAHAQRLLVREGQFVQQGQPIAEVGSTGLSTGPH 366

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N    +P+ +L
Sbjct: 367 LHFEVRLNGEPSNPLAYL 384


>gi|307625682|gb|ADN69986.1| lipoprotein NlpD [Escherichia coli UM146]
          Length = 379

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  VQ+ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVQEQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|320180824|gb|EFW55747.1| Lipoprotein NlpD [Shigella boydii ATCC 9905]
          Length = 379

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|224584702|ref|YP_002638500.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224469229|gb|ACN47059.1| lipoprotein [Salmonella enterica subsp. enterica serovar Paratyphi
           C strain RKS4594]
          Length = 315

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 236 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 294

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 295 LHFEIRYKGKSVNPLRYLPQR 315


>gi|324111375|gb|EGC05357.1| peptidase M23 [Escherichia fergusonii B253]
          Length = 380

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 301 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 359

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 360 LHFEIRYKGKSVNPLRYLPQR 380


>gi|194431819|ref|ZP_03064110.1| lipoprotein NlpD [Shigella dysenteriae 1012]
 gi|194420175|gb|EDX36253.1| lipoprotein NlpD [Shigella dysenteriae 1012]
          Length = 379

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|331648465|ref|ZP_08349553.1| lipoprotein NlpD [Escherichia coli M605]
 gi|330908778|gb|EGH37292.1| lipoprotein NlpD [Escherichia coli AA86]
 gi|331042212|gb|EGI14354.1| lipoprotein NlpD [Escherichia coli M605]
          Length = 379

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|146277890|ref|YP_001168049.1| peptidase M23B [Rhodobacter sphaeroides ATCC 17025]
 gi|145556131|gb|ABP70744.1| peptidase M23B [Rhodobacter sphaeroides ATCC 17025]
          Length = 446

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G      G  I IRHD  I TVY H+    V KGQ+VSRG  IG  G +G +   
Sbjct: 362 VVIQAGWA-SGYGRVIKIRHDFGIQTVYGHLSQIRVDKGQRVSRGDRIGDMGSTGRSTGT 420

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R +   ++P+ F++
Sbjct: 421 HLHYEVRVDGTPVNPMTFIK 440


>gi|209966278|ref|YP_002299193.1| peptidase M23 [Rhodospirillum centenum SW]
 gi|209959744|gb|ACJ00381.1| peptidase M23 [Rhodospirillum centenum SW]
          Length = 474

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 48/80 (60%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G D    G  +L+ H   I T Y+H+D   V+ GQ +++G T+G  G +G +Q P 
Sbjct: 388 VVFAGWDSGGYGRMVLVDHGFGINTRYAHLDKLMVKAGQSINQGDTVGTLGNTGRSQGPH 447

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +H+E+  +   ++P++F+E 
Sbjct: 448 LHYEVLVDGRPVNPLRFMER 467


>gi|253573895|ref|ZP_04851237.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251846372|gb|EES74378.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 515

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V +VG      GN I+I H +   T+Y H+    V+KGQ V +G  IG+ G +G +   
Sbjct: 438 VVSFVGTK-SGYGNCIIIDHKNGYETLYGHLSKISVKKGQIVEKGEKIGVMGSTGRSTGT 496

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+ KN    +P+K+L
Sbjct: 497 HLHFEIHKNGSIQNPLKYL 515


>gi|213417288|ref|ZP_03350432.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. E01-6750]
 gi|213425677|ref|ZP_03358427.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|213580999|ref|ZP_03362825.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-0664]
          Length = 315

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 236 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 294

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 295 LHFEIRYKGKSVNPLRYLPQR 315


>gi|306812376|ref|ZP_07446574.1| lipoprotein NlpD [Escherichia coli NC101]
 gi|305854414|gb|EFM54852.1| lipoprotein NlpD [Escherichia coli NC101]
          Length = 379

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|91212109|ref|YP_542095.1| lipoprotein NlpD [Escherichia coli UTI89]
 gi|91073683|gb|ABE08564.1| lipoprotein NlpD precursor [Escherichia coli UTI89]
          Length = 379

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|16130649|ref|NP_417222.1| activator of AmiC murein hydrolase activity, lipoprotein
           [Escherichia coli str. K-12 substr. MG1655]
 gi|30064099|ref|NP_838270.1| lipoprotein NlpD [Shigella flexneri 2a str. 2457T]
 gi|56480176|ref|NP_708547.2| lipoprotein NlpD [Shigella flexneri 2a str. 301]
 gi|74313308|ref|YP_311727.1| lipoprotein NlpD [Shigella sonnei Ss046]
 gi|82778109|ref|YP_404458.1| lipoprotein NlpD [Shigella dysenteriae Sd197]
 gi|89109529|ref|AP_003309.1| predicted outer membrane lipoprotein [Escherichia coli str. K-12
           substr. W3110]
 gi|110642883|ref|YP_670613.1| lipoprotein NlpD [Escherichia coli 536]
 gi|110806627|ref|YP_690147.1| lipoprotein NlpD [Shigella flexneri 5 str. 8401]
 gi|117624977|ref|YP_853965.1| lipoprotein NlpD [Escherichia coli APEC O1]
 gi|170082317|ref|YP_001731637.1| outer membrane lipoprotein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170679671|ref|YP_001744891.1| lipoprotein NlpD [Escherichia coli SMS-3-5]
 gi|188494507|ref|ZP_03001777.1| lipoprotein NlpD [Escherichia coli 53638]
 gi|191171266|ref|ZP_03032816.1| lipoprotein NlpD [Escherichia coli F11]
 gi|218555289|ref|YP_002388202.1| lipoprotein NlpD [Escherichia coli IAI1]
 gi|218559735|ref|YP_002392648.1| lipoprotein NlpD [Escherichia coli S88]
 gi|218690869|ref|YP_002399081.1| lipoprotein NlpD [Escherichia coli ED1a]
 gi|218701233|ref|YP_002408862.1| lipoprotein NlpD [Escherichia coli IAI39]
 gi|218706236|ref|YP_002413755.1| lipoprotein NlpD [Escherichia coli UMN026]
 gi|237706629|ref|ZP_04537110.1| lipoprotein NlpD [Escherichia sp. 3_2_53FAA]
 gi|238901879|ref|YP_002927675.1| putative outer membrane lipoprotein [Escherichia coli BW2952]
 gi|256019473|ref|ZP_05433338.1| lipoprotein NlpD [Shigella sp. D9]
 gi|293406234|ref|ZP_06650160.1| nlpD [Escherichia coli FVEC1412]
 gi|293412097|ref|ZP_06654820.1| nlpD [Escherichia coli B354]
 gi|293415988|ref|ZP_06658628.1| nlpD [Escherichia coli B185]
 gi|298381971|ref|ZP_06991568.1| nlpD [Escherichia coli FVEC1302]
 gi|301027335|ref|ZP_07190676.1| peptidase, M23 family [Escherichia coli MS 196-1]
 gi|332280595|ref|ZP_08393008.1| outer membrane lipoprotein [Shigella sp. D9]
 gi|83305830|sp|P0ADA3|NLPD_ECOLI RecName: Full=Lipoprotein nlpD; Flags: Precursor
 gi|83305831|sp|P0ADA4|NLPD_SHIFL RecName: Full=Lipoprotein nlpD; Flags: Precursor
 gi|433185|gb|AAA17875.1| lipoprotein precursor [Escherichia coli]
 gi|882635|gb|AAA69252.1| lipoprotein NlpD precursor [Escherichia coli str. K-12 substr.
           MG1655]
 gi|1789099|gb|AAC75784.1| activator of AmiC murein hydrolase activity, lipoprotein
           [Escherichia coli str. K-12 substr. MG1655]
 gi|30042355|gb|AAP18080.1| lipoprotein [Shigella flexneri 2a str. 2457T]
 gi|56383727|gb|AAN44254.2| lipoprotein [Shigella flexneri 2a str. 301]
 gi|73856785|gb|AAZ89492.1| lipoprotein [Shigella sonnei Ss046]
 gi|81242257|gb|ABB62967.1| lipoprotein [Shigella dysenteriae Sd197]
 gi|85675563|dbj|BAE76819.1| predicted outer membrane lipoprotein [Escherichia coli str. K12
           substr. W3110]
 gi|110344475|gb|ABG70712.1| lipoprotein NlpD precursor [Escherichia coli 536]
 gi|110616175|gb|ABF04842.1| lipoprotein [Shigella flexneri 5 str. 8401]
 gi|115514101|gb|ABJ02176.1| putative outer membrane lipoprotein [Escherichia coli APEC O1]
 gi|169890152|gb|ACB03859.1| predicted outer membrane lipoprotein [Escherichia coli str. K-12
           substr. DH10B]
 gi|170517389|gb|ACB15567.1| lipoprotein NlpD [Escherichia coli SMS-3-5]
 gi|188489706|gb|EDU64809.1| lipoprotein NlpD [Escherichia coli 53638]
 gi|190908566|gb|EDV68155.1| lipoprotein NlpD [Escherichia coli F11]
 gi|218362057|emb|CAQ99666.1| outer membrane lipoprotein [Escherichia coli IAI1]
 gi|218366504|emb|CAR04256.1| outer membrane lipoprotein [Escherichia coli S88]
 gi|218371219|emb|CAR19050.1| outer membrane lipoprotein [Escherichia coli IAI39]
 gi|218428433|emb|CAR09213.1| outer membrane lipoprotein [Escherichia coli ED1a]
 gi|218433333|emb|CAR14233.1| outer membrane lipoprotein [Escherichia coli UMN026]
 gi|222034439|emb|CAP77181.1| Lipoprotein nlpD [Escherichia coli LF82]
 gi|226899669|gb|EEH85928.1| lipoprotein NlpD [Escherichia sp. 3_2_53FAA]
 gi|238862709|gb|ACR64707.1| predicted outer membrane lipoprotein [Escherichia coli BW2952]
 gi|260448207|gb|ACX38629.1| Peptidase M23 [Escherichia coli DH1]
 gi|281602113|gb|ADA75097.1| Lipoprotein NlpD [Shigella flexneri 2002017]
 gi|284922678|emb|CBG35766.1| lipoprotein [Escherichia coli 042]
 gi|291426240|gb|EFE99272.1| nlpD [Escherichia coli FVEC1412]
 gi|291432177|gb|EFF05159.1| nlpD [Escherichia coli B185]
 gi|291468868|gb|EFF11359.1| nlpD [Escherichia coli B354]
 gi|294491833|gb|ADE90589.1| lipoprotein NlpD [Escherichia coli IHE3034]
 gi|298277111|gb|EFI18627.1| nlpD [Escherichia coli FVEC1302]
 gi|299879328|gb|EFI87539.1| peptidase, M23 family [Escherichia coli MS 196-1]
 gi|312947274|gb|ADR28101.1| lipoprotein NlpD [Escherichia coli O83:H1 str. NRG 857C]
 gi|315137349|dbj|BAJ44508.1| nlpD [Escherichia coli DH1]
 gi|320194881|gb|EFW69510.1| Lipoprotein NlpD [Escherichia coli WV_060327]
 gi|323188841|gb|EFZ74126.1| lipoprotein nlpD [Escherichia coli RN587/1]
 gi|323951036|gb|EGB46912.1| peptidase M23 [Escherichia coli H252]
 gi|323957043|gb|EGB52768.1| peptidase M23 [Escherichia coli H263]
 gi|332102947|gb|EGJ06293.1| outer membrane lipoprotein [Shigella sp. D9]
 gi|1090176|prf||2018294A lipoprotein
          Length = 379

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|310644288|ref|YP_003949047.1| peptidase m23b [Paenibacillus polymyxa SC2]
 gi|309249239|gb|ADO58806.1| Peptidase M23B [Paenibacillus polymyxa SC2]
          Length = 427

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSH--IDTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +VI         GNT++I H D + T+Y H       V  GQ V RG  I   G +GN+ 
Sbjct: 348 VVIVAEWW-SGYGNTVVIDHGDGLWTLYGHIRNGGTVVHTGQTVKRGQKIAEVGSTGNST 406

Query: 59  HPQVHFELRKNAIAMDPIKFL 79
            P  HFE+R+N   ++P+ +L
Sbjct: 407 GPHCHFEVRENNKPVNPMNYL 427


>gi|330008321|ref|ZP_08306196.1| lipoprotein NlpD [Klebsiella sp. MS 92-3]
 gi|328535179|gb|EGF61680.1| lipoprotein NlpD [Klebsiella sp. MS 92-3]
          Length = 328

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 249 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 307

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 308 LHFEIRYKGKSVNPLQYLPQR 328


>gi|303242119|ref|ZP_07328609.1| Peptidase M23 [Acetivibrio cellulolyticus CD2]
 gi|302590306|gb|EFL60064.1| Peptidase M23 [Acetivibrio cellulolyticus CD2]
          Length = 374

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GNT++I H   I T+Y+H     V  G+ V  G TI   G +G +  P 
Sbjct: 296 VIMAGWQ-SGYGNTVVIDHGGGITTLYAHCSKLLVSVGETVKAGETIAKVGSTGMSTGPH 354

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+RKN    DP++++ +
Sbjct: 355 LHFEVRKNGSTTDPLRYVSK 374


>gi|262367054|gb|ACY63611.1| lipoprotein nlpD [Yersinia pestis D182038]
          Length = 205

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 126 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 184

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 185 LHFEIRYKGKSVNPLRYLPQR 205


>gi|170765928|ref|ZP_02900739.1| lipoprotein NlpD [Escherichia albertii TW07627]
 gi|170125074|gb|EDS94005.1| lipoprotein NlpD [Escherichia albertii TW07627]
          Length = 386

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 307 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 365

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 366 LHFEIRYKGKSVNPLRYLPQR 386


>gi|158321812|ref|YP_001514319.1| peptidase M23B [Alkaliphilus oremlandii OhILAs]
 gi|158142011|gb|ABW20323.1| peptidase M23B [Alkaliphilus oremlandii OhILAs]
          Length = 511

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      GN ++I H++   T Y+H     + KG++V +G  I   G +GN+    
Sbjct: 433 VSFAGRQ-GSYGNLVIIDHENGYQTYYAHNSKIVINKGERVYKGQKIAEMGNTGNSTGVH 491

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+RKN   ++P  F+ 
Sbjct: 492 LHFEVRKNGTPVNPQSFVR 510


>gi|26249147|ref|NP_755187.1| lipoprotein NlpD [Escherichia coli CFT073]
 gi|227888285|ref|ZP_04006090.1| lipoprotein NlpD [Escherichia coli 83972]
 gi|26109554|gb|AAN81757.1|AE016765_159 Lipoprotein nlpD precursor [Escherichia coli CFT073]
 gi|227834554|gb|EEJ45020.1| lipoprotein NlpD [Escherichia coli 83972]
 gi|307554721|gb|ADN47496.1| lipoprotein NlpD precursor [Escherichia coli ABU 83972]
          Length = 379

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|281179748|dbj|BAI56078.1| lipoprotein [Escherichia coli SE15]
          Length = 379

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|110634139|ref|YP_674347.1| peptidase M23B [Mesorhizobium sp. BNC1]
 gi|110285123|gb|ABG63182.1| peptidase M23B [Chelativorans sp. BNC1]
          Length = 423

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    G  + + H + I T Y+H+    V+ G ++  G  IG  G SG +  P
Sbjct: 336 IVVEAGWN-GGYGRMVEVDHGNGIRTRYAHLSNVLVKIGDRIDNGGVIGRVGSSGRSTGP 394

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R+N   ++P K ++
Sbjct: 395 HLHYEIRQNHRPINPRKLIK 414


>gi|262041490|ref|ZP_06014688.1| lipoprotein NlpD [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|259041149|gb|EEW42222.1| lipoprotein NlpD [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 331

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 252 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 310

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 311 LHFEIRYKGKSVNPLQYLPQR 331


>gi|253575915|ref|ZP_04853249.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251844709|gb|EES72723.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 405

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 45/81 (55%), Gaps = 3/81 (3%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSH--IDTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +VI         GNT++I H D++ T+Y H       V+KGQKV +G  I   G +GN+ 
Sbjct: 326 VVIVAEWW-SGYGNTVIIDHGDNVWTLYGHIRNGGIKVEKGQKVKKGEKIAEVGSTGNST 384

Query: 59  HPQVHFELRKNAIAMDPIKFL 79
            P  HFE+R N   +DP+ +L
Sbjct: 385 GPHCHFEVRINGNPVDPMPYL 405


>gi|320160347|ref|YP_004173571.1| peptidase M23 family protein [Anaerolinea thermophila UNI-1]
 gi|319994200|dbj|BAJ62971.1| peptidase M23 family protein [Anaerolinea thermophila UNI-1]
          Length = 370

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 44/80 (55%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G      G  ++I H +   T+Y+H     V+ GQ VS+G  I  +G +GN+  P
Sbjct: 291 VVVYSGPIGGGYGLMVMIDHGNGFHTLYAHNSQLLVRCGQGVSKGQVIAYAGSTGNSTGP 350

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R     ++P+ +L 
Sbjct: 351 HLHFEIRYLGAFVNPLDYLR 370


>gi|161502016|ref|YP_001569128.1| lipoprotein NlpD [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160863363|gb|ABX19986.1| hypothetical protein SARI_00032 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 315

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 236 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 294

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 295 LHFEIRYKGKSVNPLRYLPQR 315


>gi|222086114|ref|YP_002544646.1| metalloendopeptidase protein [Agrobacterium radiobacter K84]
 gi|221723562|gb|ACM26718.1| metalloendopeptidase protein [Agrobacterium radiobacter K84]
          Length = 451

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      GN + I H D I T Y H++   V+ G  V  G  +GL+G +G +    
Sbjct: 354 VVSAGW-TGGYGNMVEIDHGDGISTRYGHMEELLVKAGDTVKTGDAVGLAGSTGRSTGTH 412

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R+N   +DP+ F+ 
Sbjct: 413 LHYEVRENGHPIDPMYFIN 431


>gi|225181174|ref|ZP_03734620.1| Peptidase M23 [Dethiobacter alkaliphilus AHT 1]
 gi|225168143|gb|EEG76948.1| Peptidase M23 [Dethiobacter alkaliphilus AHT 1]
          Length = 516

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G      G  + I H +  VT Y+H  +  V  GQ V RG  I   G +GN+  P 
Sbjct: 440 VTQAGWS-GGYGLMVTIDHGNGYVTRYAHNSSNQVSVGQTVQRGQQIARIGSTGNSTGPH 498

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+ +N   ++P++F 
Sbjct: 499 LHFEVLRNGSHVNPMQFF 516


>gi|218132756|ref|ZP_03461560.1| hypothetical protein BACPEC_00617 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992482|gb|EEC58485.1| hypothetical protein BACPEC_00617 [Bacteroides pectinophilus ATCC
           43243]
          Length = 551

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  + I+H + +++ Y H+ +  V  GQ V +   I  SG +G++  P 
Sbjct: 472 VVRAGW-YSGYGYCVDIQHANGVMSRYGHLSSIKVSVGQTVDQYDVIAYSGNTGDSTGPH 530

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R N  A++P+ ++ +
Sbjct: 531 LHFEIRINGTAVNPLNYVNK 550


>gi|172035636|ref|YP_001802137.1| peptidoglycan-binding M23B family peptidase [Cyanothece sp. ATCC
           51142]
 gi|171697090|gb|ACB50071.1| putative peptidoglycan-binding peptidase, M23B family [Cyanothece
           sp. ATCC 51142]
          Length = 685

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G +    GN + +RH D  VT+Y+H     V++GQKV +G  I   G +G +  P 
Sbjct: 603 VISAGWNSGGYGNLVKVRHPDGSVTLYAHNSRILVRRGQKVEQGQQIAEMGSTGYSTGPH 662

Query: 62  VHFELRKNAI-AMDPIKFLEE 81
           +H+E+  N   A +P+ FL +
Sbjct: 663 LHYEIHPNGRGAQNPMAFLPK 683


>gi|254466315|ref|ZP_05079726.1| peptidase M23B [Rhodobacterales bacterium Y4I]
 gi|206687223|gb|EDZ47705.1| peptidase M23B [Rhodobacterales bacterium Y4I]
          Length = 443

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + IRH   I T Y+H     V  GQ+VSRG  I   G +G +   
Sbjct: 359 VVTHAGWQ-SGYGKLVTIRHAFGIETRYAHNSKLRVTAGQRVSRGDHIADMGNTGRSTGT 417

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R N   ++P+ +++
Sbjct: 418 HLHYEVRVNGQPVNPMIYIK 437


>gi|319784082|ref|YP_004143558.1| peptidase M23 [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169970|gb|ADV13508.1| Peptidase M23 [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 434

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G +    G  + + H +   T Y H+    V  G+K+  G  IG +G SG +  P 
Sbjct: 348 VTKAGWN-GGYGRMVEVDHGNGFATRYGHLSEIDVTVGEKLDAGAVIGKTGSSGRSTGPH 406

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N  A+DP++FL
Sbjct: 407 LHYEVRHNGEAIDPLRFL 424


>gi|308071059|ref|YP_003872664.1| membrane protein [Paenibacillus polymyxa E681]
 gi|305860338|gb|ADM72126.1| Membrane protein [Paenibacillus polymyxa E681]
          Length = 427

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSH--IDTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +VI         GNT++I H D + T+Y H       V  GQ V RG  I   G +GN+ 
Sbjct: 348 VVIVAEWW-SGYGNTVVIDHGDGLWTLYGHIRNGGTVVHTGQTVKRGQKIAEVGSTGNST 406

Query: 59  HPQVHFELRKNAIAMDPIKFL 79
            P  HFE+R+N   ++P+ +L
Sbjct: 407 GPHCHFEVRENNKPVNPMNYL 427


>gi|161615846|ref|YP_001589810.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|161365210|gb|ABX68978.1| hypothetical protein SPAB_03638 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 327

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 248 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 306

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 307 LHFEIRYKGKSVNPLRYLPQR 327


>gi|215488062|ref|YP_002330493.1| lipoprotein NlpD [Escherichia coli O127:H6 str. E2348/69]
 gi|215266134|emb|CAS10560.1| predicted outer membrane lipoprotein [Escherichia coli O127:H6 str.
           E2348/69]
          Length = 379

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|205375566|ref|ZP_03228354.1| metalloprotease yebA precursor [Bacillus coahuilensis m4-4]
          Length = 484

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 44/78 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G D    GN ++I H++   T+Y+H+ +  V  GQ VS+G  +G  G +GN+    
Sbjct: 407 VVFAGWDSGGYGNKVIIDHNNGFRTLYAHLSSIDVSVGQTVSQGMKLGNIGATGNSTGVH 466

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H E+ KN   ++P  + 
Sbjct: 467 LHLEVTKNGSLVNPADYF 484


>gi|168749932|ref|ZP_02774954.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4113]
 gi|168755488|ref|ZP_02780495.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4401]
 gi|168768835|ref|ZP_02793842.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4486]
 gi|168774724|ref|ZP_02799731.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4196]
 gi|168778726|ref|ZP_02803733.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4076]
 gi|195939454|ref|ZP_03084836.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4024]
 gi|208806036|ref|ZP_03248373.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4206]
 gi|208814031|ref|ZP_03255360.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4045]
 gi|208821071|ref|ZP_03261391.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4042]
 gi|209400494|ref|YP_002272205.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4115]
 gi|254794682|ref|YP_003079519.1| lipoprotein NlpD [Escherichia coli O157:H7 str. TW14359]
 gi|187769624|gb|EDU33468.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4196]
 gi|188015835|gb|EDU53957.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4113]
 gi|189003514|gb|EDU72500.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4076]
 gi|189357376|gb|EDU75795.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4401]
 gi|189362066|gb|EDU80485.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4486]
 gi|208725837|gb|EDZ75438.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4206]
 gi|208735308|gb|EDZ83995.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4045]
 gi|208741194|gb|EDZ88876.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4042]
 gi|209161894|gb|ACI39327.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4115]
 gi|254594082|gb|ACT73443.1| predicted outer membrane lipoprotein [Escherichia coli O157:H7 str.
           TW14359]
          Length = 363

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 284 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 342

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 343 LHFEIRYKGKSVNPLRYLPQR 363


>gi|134036991|gb|ABO47832.1| putative outer membrane lipoprotein [Escherichia coli]
 gi|134037009|gb|ABO47844.1| putative outer membrane lipoprotein [Escherichia coli]
          Length = 181

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 102 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 160

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 161 LHFEIRYKGKSVNPLRYLPQR 181


>gi|126728579|ref|ZP_01744394.1| peptidase, M23/M37 family protein [Sagittula stellata E-37]
 gi|126710509|gb|EBA09560.1| peptidase, M23/M37 family protein [Sagittula stellata E-37]
          Length = 436

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G      G  + I+H+  I T Y+H+    V+ GQ+VSRG  IG  G +G +   
Sbjct: 352 VVVHAGWS-SGYGRLVKIQHEFGIETRYAHMSKIRVKVGQRVSRGQRIGDMGNTGRSTGT 410

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R     ++P+ +++
Sbjct: 411 HLHYEVRVGGKPVNPMIYIK 430


>gi|15803259|ref|NP_289291.1| lipoprotein NlpD [Escherichia coli O157:H7 EDL933]
 gi|15832850|ref|NP_311623.1| lipoprotein NlpD [Escherichia coli O157:H7 str. Sakai]
 gi|168762857|ref|ZP_02787864.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4501]
 gi|168787998|ref|ZP_02813005.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC869]
 gi|168800178|ref|ZP_02825185.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC508]
 gi|217327536|ref|ZP_03443619.1| lipoprotein NlpD [Escherichia coli O157:H7 str. TW14588]
 gi|261226036|ref|ZP_05940317.1| lipoprotein NlpD [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256707|ref|ZP_05949240.1| lipoprotein NlpD [Escherichia coli O157:H7 str. FRIK966]
 gi|291284069|ref|YP_003500887.1| Lipoprotein [Escherichia coli O55:H7 str. CB9615]
 gi|12517196|gb|AAG57849.1|AE005502_3 lipoprotein [Escherichia coli O157:H7 str. EDL933]
 gi|13363067|dbj|BAB37019.1| putative lipoprotein [Escherichia coli O157:H7 str. Sakai]
 gi|189366917|gb|EDU85333.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC4501]
 gi|189372137|gb|EDU90553.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC869]
 gi|189377501|gb|EDU95917.1| lipoprotein NlpD [Escherichia coli O157:H7 str. EC508]
 gi|217319903|gb|EEC28328.1| lipoprotein NlpD [Escherichia coli O157:H7 str. TW14588]
 gi|290763942|gb|ADD57903.1| Lipoprotein [Escherichia coli O55:H7 str. CB9615]
 gi|320189071|gb|EFW63730.1| Lipoprotein NlpD [Escherichia coli O157:H7 str. EC1212]
 gi|320640385|gb|EFX09924.1| lipoprotein NlpD [Escherichia coli O157:H7 str. G5101]
 gi|320645932|gb|EFX14913.1| lipoprotein NlpD [Escherichia coli O157:H- str. 493-89]
 gi|320651232|gb|EFX19667.1| lipoprotein NlpD [Escherichia coli O157:H- str. H 2687]
 gi|320656782|gb|EFX24670.1| lipoprotein NlpD [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320662324|gb|EFX29721.1| lipoprotein NlpD [Escherichia coli O55:H7 str. USDA 5905]
 gi|320667376|gb|EFX34334.1| lipoprotein NlpD [Escherichia coli O157:H7 str. LSU-61]
 gi|326339190|gb|EGD63005.1| Lipoprotein NlpD [Escherichia coli O157:H7 str. 1044]
 gi|326342927|gb|EGD66695.1| Lipoprotein NlpD [Escherichia coli O157:H7 str. 1125]
          Length = 379

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|168028139|ref|XP_001766586.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162682231|gb|EDQ68651.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 618

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      G  + I+H+   VT Y H    + + GQ+V +G  I   G +G A  P 
Sbjct: 540 VIFAGWS-GGYGYLVTIQHEGGFVTRYGHCCAIHSRVGQQVVKGQQIAAVGATGRATGPH 598

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+RKN  A+DP+K+++
Sbjct: 599 LHFEVRKNGEALDPLKWVQ 617


>gi|291303799|ref|YP_003515077.1| peptidase M23 [Stackebrandtia nassauensis DSM 44728]
 gi|290573019|gb|ADD45984.1| Peptidase M23 [Stackebrandtia nassauensis DSM 44728]
          Length = 269

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 40/81 (49%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G +    G  ++I H D + T Y+H     V +GQ V  G  I   G +GN+  P 
Sbjct: 170 VKSAGWNYGGFGQLVIIDHGDGVETYYAHNSQIAVAEGQWVKAGQQISSVGNTGNSFGPH 229

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFEL  +   +DP  +L E+
Sbjct: 230 LHFELHVDGEPVDPKPYLFER 250


>gi|332800515|ref|YP_004462014.1| peptidase M23 [Tepidanaerobacter sp. Re1]
 gi|332698250|gb|AEE92707.1| Peptidase M23 [Tepidanaerobacter sp. Re1]
          Length = 461

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      GN ++I H   I T Y+H  +  V  GQ+V +G  I   G +G A    
Sbjct: 383 VTFTGWQ-GGYGNLVIINHGGGIETYYAHNSSITVSVGQQVEKGQQIATVGSTGRASGNH 441

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           VHFE+R N  A++P+ +L +
Sbjct: 442 VHFEVRVNGSAINPLNYLNK 461


>gi|238909693|ref|ZP_04653530.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|321225599|gb|EFX50653.1| Lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
          Length = 319

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 240 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 298

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 299 LHFEIRYKGKSVNPLRYLPQR 319


>gi|311278283|ref|YP_003940514.1| Peptidase M23 [Enterobacter cloacae SCF1]
 gi|308747478|gb|ADO47230.1| Peptidase M23 [Enterobacter cloacae SCF1]
          Length = 372

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G SG +   +
Sbjct: 293 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSSGTSS-TR 351

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 352 LHFEIRYKGKSVNPLQYLPQR 372


>gi|259418607|ref|ZP_05742524.1| peptidase M23B [Silicibacter sp. TrichCH4B]
 gi|259344829|gb|EEW56683.1| peptidase M23B [Silicibacter sp. TrichCH4B]
          Length = 443

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I+H   I T Y+H     V+ GQ+VSRG  I   G +G +   
Sbjct: 359 VVTHAGWS-SGYGKLVKIQHAFGIETRYAHNSNLRVKVGQRVSRGDHIADMGTTGRSTGT 417

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R N   ++P+ +++
Sbjct: 418 HLHYEVRVNGKPVNPMIYIK 437


>gi|322628874|gb|EFY25657.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|323210116|gb|EFZ95019.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
          Length = 319

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 240 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 298

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 299 LHFEIRYKGKSVNPLRYLPQR 319


>gi|310823281|ref|YP_003955639.1| M23 peptidase domain-containing protein [Stigmatella aurantiaca
           DW4/3-1]
 gi|309396353|gb|ADO73812.1| M23 peptidase domain protein [Stigmatella aurantiaca DW4/3-1]
          Length = 303

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G +    GN I+I H   I T Y H+    V+ G KV RG  I   G +G +  P 
Sbjct: 224 VVFAGLE-GGYGNVIVIDHGYGIKTRYGHLAKMLVKAGDKVKRGSLIAAVGNTGRSTGPH 282

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N I  +P KF+
Sbjct: 283 LHYEVRVNGIPQNPRKFI 300


>gi|289579455|ref|YP_003478082.1| peptidase M23 [Thermoanaerobacter italicus Ab9]
 gi|289529168|gb|ADD03520.1| Peptidase M23 [Thermoanaerobacter italicus Ab9]
          Length = 451

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G +    G  + I H +  VT Y H     V+KG KV++G  I L G +G+A  P 
Sbjct: 373 VIFSGWE-SGYGYLVKIDHHNGYVTYYGHASKLLVKKGDKVAKGQKIALVGSTGHATGPH 431

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           VHFE+RKN + ++P+ +L  
Sbjct: 432 VHFEVRKNGVPVNPLPYLNR 451


>gi|218295048|ref|ZP_03495884.1| Peptidase M23 [Thermus aquaticus Y51MC23]
 gi|218244251|gb|EED10776.1| Peptidase M23 [Thermus aquaticus Y51MC23]
          Length = 394

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 40/79 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G      G  +++ H   + T+Y+H+    V+ GQ V  G  IG  G +G +  P 
Sbjct: 316 VQVAGWSSFGYGFHVVLDHGGGVETLYAHMSRIAVRPGQWVEAGDLIGYVGSTGWSTGPH 375

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N +  +P+ +L 
Sbjct: 376 LHFEVRVNGVPRNPLAYLP 394


>gi|150396690|ref|YP_001327157.1| peptidase M23B [Sinorhizobium medicae WSM419]
 gi|150028205|gb|ABR60322.1| peptidase M23B [Sinorhizobium medicae WSM419]
          Length = 442

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V  VG+     GN I I H + + T Y+H+ T  V  G++V     I  SG +G +  P
Sbjct: 353 IVTAVGSA-GGYGNMIEIDHGNGVSTRYAHLSTILVDVGEEVKADAVIAKSGSTGRSTGP 411

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R N   +DP +FL 
Sbjct: 412 HLHYEVRLNGRPVDPARFLR 431


>gi|271501816|ref|YP_003334842.1| Peptidase M23 [Dickeya dadantii Ech586]
 gi|270345371|gb|ACZ78136.1| Peptidase M23 [Dickeya dadantii Ech586]
          Length = 413

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H +T  V++ Q+V  G  I   G +G +   +
Sbjct: 334 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNETMLVREQQEVKAGQQIATMGSTGTSS-VR 392

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 393 LHFEIRYKGKSVNPLRFLPQR 413


>gi|99080930|ref|YP_613084.1| peptidase M23B [Ruegeria sp. TM1040]
 gi|99037210|gb|ABF63822.1| peptidase M23B [Ruegeria sp. TM1040]
          Length = 443

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I+H   I T Y+H     V+ GQ+VSRG  I   G +G +   
Sbjct: 359 VVTHAGWQ-SGYGRLVKIQHAFGIETRYAHNSNLRVKVGQRVSRGDHIADMGNTGRSTGT 417

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R N   ++P+ +++
Sbjct: 418 HLHYEVRVNGKPVNPMIYIK 437


>gi|307132340|ref|YP_003884356.1| putative outer membrane lipoprotein [Dickeya dadantii 3937]
 gi|306529869|gb|ADM99799.1| predicted outer membrane lipoprotein [Dickeya dadantii 3937]
          Length = 408

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H +T  V++ Q+V  G  I   G +G +   +
Sbjct: 329 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNETMLVREQQEVKAGQQIATMGSTGTSS-VR 387

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 388 LHFEIRYKGKSVNPLRFLPQR 408


>gi|156932760|ref|YP_001436676.1| lipoprotein NlpD [Cronobacter sakazakii ATCC BAA-894]
 gi|156531014|gb|ABU75840.1| hypothetical protein ESA_00549 [Cronobacter sakazakii ATCC BAA-894]
          Length = 322

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G SG +   +
Sbjct: 243 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSSGTSS-TR 301

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 302 LHFEIRYKGKSVNPLRYLPQR 322


>gi|332092026|gb|EGI97104.1| lipoprotein nlpD [Shigella boydii 3594-74]
          Length = 313

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 234 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 292

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 293 LHFEIRYKGKSVNPLRYLPQR 313


>gi|300815848|ref|ZP_07096072.1| peptidase, M23 family [Escherichia coli MS 107-1]
 gi|300919221|ref|ZP_07135744.1| peptidase, M23 family [Escherichia coli MS 115-1]
 gi|300922265|ref|ZP_07138391.1| peptidase, M23 family [Escherichia coli MS 182-1]
 gi|300930601|ref|ZP_07145993.1| peptidase, M23 family [Escherichia coli MS 187-1]
 gi|301326218|ref|ZP_07219601.1| peptidase, M23 family [Escherichia coli MS 78-1]
 gi|301645275|ref|ZP_07245226.1| peptidase, M23 family [Escherichia coli MS 146-1]
 gi|309795209|ref|ZP_07689628.1| peptidase, M23 family [Escherichia coli MS 145-7]
 gi|300413666|gb|EFJ96976.1| peptidase, M23 family [Escherichia coli MS 115-1]
 gi|300421395|gb|EFK04706.1| peptidase, M23 family [Escherichia coli MS 182-1]
 gi|300461543|gb|EFK25036.1| peptidase, M23 family [Escherichia coli MS 187-1]
 gi|300531777|gb|EFK52839.1| peptidase, M23 family [Escherichia coli MS 107-1]
 gi|300847063|gb|EFK74823.1| peptidase, M23 family [Escherichia coli MS 78-1]
 gi|301076440|gb|EFK91246.1| peptidase, M23 family [Escherichia coli MS 146-1]
 gi|308121180|gb|EFO58442.1| peptidase, M23 family [Escherichia coli MS 145-7]
 gi|323154964|gb|EFZ41156.1| lipoprotein nlpD [Escherichia coli EPECa14]
 gi|323159950|gb|EFZ45920.1| lipoprotein nlpD [Escherichia coli E128010]
 gi|323172965|gb|EFZ58596.1| lipoprotein nlpD [Escherichia coli LT-68]
 gi|324017013|gb|EGB86232.1| peptidase, M23 family [Escherichia coli MS 117-3]
 gi|332344624|gb|AEE57958.1| lipoprotein NlpD [Escherichia coli UMNK88]
          Length = 329

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|297545599|ref|YP_003677901.1| peptidase M23 [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
 gi|296843374|gb|ADH61890.1| Peptidase M23 [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
          Length = 451

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G +    G  + I H +  VT Y H     V+KG KV++G  I L G +G+A  P 
Sbjct: 373 VIFSGWE-SGYGYLVKIDHHNGYVTYYGHASKLLVKKGDKVAKGQKIALVGSTGHATGPH 431

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           VHFE+RKN + ++P+ +L  
Sbjct: 432 VHFEVRKNGVPVNPLPYLNR 451


>gi|114565815|ref|YP_752969.1| peptidase M23B [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114336750|gb|ABI67598.1| peptidase M23B [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 379

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIYVG  +   G   +I H + + T+Y+H     V+ G +VS+G  IG  G +G +  P 
Sbjct: 302 VIYVGW-MSGYGQVTVIDHGNGMSTLYAHQSAFLVKNGAQVSKGQAIGKVGSTGWSTGPH 360

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N   +DP  +++
Sbjct: 361 LHFEVRVNGSPVDPAGYVK 379


>gi|291278634|ref|YP_003495469.1| peptidase M23/M37 family [Deferribacter desulfuricans SSM1]
 gi|290753336|dbj|BAI79713.1| peptidase, M23/M37 family [Deferribacter desulfuricans SSM1]
          Length = 311

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G      G  + I H    VT Y+H     V+ GQ+V +G  I   G SG++  P
Sbjct: 227 IVIYAGYKP-GYGKLVTIDHGFGYVTRYAHNSKVLVKVGQRVEKGDIIAKVGSSGHSTGP 285

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VH+E+  N + ++P++F+ E
Sbjct: 286 HVHYEVLVNGVPVNPLEFINE 306


>gi|134037012|gb|ABO47846.1| putative outer membrane lipoprotein [Escherichia coli]
          Length = 181

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 102 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 160

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 161 LHFEIRYKGKSVNPLRYLPQR 181


>gi|115378602|ref|ZP_01465755.1| cell wall-binding protein associated metalloendopeptidase
           [Stigmatella aurantiaca DW4/3-1]
 gi|115364389|gb|EAU63471.1| cell wall-binding protein associated metalloendopeptidase
           [Stigmatella aurantiaca DW4/3-1]
          Length = 295

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G +    GN I+I H   I T Y H+    V+ G KV RG  I   G +G +  P 
Sbjct: 216 VVFAGLE-GGYGNVIVIDHGYGIKTRYGHLAKMLVKAGDKVKRGSLIAAVGNTGRSTGPH 274

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N I  +P KF+
Sbjct: 275 LHYEVRVNGIPQNPRKFI 292


>gi|238750590|ref|ZP_04612090.1| hypothetical protein yrohd0001_4180 [Yersinia rohdei ATCC 43380]
 gi|238711238|gb|EEQ03456.1| hypothetical protein yrohd0001_4180 [Yersinia rohdei ATCC 43380]
          Length = 327

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 248 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 306

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 307 LHFEIRYKGKSVNPLRYLPQR 327


>gi|237729724|ref|ZP_04560205.1| lipoprotein NlpD [Citrobacter sp. 30_2]
 gi|226908330|gb|EEH94248.1| lipoprotein NlpD [Citrobacter sp. 30_2]
          Length = 375

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q++  G  I   G +G +   +
Sbjct: 296 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEIKAGQKIATMGSTGTSS-TR 354

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 355 LHFEIRYKGKSVNPLRYLPQR 375


>gi|170692750|ref|ZP_02883912.1| peptidase M23B [Burkholderia graminis C4D1M]
 gi|170142406|gb|EDT10572.1| peptidase M23B [Burkholderia graminis C4D1M]
          Length = 345

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G +    GN + I H + ++T Y H     V  G  V     I   G +G +  P 
Sbjct: 260 VVFAG-EKSGYGNAVEIDHGNGLMTRYGHASRIVVHVGDLVLPRQYIADVGSTGRSTGPH 318

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+  N   +DP  +L
Sbjct: 319 LHFEVLVNGAPVDPAAYL 336


>gi|254476684|ref|ZP_05090070.1| peptidase M23B [Ruegeria sp. R11]
 gi|214030927|gb|EEB71762.1| peptidase M23B [Ruegeria sp. R11]
          Length = 443

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I+H   I T Y+H     V+ GQ+VSRG  I   G +G +   
Sbjct: 359 VVTHAGWQ-SGYGKLVTIKHAFGIETKYAHNSNLRVKVGQRVSRGDHIADMGNTGRSTGT 417

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R N   ++P+ +++
Sbjct: 418 HLHYEVRVNGQPVNPMIYIK 437


>gi|242238322|ref|YP_002986503.1| peptidase M23 [Dickeya dadantii Ech703]
 gi|242130379|gb|ACS84681.1| Peptidase M23 [Dickeya dadantii Ech703]
          Length = 401

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H +T  V++ Q+V  G  I   G +G +   +
Sbjct: 322 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNETMLVREQQEVKAGQQIATMGSTGTSS-VR 380

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 381 LHFEIRYKGKSVNPLRFLPQR 401


>gi|167036492|ref|YP_001664070.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|320114920|ref|YP_004185079.1| peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166855326|gb|ABY93734.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|319928011|gb|ADV78696.1| Peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 314

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G +    GN I I H+    T Y+H+    V+K QKV  G  IG  G +G +  P 
Sbjct: 237 VGYAGWN-GGYGNVIYITHNGGYETRYAHLSRIAVKKWQKVKAGDIIGYVGSTGKSTGPH 295

Query: 62  VHFELRKNAIAMDPIKF 78
           +HFE+R N  A+DP+ F
Sbjct: 296 LHFEIRINGQAVDPLGF 312


>gi|311693465|gb|ADP96338.1| peptidase M23B [marine bacterium HP15]
          Length = 317

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G +    GN + + H D ++T Y+H  T  V+ G  V +G  + L G +G +  P
Sbjct: 235 VVTYAG-ERYGYGNLVEVDHGDGLITRYAHCKTIKVKVGDVVQKGQVVALMGSTGRSTGP 293

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+ +N  + +P  +++ 
Sbjct: 294 HVHFEVIRNGKSENPETYIKR 314


>gi|293391442|ref|ZP_06635776.1| outer membrane antigenic lipoprotein B [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951976|gb|EFE02095.1| outer membrane antigenic lipoprotein B [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 389

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V+  Q++  G  I   G +G     +
Sbjct: 310 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDSILVKDQQEIKAGQQIAKMGSTG-TNGVK 368

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 369 LHFEIRYKGKSVDPLRYLPRR 389


>gi|261867083|ref|YP_003255005.1| outer membrane antigenic lipoprotein B [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412415|gb|ACX81786.1| outer membrane antigenic lipoprotein B [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 389

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V+  Q++  G  I   G +G     +
Sbjct: 310 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDSILVKDQQEIKAGQQIAKMGSTG-TNGVK 368

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 369 LHFEIRYKGKSVDPLRYLPRR 389


>gi|169824880|ref|YP_001692491.1| cell wall-binding protein [Finegoldia magna ATCC 29328]
 gi|167831685|dbj|BAG08601.1| cell wall-binding protein [Finegoldia magna ATCC 29328]
          Length = 407

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++VG      GN + ++HD+  +T Y H+       GQ+V RG  I   G +G +  P
Sbjct: 329 VVVHVGWS-GGYGNLVKVQHDNGALTYYGHLSGFNCSVGQRVKRGQLIAFIGSTGYSTGP 387

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N    DP+ +L 
Sbjct: 388 HLHFEVRFNGQHTDPLNYLR 407


>gi|182626086|ref|ZP_02953847.1| peptidase, M23/M37 family protein [Clostridium perfringens D str.
           JGS1721]
 gi|177908607|gb|EDT71128.1| peptidase, M23/M37 family protein [Clostridium perfringens D str.
           JGS1721]
          Length = 441

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G +    GN ++I H D   T+Y H     VQ GQ VS+G  I   G +G +  P 
Sbjct: 364 VVEAGWNTA-YGNMVIIDHGDGTSTLYGHSSRLAVQAGQHVSQGQVIAYVGSTGYSTGPH 422

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF +  N   ++P+ ++
Sbjct: 423 LHFGIMINGEWVNPMNYI 440


>gi|168217995|ref|ZP_02643620.1| peptidase, M23/M37 family protein [Clostridium perfringens NCTC
           8239]
 gi|182379986|gb|EDT77465.1| peptidase, M23/M37 family protein [Clostridium perfringens NCTC
           8239]
          Length = 441

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G +    GN ++I H D   T+Y H     VQ GQ VS+G  I   G +G +  P 
Sbjct: 364 VVEAGWNTA-YGNMVIIDHGDGTSTLYGHSSRLAVQAGQHVSQGQVIAYVGSTGYSTGPH 422

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF +  N   ++P+ ++
Sbjct: 423 LHFGIMINGEWVNPMNYI 440


>gi|168213583|ref|ZP_02639208.1| peptidase, M23/M37 family protein [Clostridium perfringens CPE str.
           F4969]
 gi|170714919|gb|EDT27101.1| peptidase, M23/M37 family protein [Clostridium perfringens CPE str.
           F4969]
          Length = 441

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G +    GN ++I H D   T+Y H     VQ GQ VS+G  I   G +G +  P 
Sbjct: 364 VVEAGWNTA-YGNMVIIDHGDGTSTLYGHSSRLAVQAGQHVSQGQVIAYVGSTGYSTGPH 422

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF +  N   ++P+ ++
Sbjct: 423 LHFGIMINGEWVNPMNYI 440


>gi|168209316|ref|ZP_02634941.1| peptidase, M23/M37 family protein [Clostridium perfringens B str.
           ATCC 3626]
 gi|170712559|gb|EDT24741.1| peptidase, M23/M37 family protein [Clostridium perfringens B str.
           ATCC 3626]
          Length = 441

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G +    GN ++I H D   T+Y H     VQ GQ VS+G  I   G +G +  P 
Sbjct: 364 VVEAGWNTA-YGNMVIIDHGDGTSTLYGHSSRLAVQAGQHVSQGQVIAYVGSTGYSTGPH 422

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF +  N   ++P+ ++
Sbjct: 423 LHFGIMINGEWVNPMNYI 440


>gi|168207170|ref|ZP_02633175.1| peptidase, M23/M37 family protein [Clostridium perfringens E str.
           JGS1987]
 gi|170661476|gb|EDT14159.1| peptidase, M23/M37 family protein [Clostridium perfringens E str.
           JGS1987]
          Length = 441

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G +    GN ++I H D   T+Y H     VQ GQ VS+G  I   G +G +  P 
Sbjct: 364 VVEAGWNTA-YGNMVIIDHGDGTSTLYGHSSRLAVQAGQHVSQGQVIAYVGSTGYSTGPH 422

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF +  N   ++P+ ++
Sbjct: 423 LHFGIMINGEWVNPMNYI 440


>gi|169342798|ref|ZP_02863832.1| peptidase, M23/M37 family protein [Clostridium perfringens C str.
           JGS1495]
 gi|169299055|gb|EDS81127.1| peptidase, M23/M37 family protein [Clostridium perfringens C str.
           JGS1495]
          Length = 441

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G +    GN ++I H D   T+Y H     VQ GQ VS+G  I   G +G +  P 
Sbjct: 364 VVEAGWNTA-YGNMVIIDHGDGTSTLYGHSSRLAVQAGQHVSQGQVIAYVGSTGYSTGPH 422

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF +  N   ++P+ ++
Sbjct: 423 LHFGIMINGEWVNPMNYI 440


>gi|110798595|ref|YP_696301.1| peptidase, M23/M37 family protein [Clostridium perfringens ATCC
           13124]
 gi|110673242|gb|ABG82229.1| peptidase, M23/M37 family protein [Clostridium perfringens ATCC
           13124]
          Length = 441

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G +    GN ++I H D   T+Y H     VQ GQ VS+G  I   G +G +  P 
Sbjct: 364 VVEAGWNTA-YGNMVIIDHGDGTSTLYGHSSRLAVQAGQHVSQGQVIAYVGSTGYSTGPH 422

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF +  N   ++P+ ++
Sbjct: 423 LHFGIMINGEWVNPMNYI 440


>gi|18310596|ref|NP_562530.1| cell wall-binding protein [Clostridium perfringens str. 13]
 gi|18145277|dbj|BAB81320.1| probable cell wall-binding protein [Clostridium perfringens str.
           13]
          Length = 441

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G +    GN ++I H D   T+Y H     VQ GQ VS+G  I   G +G +  P 
Sbjct: 364 VVEAGWNTA-YGNMVIIDHGDGTSTLYGHSSRLAVQAGQHVSQGQVIAYVGSTGYSTGPH 422

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF +  N   ++P+ ++
Sbjct: 423 LHFGIMINGEWVNPMNYI 440


>gi|291570565|dbj|BAI92837.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 721

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ G +    GN + + H D  VT+Y+H     V KGQ+V++G  I   G +G +  P
Sbjct: 639 VVIFSGWNSGGYGNLVELEHPDGSVTLYAHNHRILVSKGQRVTQGQLIAEMGSTGFSTGP 698

Query: 61  QVHFELRKNAI-AMDPIKFLEE 81
            +HFE+      A++P+  L  
Sbjct: 699 HLHFEIHPTGNGAVNPMALLSR 720


>gi|284053208|ref|ZP_06383418.1| peptidase M23B [Arthrospira platensis str. Paraca]
          Length = 701

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ G +    GN + + H D  VT+Y+H     V KGQ+V++G  I   G +G +  P
Sbjct: 619 VVIFSGWNSGGYGNLVELEHPDGSVTLYAHNHRILVSKGQRVTQGQLIAEMGSTGFSTGP 678

Query: 61  QVHFELRKNAI-AMDPIKFLEE 81
            +HFE+      A++P+  L  
Sbjct: 679 HLHFEIHPTGNGAVNPMALLSR 700


>gi|332087628|gb|EGI92755.1| lipoprotein nlpD [Shigella dysenteriae 155-74]
          Length = 329

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|206900557|ref|YP_002250823.1| peptidase M23/M37 [Dictyoglomus thermophilum H-6-12]
 gi|206739660|gb|ACI18718.1| peptidase M23/M37 [Dictyoglomus thermophilum H-6-12]
          Length = 280

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           +I+ G      GN ++I H   I TVY H+     + G++++ G  IG  G +G +  P 
Sbjct: 202 IIFAGW-YGGYGNMVIIDHGGKISTVYGHLSKIVARVGEEIAEGDIIGYVGTTGLSTGPH 260

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N   +DP+ +L
Sbjct: 261 LHFEVRVNGDPVDPLSWL 278


>gi|300941125|ref|ZP_07155637.1| peptidase, M23 family [Escherichia coli MS 21-1]
 gi|300454168|gb|EFK17661.1| peptidase, M23 family [Escherichia coli MS 21-1]
          Length = 329

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|332087477|gb|EGI92605.1| lipoprotein nlpD [Shigella boydii 5216-82]
          Length = 329

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|296104426|ref|YP_003614572.1| putative lipoprotein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295058885|gb|ADF63623.1| putative lipoprotein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 315

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 236 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 294

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 295 LHFEIRYKGKSVNPLQYLPQR 315


>gi|288550339|ref|ZP_05970048.2| lipoprotein NlpD [Enterobacter cancerogenus ATCC 35316]
 gi|288315523|gb|EFC54461.1| lipoprotein NlpD [Enterobacter cancerogenus ATCC 35316]
          Length = 323

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 244 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 302

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 303 LHFEIRYKGKSVNPLQYLPQR 323


>gi|300820523|ref|ZP_07100674.1| peptidase, M23 family [Escherichia coli MS 119-7]
 gi|300899983|ref|ZP_07118186.1| peptidase, M23 family [Escherichia coli MS 198-1]
 gi|300906753|ref|ZP_07124435.1| peptidase, M23 family [Escherichia coli MS 84-1]
 gi|300946979|ref|ZP_07161205.1| peptidase, M23 family [Escherichia coli MS 116-1]
 gi|300954985|ref|ZP_07167396.1| peptidase, M23 family [Escherichia coli MS 175-1]
 gi|300976232|ref|ZP_07173329.1| peptidase, M23 family [Escherichia coli MS 200-1]
 gi|301027158|ref|ZP_07190527.1| peptidase, M23 family [Escherichia coli MS 69-1]
 gi|301306157|ref|ZP_07212233.1| peptidase, M23 family [Escherichia coli MS 124-1]
 gi|309786169|ref|ZP_07680797.1| lipoprotein nlpD [Shigella dysenteriae 1617]
 gi|312964992|ref|ZP_07779232.1| lipoprotein nlpD [Escherichia coli 2362-75]
 gi|300308577|gb|EFJ63097.1| peptidase, M23 family [Escherichia coli MS 200-1]
 gi|300318077|gb|EFJ67861.1| peptidase, M23 family [Escherichia coli MS 175-1]
 gi|300356492|gb|EFJ72362.1| peptidase, M23 family [Escherichia coli MS 198-1]
 gi|300395190|gb|EFJ78728.1| peptidase, M23 family [Escherichia coli MS 69-1]
 gi|300401447|gb|EFJ84985.1| peptidase, M23 family [Escherichia coli MS 84-1]
 gi|300453366|gb|EFK16986.1| peptidase, M23 family [Escherichia coli MS 116-1]
 gi|300526787|gb|EFK47856.1| peptidase, M23 family [Escherichia coli MS 119-7]
 gi|300838589|gb|EFK66349.1| peptidase, M23 family [Escherichia coli MS 124-1]
 gi|308925914|gb|EFP71393.1| lipoprotein nlpD [Shigella dysenteriae 1617]
 gi|312290548|gb|EFR18428.1| lipoprotein nlpD [Escherichia coli 2362-75]
 gi|313647808|gb|EFS12254.1| lipoprotein nlpD [Shigella flexneri 2a str. 2457T]
 gi|315254526|gb|EFU34494.1| peptidase, M23 family [Escherichia coli MS 85-1]
 gi|315289256|gb|EFU48651.1| peptidase, M23 family [Escherichia coli MS 110-3]
 gi|315298765|gb|EFU58019.1| peptidase, M23 family [Escherichia coli MS 16-3]
 gi|323167242|gb|EFZ52959.1| lipoprotein nlpD [Shigella sonnei 53G]
 gi|324005708|gb|EGB74927.1| peptidase, M23 family [Escherichia coli MS 57-2]
 gi|324015518|gb|EGB84737.1| peptidase, M23 family [Escherichia coli MS 60-1]
 gi|332753599|gb|EGJ83978.1| lipoprotein nlpD [Shigella flexneri K-671]
 gi|332755683|gb|EGJ86046.1| lipoprotein nlpD [Shigella flexneri 2747-71]
 gi|332765695|gb|EGJ95908.1| nlpD putative outer membrane lipoprotein [Shigella flexneri
           2930-71]
 gi|333001094|gb|EGK20664.1| lipoprotein nlpD [Shigella flexneri K-272]
 gi|333015401|gb|EGK34740.1| lipoprotein nlpD [Shigella flexneri K-227]
 gi|333015737|gb|EGK35075.1| lipoprotein nlpD [Shigella flexneri K-304]
          Length = 329

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|90412103|ref|ZP_01220110.1| hypothetical lipoprotein NlpD [Photobacterium profundum 3TCK]
 gi|90327081|gb|EAS43460.1| hypothetical lipoprotein NlpD [Photobacterium profundum 3TCK]
          Length = 306

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H D  ++ Y+H D   V++ Q V  G  I   G SG +   +
Sbjct: 227 VVYAGNALRGYGNLIIIKHSDDYLSAYAHNDKMLVKEQQTVKAGQKIASMGSSGTSS-VR 285

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L +K
Sbjct: 286 LHFEIRYKGKSVDPMRYLPKK 306


>gi|22124744|ref|NP_668167.1| lipoprotein NlpD [Yersinia pestis KIM 10]
 gi|45440188|ref|NP_991727.1| lipoprotein NlpD [Yersinia pestis biovar Microtus str. 91001]
 gi|108808778|ref|YP_652694.1| lipoprotein NlpD [Yersinia pestis Antiqua]
 gi|108810902|ref|YP_646669.1| lipoprotein NlpD [Yersinia pestis Nepal516]
 gi|145600261|ref|YP_001164337.1| lipoprotein NlpD [Yersinia pestis Pestoides F]
 gi|153997600|ref|ZP_02022700.1| lipoprotein [Yersinia pestis CA88-4125]
 gi|218930374|ref|YP_002348249.1| lipoprotein NlpD [Yersinia pestis CO92]
 gi|229838983|ref|ZP_04459142.1| predicted outer membrane lipoprotein [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229896463|ref|ZP_04511631.1| predicted outer membrane lipoprotein [Yersinia pestis Pestoides A]
 gi|229899550|ref|ZP_04514691.1| predicted outer membrane lipoprotein [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229901115|ref|ZP_04516238.1| predicted outer membrane lipoprotein [Yersinia pestis Nepal516]
 gi|21957563|gb|AAM84418.1|AE013686_1 lipoprotein [Yersinia pestis KIM 10]
 gi|45435044|gb|AAS60604.1| lipoprotein [Yersinia pestis biovar Microtus str. 91001]
 gi|108774550|gb|ABG17069.1| lipoprotein [Yersinia pestis Nepal516]
 gi|108780691|gb|ABG14749.1| lipoprotein [Yersinia pestis Antiqua]
 gi|115348985|emb|CAL21945.1| lipoprotein [Yersinia pestis CO92]
 gi|145211957|gb|ABP41364.1| lipoprotein [Yersinia pestis Pestoides F]
 gi|149289237|gb|EDM39317.1| lipoprotein [Yersinia pestis CA88-4125]
 gi|224483371|gb|ACN50512.1| NlpD [Yersinia pestis]
 gi|229681840|gb|EEO77933.1| predicted outer membrane lipoprotein [Yersinia pestis Nepal516]
 gi|229687042|gb|EEO79117.1| predicted outer membrane lipoprotein [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229695349|gb|EEO85396.1| predicted outer membrane lipoprotein [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229700537|gb|EEO88568.1| predicted outer membrane lipoprotein [Yersinia pestis Pestoides A]
 gi|320016551|gb|ADW00123.1| putative outer membrane lipoprotein [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 333

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 254 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 312

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 313 LHFEIRYKGKSVNPLRYLPQR 333


>gi|332999495|gb|EGK19080.1| lipoprotein nlpD [Shigella flexneri VA-6]
          Length = 329

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|331654220|ref|ZP_08355220.1| lipoprotein NlpD [Escherichia coli M718]
 gi|331658856|ref|ZP_08359798.1| lipoprotein NlpD [Escherichia coli TA206]
 gi|331664298|ref|ZP_08365204.1| lipoprotein NlpD [Escherichia coli TA143]
 gi|331669481|ref|ZP_08370327.1| lipoprotein NlpD [Escherichia coli TA271]
 gi|331674248|ref|ZP_08375008.1| lipoprotein NlpD [Escherichia coli TA280]
 gi|331678722|ref|ZP_08379396.1| lipoprotein NlpD [Escherichia coli H591]
 gi|331684361|ref|ZP_08384953.1| lipoprotein NlpD [Escherichia coli H299]
 gi|331047602|gb|EGI19679.1| lipoprotein NlpD [Escherichia coli M718]
 gi|331053438|gb|EGI25467.1| lipoprotein NlpD [Escherichia coli TA206]
 gi|331058229|gb|EGI30210.1| lipoprotein NlpD [Escherichia coli TA143]
 gi|331063149|gb|EGI35062.1| lipoprotein NlpD [Escherichia coli TA271]
 gi|331068342|gb|EGI39737.1| lipoprotein NlpD [Escherichia coli TA280]
 gi|331073552|gb|EGI44873.1| lipoprotein NlpD [Escherichia coli H591]
 gi|331077976|gb|EGI49182.1| lipoprotein NlpD [Escherichia coli H299]
          Length = 321

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 242 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 300

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 301 LHFEIRYKGKSVNPLRYLPQR 321


>gi|300976794|ref|ZP_07173611.1| peptidase, M23 family [Escherichia coli MS 45-1]
 gi|301049495|ref|ZP_07196453.1| peptidase, M23 family [Escherichia coli MS 185-1]
 gi|300298726|gb|EFJ55111.1| peptidase, M23 family [Escherichia coli MS 185-1]
 gi|300409980|gb|EFJ93518.1| peptidase, M23 family [Escherichia coli MS 45-1]
 gi|315293696|gb|EFU53048.1| peptidase, M23 family [Escherichia coli MS 153-1]
          Length = 329

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|11036546|gb|AAG27176.1|AF270497_1 lipoprotein [Escherichia coli]
          Length = 176

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 97  VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 155

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 156 LHFEIRYKGKSVNPLRYLPQR 176


>gi|260881508|ref|ZP_05404577.2| peptidase, M23B family [Mitsuokella multacida DSM 20544]
 gi|260848619|gb|EEX68626.1| peptidase, M23B family [Mitsuokella multacida DSM 20544]
          Length = 378

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  +   GNT++I H   I T+Y H  +  V  GQ VS+G  I   G +GN+  P 
Sbjct: 302 VEYAGW-VSGYGNTVIINHGGGITTLYGHNQSLAVSAGQSVSQGQVISYCGSTGNSTGPH 360

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R+N   + P  +L
Sbjct: 361 CHFEVRQNGEPVSPYSYL 378


>gi|134036994|gb|ABO47834.1| putative outer membrane lipoprotein [Escherichia coli]
 gi|134036997|gb|ABO47836.1| putative outer membrane lipoprotein [Escherichia coli]
 gi|134037000|gb|ABO47838.1| putative outer membrane lipoprotein [Escherichia coli]
 gi|134037003|gb|ABO47840.1| putative outer membrane lipoprotein [Escherichia coli]
 gi|134037006|gb|ABO47842.1| putative outer membrane lipoprotein [Escherichia coli]
          Length = 181

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 102 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 160

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 161 LHFEIRYKGKSVNPLRYLPQR 181


>gi|238758206|ref|ZP_04619385.1| hypothetical protein yaldo0001_26160 [Yersinia aldovae ATCC 35236]
 gi|238703536|gb|EEP96074.1| hypothetical protein yaldo0001_26160 [Yersinia aldovae ATCC 35236]
          Length = 322

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 243 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 301

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 302 LHFEIRYKGKSVNPLRYLPQR 322


>gi|126739331|ref|ZP_01755024.1| peptidase, M23/M37 family protein [Roseobacter sp. SK209-2-6]
 gi|126719431|gb|EBA16140.1| peptidase, M23/M37 family protein [Roseobacter sp. SK209-2-6]
          Length = 444

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I+H   I T Y+H     V+ GQ+VSRG  I   G +G +   
Sbjct: 360 VVTHAGWQ-SGYGKLVTIQHAFGIETKYAHNSNLRVKVGQRVSRGDHIADMGNTGRSTGT 418

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R N   ++P+ +++
Sbjct: 419 HLHYEVRVNGKPINPMIYIK 438


>gi|332753465|gb|EGJ83845.1| lipoprotein nlpD [Shigella flexneri 4343-70]
 gi|332999976|gb|EGK19559.1| lipoprotein nlpD [Shigella flexneri K-218]
          Length = 329

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|209523631|ref|ZP_03272185.1| Peptidase M23 [Arthrospira maxima CS-328]
 gi|209496036|gb|EDZ96337.1| Peptidase M23 [Arthrospira maxima CS-328]
          Length = 725

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ G +    GN + + H D  VT+Y+H     V KGQKV++G  I   G +G +  P
Sbjct: 643 VVIFSGWNSGGYGNLVELEHPDGSVTLYAHNHRNLVSKGQKVTQGQLIAEMGSTGFSTGP 702

Query: 61  QVHFELRKNAI-AMDPIKFLEE 81
            +HFE+      A++P+  L  
Sbjct: 703 HLHFEIHPTGNGAVNPMALLSR 724


>gi|123441127|ref|YP_001005115.1| lipoprotein NlpD [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|122088088|emb|CAL10876.1| lipoprotein [Yersinia enterocolitica subsp. enterocolitica 8081]
          Length = 327

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 248 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 306

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 307 LHFEIRYKGKSVNPLRYLPQR 327


>gi|119387178|ref|YP_918233.1| peptidase M23B [Paracoccus denitrificans PD1222]
 gi|119377773|gb|ABL72537.1| peptidase M23B [Paracoccus denitrificans PD1222]
          Length = 491

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GN I I+H+    T Y H+    V+ GQKVSRG  IG  G +G +    
Sbjct: 408 VIFAGWQ-RGYGNLIKIQHELGTETRYGHLSKIRVKAGQKVSRGSQIGDMGNTGRSTGSH 466

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R N  A++P+ F++
Sbjct: 467 LHYEVRVNGRAVNPMSFIK 485


>gi|260426626|ref|ZP_05780605.1| peptidase, M23/M37 family [Citreicella sp. SE45]
 gi|260421118|gb|EEX14369.1| peptidase, M23/M37 family [Citreicella sp. SE45]
          Length = 394

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G  +   G  + I+H+  I T Y+H+    V+ GQ+VSRG  +G  G +G +   
Sbjct: 310 VVTHAGW-MSGYGRLVKIQHEFGIETRYAHMSKIRVKVGQRVSRGDQVGDMGNTGRSTGT 368

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R    A++P+ +++
Sbjct: 369 HLHYEVRVGGKAVNPMTYIK 388


>gi|238761663|ref|ZP_04622638.1| hypothetical protein ykris0001_11430 [Yersinia kristensenii ATCC
           33638]
 gi|238700177|gb|EEP92919.1| hypothetical protein ykris0001_11430 [Yersinia kristensenii ATCC
           33638]
          Length = 321

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 242 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 300

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 301 LHFEIRYKGKSVNPLRYLPQR 321


>gi|162419853|ref|YP_001605523.1| lipoprotein NlpD [Yersinia pestis Angola]
 gi|165925754|ref|ZP_02221586.1| lipoprotein nlpD [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165936668|ref|ZP_02225235.1| lipoprotein nlpD [Yersinia pestis biovar Orientalis str. IP275]
 gi|166010173|ref|ZP_02231071.1| lipoprotein nlpD [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166213138|ref|ZP_02239173.1| lipoprotein nlpD [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167399591|ref|ZP_02305115.1| lipoprotein nlpD [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167421505|ref|ZP_02313258.1| lipoprotein nlpD [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167423088|ref|ZP_02314841.1| lipoprotein nlpD [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|270489293|ref|ZP_06206367.1| peptidase, M23 family [Yersinia pestis KIM D27]
 gi|294505064|ref|YP_003569126.1| lipoprotein nlpD [Yersinia pestis Z176003]
 gi|162352668|gb|ABX86616.1| lipoprotein nlpD [Yersinia pestis Angola]
 gi|165915317|gb|EDR33927.1| lipoprotein nlpD [Yersinia pestis biovar Orientalis str. IP275]
 gi|165922366|gb|EDR39543.1| lipoprotein nlpD [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165991080|gb|EDR43381.1| lipoprotein nlpD [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166205925|gb|EDR50405.1| lipoprotein nlpD [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166960424|gb|EDR56445.1| lipoprotein nlpD [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167052095|gb|EDR63503.1| lipoprotein nlpD [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167057258|gb|EDR67004.1| lipoprotein nlpD [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|262363124|gb|ACY59845.1| lipoprotein nlpD [Yersinia pestis D106004]
 gi|270337797|gb|EFA48574.1| peptidase, M23 family [Yersinia pestis KIM D27]
 gi|294355523|gb|ADE65864.1| lipoprotein nlpD [Yersinia pestis Z176003]
          Length = 327

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 248 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 306

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 307 LHFEIRYKGKSVNPLRYLPQR 327


>gi|238791264|ref|ZP_04634903.1| hypothetical protein yinte0001_30170 [Yersinia intermedia ATCC
           29909]
 gi|238729397|gb|EEQ20912.1| hypothetical protein yinte0001_30170 [Yersinia intermedia ATCC
           29909]
          Length = 321

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 242 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 300

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 301 LHFEIRYKGKSVNPLRYLPQR 321


>gi|256822091|ref|YP_003146054.1| peptidase M23 [Kangiella koreensis DSM 16069]
 gi|256795630|gb|ACV26286.1| Peptidase M23 [Kangiella koreensis DSM 16069]
          Length = 334

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN ++I+H++  ++ Y+H     V++ + +  G  I   G + ++  P+
Sbjct: 255 VVYAGRGLRGYGNLVIIKHNNDFISAYAHNRILLVKENEIIKAGQKIAEVGNT-DSDVPK 313

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R     +DP+++L ++
Sbjct: 314 LHFEIRFKGKPVDPMRYLPKR 334


>gi|254461829|ref|ZP_05075245.1| peptidase, M23/M37 family [Rhodobacterales bacterium HTCC2083]
 gi|206678418|gb|EDZ42905.1| peptidase, M23/M37 family [Rhodobacteraceae bacterium HTCC2083]
          Length = 433

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ G  L   G  + I+H   I T Y+H+    V+ GQ+VSRG  IG  G +G +   
Sbjct: 349 VVIHAGW-LSGYGKLVKIQHQFGIETRYAHLSKFRVKVGQRVSRGQRIGDMGNTGRSTGT 407

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R    A++P+ +++
Sbjct: 408 HLHYEVRVGGKAVNPMIYIK 427


>gi|329296049|ref|ZP_08253385.1| lipoprotein NlpD [Plautia stali symbiont]
          Length = 374

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 295 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 353

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 354 LHFEIRYKGKSVNPLRYLPQR 374


>gi|114569854|ref|YP_756534.1| peptidase M23B [Maricaulis maris MCS10]
 gi|114340316|gb|ABI65596.1| peptidase M23B [Maricaulis maris MCS10]
          Length = 413

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G      G T+ I H    VT Y+H+    V++G  V RG  IG  G +G +    
Sbjct: 328 VIYAGWR-GGYGRTVEIDHGYGFVTRYAHLHEIDVRRGDTVERGQRIGGMGSTGRSTATH 386

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+  N  A+DP + L 
Sbjct: 387 LHYEVWYNGSAIDPERLLR 405


>gi|51595125|ref|YP_069316.1| lipoprotein NlpD [Yersinia pseudotuberculosis IP 32953]
 gi|51588407|emb|CAH20015.1| lipoprotein [Yersinia pseudotuberculosis IP 32953]
          Length = 333

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 254 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 312

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 313 LHFEIRYKGKSVNPLRYLPQR 333


>gi|187920572|ref|YP_001889604.1| peptidase M23 [Burkholderia phytofirmans PsJN]
 gi|187719010|gb|ACD20233.1| Peptidase M23 [Burkholderia phytofirmans PsJN]
          Length = 332

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G +    GN + I H + ++T Y H     V  G  V     I   G +G +  P 
Sbjct: 247 VVYAG-EKSGYGNAVEIDHGNGLMTRYGHASRIVVHVGDLVLPRQYIADVGSTGRSTGPH 305

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+  +   ++P  +L
Sbjct: 306 LHFEVLVDGAPVNPAAYL 323


>gi|326204859|ref|ZP_08194712.1| Peptidase M23 [Clostridium papyrosolvens DSM 2782]
 gi|325984908|gb|EGD45751.1| Peptidase M23 [Clostridium papyrosolvens DSM 2782]
          Length = 283

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/83 (38%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G      GN +++ H +   TVY H     V+ GQ V +G  I L G +G +  P 
Sbjct: 200 VIYAG-LSGGYGNHVIVDHGNGFKTVYGHSSKLLVKAGQIVKKGQKIALVGSTGRSTGPH 258

Query: 62  VHFELRKNAIAMDPIKFLEEKIP 84
           +HFE+R    A+DP+K++E K P
Sbjct: 259 LHFEIRIADTAVDPVKYVEFKPP 281


>gi|149914720|ref|ZP_01903250.1| peptidase, M23/M37 family protein [Roseobacter sp. AzwK-3b]
 gi|149811513|gb|EDM71348.1| peptidase, M23/M37 family protein [Roseobacter sp. AzwK-3b]
          Length = 437

 Score =  100 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 47/80 (58%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ G  L   G  + I+H+  I T Y+H+    V +GQ+VSRG  IG  G +G +   
Sbjct: 353 VVIHAGW-LSGYGRLVKIKHEFGIETRYAHLSKIRVTEGQRVSRGERIGDMGNTGRSTGT 411

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R    A++P+ +++
Sbjct: 412 HLHYEVRVGGKAVNPMIYIK 431


>gi|167646541|ref|YP_001684204.1| peptidase M23B [Caulobacter sp. K31]
 gi|167348971|gb|ABZ71706.1| peptidase M23B [Caulobacter sp. K31]
          Length = 384

 Score =  100 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + I H +   T Y+H+    V+ GQ+V+ G  I   G +G +  P
Sbjct: 297 VVSFTG-VRSGYGNVVEIDHGNGFKTRYAHLQATSVKVGQRVAIGQRIAAMGSTGRSTGP 355

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+  N  A +P +FL+
Sbjct: 356 HLHYEVWVNGRAQNPNRFLK 375


>gi|83952640|ref|ZP_00961370.1| peptidase, M23/M37 family protein [Roseovarius nubinhibens ISM]
 gi|83835775|gb|EAP75074.1| peptidase, M23/M37 family protein [Roseovarius nubinhibens ISM]
          Length = 434

 Score =  100 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I+HD  I T Y+H    +V  GQ+VSRG  I   G +G +   
Sbjct: 350 VVTHAGWQ-SGYGRLVKIQHDFGIETRYAHNSKLFVTMGQRVSRGQKIAAMGNTGRSTGT 408

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R     ++P+ +++
Sbjct: 409 HLHYEVRVGGKPINPMIYIK 428


>gi|260424650|ref|ZP_05732812.2| peptidase, M23B family [Dialister invisus DSM 15470]
 gi|260402692|gb|EEW96239.1| peptidase, M23B family [Dialister invisus DSM 15470]
          Length = 372

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI         GN ++I H + + ++Y H  +  V  G+ VS+G  I  +G +G +  P 
Sbjct: 296 VIAAEW-YGGYGNAVIIDHGNGLQSLYGHNSSLTVSVGETVSQGQIIAYAGSTGYSTGPH 354

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R+N  A+DP+ +L
Sbjct: 355 CHFEVRQNGEAVDPMGYL 372


>gi|126735605|ref|ZP_01751350.1| peptidase, M23/M37 family protein [Roseobacter sp. CCS2]
 gi|126714792|gb|EBA11658.1| peptidase, M23/M37 family protein [Roseobacter sp. CCS2]
          Length = 435

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 47/80 (58%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           ++ + G      G  I IRHD  I T Y+H++T  V+ GQ+VSRG  IG  G SG +  P
Sbjct: 351 VISHAGWA-SGYGRLIKIRHDFGIETRYAHLNTMDVRVGQRVSRGERIGAMGNSGRSTGP 409

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R N   ++P+ ++ 
Sbjct: 410 HLHYEVRVNGNPVNPMTYIR 429


>gi|291086271|ref|ZP_06571439.1| lipoprotein NlpD [Citrobacter youngae ATCC 29220]
 gi|291068696|gb|EFE06805.1| lipoprotein NlpD [Citrobacter youngae ATCC 29220]
          Length = 325

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q++  G  I   G +G +   +
Sbjct: 246 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEIKAGQKIATMGSTGTSS-TR 304

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 305 LHFEIRYKGKSVNPLRYLPQR 325


>gi|170025641|ref|YP_001722146.1| lipoprotein NlpD [Yersinia pseudotuberculosis YPIII]
 gi|186894138|ref|YP_001871250.1| lipoprotein NlpD [Yersinia pseudotuberculosis PB1/+]
 gi|169752175|gb|ACA69693.1| peptidase M23B [Yersinia pseudotuberculosis YPIII]
 gi|186697164|gb|ACC87793.1| Peptidase M23 [Yersinia pseudotuberculosis PB1/+]
          Length = 327

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 248 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 306

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 307 LHFEIRYKGKSVNPLRYLPQR 327


>gi|186473545|ref|YP_001860887.1| peptidase M23B [Burkholderia phymatum STM815]
 gi|184195877|gb|ACC73841.1| peptidase M23B [Burkholderia phymatum STM815]
          Length = 394

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GN + I H + ++T Y H     VQ+G  V     I   G +G +  P 
Sbjct: 309 VIHAGPQ-GGYGNAVEIDHGNGLITRYGHASKIVVQEGDLVLSHQHIADVGSTGRSTGPH 367

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+  N + +DP  +L
Sbjct: 368 LHFEVLVNGVPVDPTDYL 385


>gi|332160358|ref|YP_004296935.1| lipoprotein NlpD [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318604408|emb|CBY25906.1| lipoprotein NlpD [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325664588|gb|ADZ41232.1| lipoprotein NlpD [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330859887|emb|CBX70218.1| lipoprotein nlpD [Yersinia enterocolitica W22703]
          Length = 321

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 242 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 300

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 301 LHFEIRYKGKSVNPLRYLPQR 321


>gi|238754523|ref|ZP_04615878.1| hypothetical protein yruck0001_24610 [Yersinia ruckeri ATCC 29473]
 gi|238707352|gb|EEP99714.1| hypothetical protein yruck0001_24610 [Yersinia ruckeri ATCC 29473]
          Length = 325

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 246 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 304

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 305 LHFEIRYKGKSVNPLRYLPQR 325


>gi|163736616|ref|ZP_02144035.1| peptidase M23B [Phaeobacter gallaeciensis BS107]
 gi|163742736|ref|ZP_02150121.1| peptidase, M23/M37 family protein [Phaeobacter gallaeciensis 2.10]
 gi|161383991|gb|EDQ08375.1| peptidase, M23/M37 family protein [Phaeobacter gallaeciensis 2.10]
 gi|161390486|gb|EDQ14836.1| peptidase M23B [Phaeobacter gallaeciensis BS107]
          Length = 443

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I+H   I T Y+H     V+ GQ+VSRG  I   G +G +   
Sbjct: 359 VVTHAGWQ-SGYGKLVTIQHAFGIETKYAHNSNIRVKVGQRVSRGDHISDMGNTGRSTGT 417

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R N   ++P+ +++
Sbjct: 418 HLHYEVRVNGNPVNPMIYIK 437


>gi|54310170|ref|YP_131190.1| lipoprotein NlpD [Photobacterium profundum SS9]
 gi|46914611|emb|CAG21388.1| hypothetical lipoprotein NlpD [Photobacterium profundum SS9]
          Length = 302

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H D  ++ Y+H D   V++ Q V  G  I   G SG +   +
Sbjct: 223 VVYAGNALRGYGNLIIIKHSDDYLSAYAHNDKVLVKEQQTVKAGQKIASMGSSGTSS-VR 281

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L +K
Sbjct: 282 LHFEIRYKGKSVDPMRYLPKK 302


>gi|238797131|ref|ZP_04640633.1| hypothetical protein ymoll0001_8390 [Yersinia mollaretii ATCC
           43969]
 gi|238718978|gb|EEQ10792.1| hypothetical protein ymoll0001_8390 [Yersinia mollaretii ATCC
           43969]
          Length = 309

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 230 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 288

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 289 LHFEIRYKGKSVNPLRYLPQR 309


>gi|254469809|ref|ZP_05083214.1| peptidase M23B [Pseudovibrio sp. JE062]
 gi|211961644|gb|EEA96839.1| peptidase M23B [Pseudovibrio sp. JE062]
          Length = 587

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 52/80 (65%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN+L   GN +LIRHD+  V+ Y+H     V++G  V RG TI ++G +G+   PQ
Sbjct: 507 IVYAGNELKGFGNLVLIRHDNGWVSAYAHNKELKVRRGDVVRRGQTIAMAGATGSVTQPQ 566

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFELRK+   +DP+ FL  
Sbjct: 567 LHFELRKDNKPVDPMSFLPR 586


>gi|293392780|ref|ZP_06637098.1| outer membrane antigenic lipoprotein B [Serratia odorifera DSM
           4582]
 gi|291424639|gb|EFE97850.1| outer membrane antigenic lipoprotein B [Serratia odorifera DSM
           4582]
          Length = 316

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 237 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 295

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 296 LHFEIRYKGKSVNPLRYLPQR 316


>gi|24213743|ref|NP_711224.1| M23 family metalloendopeptidase [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45658459|ref|YP_002545.1| membrane metalloendopeptidase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|24194565|gb|AAN48242.1| M23 family metalloendopeptidase [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45601702|gb|AAS71182.1| membrane metalloendopeptidase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 372

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   GN ++I H D   T+Y+H    +VQ+G  V  G  I  SG +G +  P 
Sbjct: 284 VIYAGW-MGGYGNVVVIEHTDDFKTLYAHNSKLFVQRGDYVLAGKKIARSGSTGYSFGPH 342

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+ KN   ++P K+L+
Sbjct: 343 LHFEVIKNGRPVNPSKYLK 361


>gi|153947948|ref|YP_001402251.1| lipoprotein NlpD [Yersinia pseudotuberculosis IP 31758]
 gi|152959443|gb|ABS46904.1| lipoprotein nlpD [Yersinia pseudotuberculosis IP 31758]
          Length = 327

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 248 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 306

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 307 LHFEIRYKGKSVNPLRYLPQR 327


>gi|303234143|ref|ZP_07320789.1| peptidase, M23 family [Finegoldia magna BVS033A4]
 gi|302494684|gb|EFL54444.1| peptidase, M23 family [Finegoldia magna BVS033A4]
          Length = 407

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++VG      GN + ++HD+  +T Y H+       GQ+V RG  I   G +G +   
Sbjct: 329 VVVHVGWS-GGYGNLVKVQHDNGALTYYGHLSGYNCSVGQRVKRGQLIAFMGSTGYSTGS 387

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N    DP+ +L 
Sbjct: 388 HLHFEVRFNGQHTDPLNYLR 407


>gi|302379584|ref|ZP_07268069.1| peptidase, M23 family [Finegoldia magna ACS-171-V-Col3]
 gi|302312491|gb|EFK94487.1| peptidase, M23 family [Finegoldia magna ACS-171-V-Col3]
          Length = 407

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++VG      GN + ++HD+  +T Y H+       GQ+V RG  I   G +G +   
Sbjct: 329 VVVHVGWS-GGYGNLVKVQHDNGALTYYGHLSGYNCSVGQRVKRGQLIAFMGSTGYSTGS 387

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N    DP+ +L 
Sbjct: 388 HLHFEVRFNGQHTDPLNYLR 407


>gi|319955963|ref|YP_004167226.1| peptidase m23 [Nitratifractor salsuginis DSM 16511]
 gi|319418367|gb|ADV45477.1| Peptidase M23 [Nitratifractor salsuginis DSM 16511]
          Length = 453

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  +   G  + I H    V++Y+H     V +G  V RG  IG  G +G +  P 
Sbjct: 282 VVYAGW-MRGYGKVVKIAHAGGFVSLYAHQSRLLVHRGSYVKRGQVIGRVGSTGRSTGPH 340

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HF L  N  A+DP+K+L +
Sbjct: 341 LHFGLYHNGRAVDPLKYLGK 360


>gi|404099|dbj|BAA04487.1| ORF-X protein [Escherichia coli]
          Length = 281

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 202 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 260

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 261 LHFEIRYKGKSVNPLRYLPQR 281


>gi|20809035|ref|NP_624206.1| membrane proteins related to metalloendopeptidase
           [Thermoanaerobacter tengcongensis MB4]
 gi|20517706|gb|AAM25810.1| Membrane proteins related to metalloendopeptidases
           [Thermoanaerobacter tengcongensis MB4]
          Length = 449

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G +    G  + I H +  VT Y H     V+ G KV +G  I L G +G+A  P 
Sbjct: 371 VIFAGWE-SGYGYLVKIDHHNGYVTYYGHASKLLVKVGDKVEKGQKIALVGATGHATGPH 429

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           VHFE+RKN + +DP++FL  
Sbjct: 430 VHFEVRKNGVPIDPMRFLGR 449


>gi|297618030|ref|YP_003703189.1| peptidase M23 [Syntrophothermus lipocalidus DSM 12680]
 gi|297145867|gb|ADI02624.1| Peptidase M23 [Syntrophothermus lipocalidus DSM 12680]
          Length = 377

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   GNTI++ H   + T+Y+H+       G +V +G TIGL G +G +    
Sbjct: 301 VIYTGR-MGGYGNTIVVDHGGGVSTLYAHLSAYRTSTGARVDKGDTIGLVGSTGWSTGAH 359

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RKN   +DP  ++
Sbjct: 360 LHFEVRKNGTPVDPRGWI 377


>gi|238786007|ref|ZP_04629968.1| hypothetical protein yberc0001_11770 [Yersinia bercovieri ATCC
           43970]
 gi|238713068|gb|EEQ05119.1| hypothetical protein yberc0001_11770 [Yersinia bercovieri ATCC
           43970]
          Length = 309

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 230 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 288

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 289 LHFEIRYKGKSVNPLRYLPQR 309


>gi|328543819|ref|YP_004303928.1| M23 peptidase domain protein [polymorphum gilvum SL003B-26A1]
 gi|326413563|gb|ADZ70626.1| M23 peptidase domain protein [Polymorphum gilvum SL003B-26A1]
          Length = 426

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 50/80 (62%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY GN+L   GN +LIRH D  V+ Y+H     V++G  V RG  +  +G +G+   PQ
Sbjct: 346 VIYAGNELKGYGNLVLIRHSDGWVSAYAHNSELSVKRGDTVQRGQVVAKAGATGSVSQPQ 405

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           VHFELR+    +DP+K+L +
Sbjct: 406 VHFELRQGNKPVDPLKYLPK 425


>gi|291618596|ref|YP_003521338.1| NlpD [Pantoea ananatis LMG 20103]
 gi|291153626|gb|ADD78210.1| NlpD [Pantoea ananatis LMG 20103]
 gi|327394976|dbj|BAK12398.1| lipoprotein NlpD precursor [Pantoea ananatis AJ13355]
          Length = 371

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 292 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 350

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 351 LHFEIRYKGKSVNPLRYLPQR 371


>gi|67925063|ref|ZP_00518442.1| Peptidoglycan-binding LysM:Peptidase M23B [Crocosphaera watsonii WH
           8501]
 gi|67853086|gb|EAM48466.1| Peptidoglycan-binding LysM:Peptidase  M23B [Crocosphaera watsonii
           WH 8501]
          Length = 423

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI VG D    G  + IRH D  VT+Y H     V++GQKV +G  I   G +G +  P 
Sbjct: 339 VITVGWDARGYGKFLKIRHPDGSVTLYGHNSRHLVRRGQKVEQGQKIAEMGNTGRSTGPH 398

Query: 62  VHFELRKNAI-AMDPIKFLEE 81
           +H+E+R       DP+ FL +
Sbjct: 399 LHYEIRPKGRGPQDPMAFLPK 419


>gi|114776317|ref|ZP_01451362.1| Membrane protein [Mariprofundus ferrooxydans PV-1]
 gi|114553147|gb|EAU55545.1| Membrane protein [Mariprofundus ferrooxydans PV-1]
          Length = 268

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 46/80 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y  + L   G  ++IRH +++ T Y+H     V+KG KV  G  I   G++G A  P 
Sbjct: 189 VVYSDSRLSGYGKLVIIRHGNNLFTAYAHNQRNLVRKGDKVRAGDVIARVGQTGRATGPH 248

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R+ +  +DP+ +L  
Sbjct: 249 LHFEVRQGSTPVDPLAYLPR 268


>gi|91778022|ref|YP_553230.1| M24/M37 family peptidase [Burkholderia xenovorans LB400]
 gi|91690682|gb|ABE33880.1| Putative peptidase, M23/M37 family [Burkholderia xenovorans LB400]
          Length = 328

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G +    GN + I H + ++T Y H     V  G  V     I   G +G +  P 
Sbjct: 243 VVFAG-EKSGYGNAVEIDHGNGLMTRYGHASRLVVHVGDLVLPRQYIADVGSTGRSTGPH 301

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+  N   ++P+ +L
Sbjct: 302 LHFEVLVNGAPVNPVAYL 319


>gi|260433380|ref|ZP_05787351.1| peptidase, M23/M37 family [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417208|gb|EEX10467.1| peptidase, M23/M37 family [Silicibacter lacuscaerulensis ITI-1157]
          Length = 420

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + IRH   I T Y+H     V+ GQ+VSRG  I   G +G +   
Sbjct: 336 VVTHAGWQ-SGFGKLVKIRHAFGIETYYAHNSKIRVKVGQRVSRGDHIADMGNTGRSTGT 394

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+  N   ++P+ +++
Sbjct: 395 HLHYEVHVNGKPVNPMTYIK 414


>gi|269792860|ref|YP_003317764.1| Peptidase M23 [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269100495|gb|ACZ19482.1| Peptidase M23 [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 430

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  +   G T++I+H +   T+Y+H     V  G++VS+G  I   G +G +   
Sbjct: 352 VVVYAGW-MSGYGKTVVIQHQNGTSTLYAHCSALTVPAGRRVSQGDIIARVGSTGRSTGA 410

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R   + ++P++ L 
Sbjct: 411 HLHFEVRAEGVPVNPLRSLR 430


>gi|257452436|ref|ZP_05617735.1| cell wall endopeptidase [Fusobacterium sp. 3_1_5R]
 gi|317058979|ref|ZP_07923464.1| cell wall endopeptidase family M23/M37 [Fusobacterium sp. 3_1_5R]
 gi|313684655|gb|EFS21490.1| cell wall endopeptidase family M23/M37 [Fusobacterium sp. 3_1_5R]
          Length = 382

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+I+HD+   T Y+H+     + G++V RG  IG +G +G    P
Sbjct: 305 VVTFAGN-MSGYGKIIIIKHDNGYETRYAHLSQISTRVGERVERGELIGKTGNTGRTTGP 363

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R++   ++P+K+L
Sbjct: 364 HLHFEIRRSGKTLNPMKYL 382


>gi|308187919|ref|YP_003932050.1| Lipoprotein nlpD precursor [Pantoea vagans C9-1]
 gi|308058429|gb|ADO10601.1| Lipoprotein nlpD precursor [Pantoea vagans C9-1]
          Length = 366

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 287 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 345

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 346 LHFEIRYKGKSVNPLRYLPQR 366


>gi|218462793|ref|ZP_03502884.1| Peptidase M23 [Rhizobium etli Kim 5]
          Length = 440

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN + + H + I T Y H+    V+ G  V R + IGL+G +G +    
Sbjct: 353 VIAAGW-TGGYGNMVEVDHGNGISTRYGHMSQVLVKVGDTVGRNNVIGLAGSTGRSTGTH 411

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R+N  A+DP+ F+ 
Sbjct: 412 LHYEVRQNGQAVDPVYFMN 430


>gi|114764584|ref|ZP_01443788.1| peptidase, M23/M37 family protein [Pelagibaca bermudensis HTCC2601]
 gi|114542960|gb|EAU45980.1| peptidase, M23/M37 family protein [Roseovarius sp. HTCC2601]
          Length = 415

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G  +   G  + I+H+  I T Y+H+    V+ GQ+VSRG  +G  G +G +   
Sbjct: 331 VVTHAGW-MSGYGRLVKIKHEFGIETRYAHMSKIRVKVGQRVSRGDRVGDMGNTGRSTGT 389

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R     ++P+ +++
Sbjct: 390 HLHYEVRVGGEPVNPMIYIK 409


>gi|304318076|ref|YP_003853221.1| peptidase M23 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302779578|gb|ADL70137.1| Peptidase M23 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 421

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G +    G  + I H +  VT Y H     V+KG KV +G  I L G +GN   P 
Sbjct: 344 VIFSGWE-SGYGYLVKIDHGNGYVTYYGHASKLIVKKGDKVYKGQEIALVGMTGNTTGPH 402

Query: 62  VHFELRKNAIAMDPIKFLE 80
           VHFE+RKN + ++P  +L+
Sbjct: 403 VHFEVRKNGVPVNPQIYLK 421


>gi|167769369|ref|ZP_02441422.1| hypothetical protein ANACOL_00695 [Anaerotruncus colihominis DSM
           17241]
 gi|167668337|gb|EDS12467.1| hypothetical protein ANACOL_00695 [Anaerotruncus colihominis DSM
           17241]
          Length = 744

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  ++I H     TVY+H    YVQ GQ+VS+G TI   G++GNA  P 
Sbjct: 666 VVAAGWG-GAYGYRVIIDHGGGYQTVYAHCSALYVQAGQQVSQGDTIAAIGQTGNATGPH 724

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N   +D   +L
Sbjct: 725 LHFEIRINGTPVDAAPYL 742


>gi|238019416|ref|ZP_04599842.1| hypothetical protein VEIDISOL_01285 [Veillonella dispar ATCC 17748]
 gi|237864115|gb|EEP65405.1| hypothetical protein VEIDISOL_01285 [Veillonella dispar ATCC 17748]
          Length = 401

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G  +   G  ++I H + + T+Y H     V +GQ VS+G  I  +G +GN+  P 
Sbjct: 325 VVWSGW-MGGYGYAVVIDHGNGMSTLYGHNSELAVSEGQDVSKGQVIAYAGSTGNSTGPH 383

Query: 62  VHFELRKNAIAMDPIKFL 79
           VHFE+R +   +DP+ +L
Sbjct: 384 VHFEVRISGDPVDPMGYL 401


>gi|86138777|ref|ZP_01057349.1| peptidase, M23/M37 family protein [Roseobacter sp. MED193]
 gi|85824424|gb|EAQ44627.1| peptidase, M23/M37 family protein [Roseobacter sp. MED193]
          Length = 457

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I+H   I T Y+H     V+ GQ+VSRG  I   G +G +   
Sbjct: 373 IVTHAGWQ-SGYGKLVTIQHAFGIETKYAHNSNLRVKVGQRVSRGDHIADMGTTGRSTGT 431

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R N   ++P+ +++
Sbjct: 432 HLHYEVRVNGKPVNPMIYIK 451


>gi|218674641|ref|ZP_03524310.1| Peptidase M23 [Rhizobium etli GR56]
          Length = 440

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN + + H + I T Y H+    V+ G  V R   IGL+G +G +    
Sbjct: 353 VIAAGW-TGGYGNMVEVDHGNGISTRYGHMSQVLVKVGDTVGRNDVIGLAGSTGRSTGTH 411

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R+N  A+DP+ F+ 
Sbjct: 412 LHYEVRQNGQAVDPVYFMN 430


>gi|126732844|ref|ZP_01748637.1| hypothetical protein SSE37_03055 [Sagittula stellata E-37]
 gi|126706683|gb|EBA05756.1| hypothetical protein SSE37_03055 [Sagittula stellata E-37]
          Length = 851

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 39/78 (50%), Gaps = 2/78 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTP-YVQKGQKVSRGHTIGLSGKSGNAQHP 60
           V Y G      GN I I H +   T Y+H+      +KG +V  G  IG  G +G +  P
Sbjct: 536 VEYAGPG-GGYGNVIYIDHGNGQQTRYAHMSKYGAFKKGDRVKAGDVIGYVGTTGRSTGP 594

Query: 61  QVHFELRKNAIAMDPIKF 78
            +HFELR N   +DP+ +
Sbjct: 595 HLHFELRVNGTPVDPLSY 612


>gi|78044286|ref|YP_361418.1| M23/M37 peptidase domain-containing protein [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996401|gb|ABB15300.1| M23/M37 peptidase domain protein [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 214

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G +    G  I++ H     T Y H+    V++GQ+V  G  IGL G +G +   
Sbjct: 136 VVTFAGWED-GYGKLIVLDHAGPYKTKYGHLSKILVREGQRVEAGDIIGLIGSTGRSTGS 194

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+  N   ++P+K+L 
Sbjct: 195 HLHFEILINGNPVNPLKYLP 214


>gi|157148285|ref|YP_001455604.1| lipoprotein NlpD [Citrobacter koseri ATCC BAA-895]
 gi|157085490|gb|ABV15168.1| hypothetical protein CKO_04102 [Citrobacter koseri ATCC BAA-895]
          Length = 317

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 238 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 296

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 297 LHFEIRYKGKSVNPLRYLPQR 317


>gi|323703289|ref|ZP_08114940.1| Peptidase M23 [Desulfotomaculum nigrificans DSM 574]
 gi|323531754|gb|EGB21642.1| Peptidase M23 [Desulfotomaculum nigrificans DSM 574]
          Length = 449

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN + I H + +VT Y+H+ +  V  GQ VS+G  IG  G +G +  P 
Sbjct: 373 VIRAGW-YGGYGNCVDISHGNGVVTRYAHMSSIGVMVGQTVSKGQVIGRIGSTGRSTGPH 431

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+  N +  +P+ +L
Sbjct: 432 LHFEVIVNGVPRNPLAYL 449


>gi|320160153|ref|YP_004173377.1| peptidase M23 family protein [Anaerolinea thermophila UNI-1]
 gi|319994006|dbj|BAJ62777.1| peptidase M23 family protein [Anaerolinea thermophila UNI-1]
          Length = 403

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G +    G  ++I H +   T+Y+H+   Y   G  VS+G TIG  G +G +  P
Sbjct: 323 VVVYSGWNENGYGYVVVIDHGNGWQTLYAHLSQIYAGCGASVSQGDTIGAMGSTGRSTGP 382

Query: 61  QVHFELR-KNAIAMDPIKFLE 80
            +HFE+  ++ + ++P  FL+
Sbjct: 383 HLHFEIMSESGVRVNPWSFLQ 403


>gi|86606542|ref|YP_475305.1| M23B family peptidase [Synechococcus sp. JA-3-3Ab]
 gi|86555084|gb|ABD00042.1| peptidase, M23B family [Synechococcus sp. JA-3-3Ab]
          Length = 530

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ GN     GN + IRH + IVT Y+H    YV KGQ V +G  I   G +G +  P 
Sbjct: 451 VIFAGNAGDGYGNRVDIRHPNGIVTRYAHGHRIYVSKGQYVQQGQVIMSRGNTGRSTGPH 510

Query: 62  VHFELRK-NAIAMDPIKFLE 80
           +HFE+R      +DP  +L 
Sbjct: 511 LHFEVRPGGGAPVDPRPYLP 530


>gi|110634151|ref|YP_674359.1| peptidase M23B [Mesorhizobium sp. BNC1]
 gi|110285135|gb|ABG63194.1| peptidase M23B [Chelativorans sp. BNC1]
          Length = 412

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 53/80 (66%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L   GNT+L+RH+D +VTVY H     V++G +V RG  I  SG +G+A  P
Sbjct: 333 VVIYAGDGLKGFGNTVLVRHEDGLVTVYGHASELKVKRGDQVRRGQEIARSGMTGDADRP 392

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RK    +DP+ +L 
Sbjct: 393 KLHFEVRKGTSPVDPMTYLR 412


>gi|251788477|ref|YP_003003198.1| peptidase M23 [Dickeya zeae Ech1591]
 gi|247537098|gb|ACT05719.1| Peptidase M23 [Dickeya zeae Ech1591]
          Length = 404

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H +T  V++ Q+V  G  I   G +G +   +
Sbjct: 325 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNETMLVREQQEVKAGQQIATMGSTGTSS-VR 383

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 384 LHFEIRYKGKSVNPLRFLPQR 404


>gi|329850512|ref|ZP_08265357.1| peptidase family M23 family protein [Asticcacaulis biprosthecum
           C19]
 gi|328840827|gb|EGF90398.1| peptidase family M23 family protein [Asticcacaulis biprosthecum
           C19]
          Length = 378

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V +VG      GN + I H +   T Y+H+    V+ GQ+++    +G  G +G +   
Sbjct: 292 VVSFVGVRT-GYGNCVEIDHGNGFKTRYAHLANFTVKTGQRIAVDQRVGSMGSTGRSTGV 350

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+  N    +P +FL+
Sbjct: 351 HLHYEVWLNGRPQNPARFLK 370


>gi|320530694|ref|ZP_08031738.1| peptidase, M23 family [Selenomonas artemidis F0399]
 gi|320136981|gb|EFW28919.1| peptidase, M23 family [Selenomonas artemidis F0399]
          Length = 370

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  +   G  ++I H   I T+Y H  +  V  GQ V++G  I   G +GN+  P 
Sbjct: 294 VEYAGW-ISGYGYAVIINHGGGISTLYGHCQSLDVSTGQSVAQGELIAECGSTGNSTGPH 352

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R +   ++P+++L
Sbjct: 353 CHFEVRVSGEPVNPLEYL 370


>gi|313622404|gb|EFR92868.1| M48 family peptidase [Listeria innocua FSL J1-023]
          Length = 437

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 7/85 (8%)

Query: 2   VIYVG-----NDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKS 54
           V++ G     +     G  + I H +   T+Y+H+      V  GQ+VS+G  IG+ G +
Sbjct: 353 VVFSGFGATGSGFGGYGYVVKIDHGNGFQTLYAHMRAGSLKVVTGQQVSQGQPIGIMGST 412

Query: 55  GNAQHPQVHFELRKNAIAMDPIKFL 79
           G +    +HFE+ KN I +DP  ++
Sbjct: 413 GQSTGQHLHFEIHKNGIPVDPAPYI 437


>gi|16801709|ref|NP_471977.1| hypothetical protein lin2647 [Listeria innocua Clip11262]
 gi|16415184|emb|CAC97874.1| lin2647 [Listeria innocua Clip11262]
          Length = 437

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 7/85 (8%)

Query: 2   VIYVG-----NDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKS 54
           V++ G     +     G  + I H +   T+Y+H+      V  GQ+VS+G  IG+ G +
Sbjct: 353 VVFSGFGATGSGFGGYGYVVKIDHGNGFQTLYAHMRAGSLKVVTGQQVSQGQPIGIMGST 412

Query: 55  GNAQHPQVHFELRKNAIAMDPIKFL 79
           G +    +HFE+ KN I +DP  ++
Sbjct: 413 GQSTGQHLHFEIHKNGIPVDPAPYI 437


>gi|257466306|ref|ZP_05630617.1| cell wall endopeptidase [Fusobacterium gonidiaformans ATCC 25563]
 gi|315917463|ref|ZP_07913703.1| cell wall endopeptidase [Fusobacterium gonidiaformans ATCC 25563]
 gi|313691338|gb|EFS28173.1| cell wall endopeptidase [Fusobacterium gonidiaformans ATCC 25563]
          Length = 383

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+I+HD+   T Y+H+     + G++V RG  IG +G +G    P
Sbjct: 306 VVTFAGN-MSGYGKIIIIKHDNGYETRYAHLSQISTRVGERVERGELIGKTGNTGRTTGP 364

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R++   ++P+K+L
Sbjct: 365 HLHFEIRRSGKTLNPMKYL 383


>gi|168031336|ref|XP_001768177.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162680615|gb|EDQ67050.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 521

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      G  + I+H+   VT Y+H    + + GQ+V +G  +   G +G A  P 
Sbjct: 443 VTFAGWS-GGYGYLVAIQHEGGFVTRYAHCCAIHSRIGQQVLKGQQVAAVGATGRATGPH 501

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+RKN  A+DP+K++ 
Sbjct: 502 LHFEVRKNGEALDPLKWVR 520


>gi|238786818|ref|ZP_04630619.1| hypothetical protein yfred0001_17880 [Yersinia frederiksenii ATCC
           33641]
 gi|238725186|gb|EEQ16825.1| hypothetical protein yfred0001_17880 [Yersinia frederiksenii ATCC
           33641]
          Length = 321

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ ++V  G  I   G +G +   +
Sbjct: 242 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 300

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 301 LHFEIRYKGKSVNPLRYLPQR 321


>gi|329120969|ref|ZP_08249600.1| peptidase M23B [Dialister micraerophilus DSM 19965]
 gi|327471131|gb|EGF16585.1| peptidase M23B [Dialister micraerophilus DSM 19965]
          Length = 382

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   GNT++I H ++I T+Y H  +  V  GQ VS+G  I  +G +GN+  P 
Sbjct: 306 VIYAGW-IDGYGNTVIIDHGNNITTLYGHNSSLAVSDGQSVSKGTVIAYAGSTGNSTGPH 364

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE++    A+DP+ +L
Sbjct: 365 CHFEVQVGGSAVDPMGYL 382


>gi|313680035|ref|YP_004057774.1| peptidase m23 [Oceanithermus profundus DSM 14977]
 gi|313152750|gb|ADR36601.1| Peptidase M23 [Oceanithermus profundus DSM 14977]
          Length = 387

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 43/81 (53%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G   V  G  + I H   + T+Y+H+    V++GQ+V +G  +G  G++G A  P
Sbjct: 307 IVTAAGWSRVGYGYYVKIDHGGGVETLYAHMSRIAVRRGQQVKQGALVGYVGRTGFATGP 366

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +H E+R      +P+ FL +
Sbjct: 367 HLHLEVRIRGKTQNPLSFLPK 387


>gi|313891982|ref|ZP_07825583.1| peptidase, M23 family [Dialister microaerophilus UPII 345-E]
 gi|313119625|gb|EFR42816.1| peptidase, M23 family [Dialister microaerophilus UPII 345-E]
          Length = 382

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   GNT++I H ++I T+Y H  +  V  GQ VS+G  I  +G +GN+  P 
Sbjct: 306 VIYAGW-IDGYGNTVIIDHGNNITTLYGHNSSLAVSDGQSVSKGTVIAYAGSTGNSTGPH 364

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE++    A+DP+ +L
Sbjct: 365 CHFEVQVGGSAVDPMGYL 382


>gi|295696760|ref|YP_003589998.1| Peptidase M23 [Bacillus tusciae DSM 2912]
 gi|295412362|gb|ADG06854.1| Peptidase M23 [Bacillus tusciae DSM 2912]
          Length = 478

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 42/77 (54%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G D    GN + I H + +VT+Y H+    V  GQ V++G  IG  G +G A  P 
Sbjct: 401 VIFAGWDSGGYGNCVRIDHGNGVVTIYGHMSQVLVSPGQAVAQGQVIGRVGATGEATGPH 460

Query: 62  VHFELRKNAIAMDPIKF 78
           +H+E+      +DP+ +
Sbjct: 461 LHYEVHVGGHVVDPMPY 477


>gi|283850811|ref|ZP_06368097.1| Peptidase M23 [Desulfovibrio sp. FW1012B]
 gi|283573734|gb|EFC21708.1| Peptidase M23 [Desulfovibrio sp. FW1012B]
          Length = 346

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      GN + I H     +VY H+    V+ G+ V+ G  I   G +G +  P 
Sbjct: 260 VVFAGTK-GGYGNVVEIEHPGGWKSVYGHLRGYSVKAGETVAAGGKIAEVGSTGRSTGPH 318

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELR+    +DP   L
Sbjct: 319 LHFELRRGGETVDPETLL 336


>gi|260599106|ref|YP_003211677.1| lipoprotein NlpD [Cronobacter turicensis z3032]
 gi|260218283|emb|CBA33242.1| Lipoprotein nlpD [Cronobacter turicensis z3032]
          Length = 297

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G SG +   +
Sbjct: 218 VVYAGSALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSSGTSS-TR 276

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 277 LHFEIRYKGKSVNPLRYLPQR 297


>gi|327191068|gb|EGE58121.1| putative metalloendopeptidase protein [Rhizobium etli CNPAF512]
          Length = 411

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN + + H + I T Y H+    V+ G  V R   IGL+G +G +    
Sbjct: 324 VIAAGW-TGGYGNMVEVDHGNGISTRYGHMSQVMVKVGDTVGRNDVIGLAGSTGRSTGTH 382

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R+N  A+DP+ F+ 
Sbjct: 383 LHYEVRQNGQAVDPVYFMN 401


>gi|227822082|ref|YP_002826053.1| membrane protein associated metalloendopeptidase [Sinorhizobium
           fredii NGR234]
 gi|227341082|gb|ACP25300.1| membrane protein associated metalloendopeptidase [Sinorhizobium
           fredii NGR234]
          Length = 445

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G      GN + I H + + T Y+H+    V  G +V     +  SG +G +  P 
Sbjct: 358 VTAAGPA-GGYGNMVEIDHGNGVSTRYAHLAVVLVHVGDRVEADQVVAQSGSTGRSTGPH 416

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R   +A+DP++FL 
Sbjct: 417 LHYEVRVGGLAVDPMRFLR 435


>gi|206889830|ref|YP_002249844.1| peptidase, family M23/M37 domain protein [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741768|gb|ACI20825.1| peptidase, family M23/M37 domain protein [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 242

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G      GN +++ H++ I T+Y+H     V+ G  V+    I LSG +G    P 
Sbjct: 157 VVYSGYSN-GYGNCVIVEHENGIQTIYAHNSKNLVKVGDTVTADTVIALSGSTGRTTGPH 215

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+RK+   ++P+  L  
Sbjct: 216 LHFEVRKDGKPVNPVAMLNS 235


>gi|190891964|ref|YP_001978506.1| metalloendopeptidase [Rhizobium etli CIAT 652]
 gi|190697243|gb|ACE91328.1| probable metalloendopeptidase protein [Rhizobium etli CIAT 652]
          Length = 411

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN + + H + I T Y H+    V+ G  V R   IGL+G +G +    
Sbjct: 324 VIAAGW-TGGYGNMVEVDHGNGISTRYGHMSQVMVKVGDTVGRNDVIGLAGSTGRSTGTH 382

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R+N  A+DP+ F+ 
Sbjct: 383 LHYEVRQNGQAVDPVYFMN 401


>gi|269929252|ref|YP_003321573.1| Peptidase M23 [Sphaerobacter thermophilus DSM 20745]
 gi|269788609|gb|ACZ40751.1| Peptidase M23 [Sphaerobacter thermophilus DSM 20745]
          Length = 544

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHID-TPYVQKGQKVSRGHTIGLSGKSGNAQH 59
           +VI+ G +   LGN + I H + +VT Y H++  P V  GQ V++G  +G  G +G +  
Sbjct: 464 VVIFAGWNTGGLGNAVAIDHGNGLVTWYGHMNARPAVSVGQWVAQGEYLGPMGSTGLSTG 523

Query: 60  PQVHFELRKNAIAMDPIKFLE 80
             +HF + KN + +DP+ +L 
Sbjct: 524 SHLHFVVIKNGVYVDPLNYLR 544


>gi|254440598|ref|ZP_05054092.1| M23 peptidase domain protein [Octadecabacter antarcticus 307]
 gi|198256044|gb|EDY80358.1| M23 peptidase domain protein [Octadecabacter antarcticus 307]
          Length = 431

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I+H   I T Y+H     V+ GQ++SRG  IG  G SG +  P
Sbjct: 347 VVTFAGWS-SGYGRLVKIQHAFGIETRYAHQSRIRVEVGQRLSRGDRIGDIGNSGRSTGP 405

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R     ++P+ ++ 
Sbjct: 406 HLHYEIRVGGRPVNPMIYIR 425


>gi|227114061|ref|ZP_03827717.1| lipoprotein NlpD [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 344

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q V+ G  I   G +G +   +
Sbjct: 265 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQDVTAGQKIATMGSTGTSS-VR 323

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 324 LHFEIRYKGKSVNPLRFLPQR 344


>gi|114704659|ref|ZP_01437567.1| probable metalloendopeptidase protein [Fulvimarina pelagi HTCC2506]
 gi|114539444|gb|EAU42564.1| probable metalloendopeptidase protein [Fulvimarina pelagi HTCC2506]
          Length = 422

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++  G      GN + I H + I T + H+    V+ G +V RG  +G  G +G +  P 
Sbjct: 336 IVRAGRS-GGYGNLVEIDHGNGIKTRFGHMARIDVEVGDEVPRGAQLGTVGSTGRSTGPH 394

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R+N  A+DP++F+ 
Sbjct: 395 LHYEVRRNGRAIDPMRFIR 413


>gi|326391191|ref|ZP_08212735.1| Peptidase M23 [Thermoanaerobacter ethanolicus JW 200]
 gi|325992760|gb|EGD51208.1| Peptidase M23 [Thermoanaerobacter ethanolicus JW 200]
          Length = 451

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G +    G  + I H +  VT Y H      +KG KV++G  I L G +G A    
Sbjct: 373 VIFSGWE-SGYGYLVKIDHHNGYVTYYGHASKLLAKKGDKVAKGQKIALVGSTGRATGSH 431

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+RKN + ++P+ +L  
Sbjct: 432 LHFEVRKNGVPVNPLSYLNR 451


>gi|323701464|ref|ZP_08113137.1| Peptidase M23 [Desulfotomaculum nigrificans DSM 574]
 gi|323533473|gb|EGB23339.1| Peptidase M23 [Desulfotomaculum nigrificans DSM 574]
          Length = 376

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G+ +   GN ++I H   +V++Y H+    V  GQ V++G  I L G +G +    
Sbjct: 300 VIYSGS-MTGYGNVVMIDHGGGVVSLYGHLSAKLVSNGQTVTKGMPIALVGNTGMSTGSH 358

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RKN   + P  +L
Sbjct: 359 LHFEVRKNGTPVSPYGYL 376


>gi|89092113|ref|ZP_01165068.1| Peptidase M23B [Oceanospirillum sp. MED92]
 gi|89083848|gb|EAR63065.1| Peptidase  M23B [Oceanospirillum sp. MED92]
          Length = 298

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L+  GN ++I H+   ++ Y+H     V++   V  G  I   G SG A    
Sbjct: 219 VVYAGSGLLGYGNLVIIDHNQQFLSAYAHNSRVLVKENDMVEVGQKIAEMGSSG-ADRVM 277

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R++   ++P+++L ++
Sbjct: 278 LHFEIRRDGKPVNPLRYLPKR 298


>gi|188534816|ref|YP_001908613.1| lipoprotein NlpD [Erwinia tasmaniensis Et1/99]
 gi|188029858|emb|CAO97742.1| Lipoprotein [Erwinia tasmaniensis Et1/99]
          Length = 365

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 286 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 344

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 345 LHFEIRYKGKSVNPLRYLPQR 365


>gi|86357879|ref|YP_469771.1| metalloendopeptidase protein [Rhizobium etli CFN 42]
 gi|86281981|gb|ABC91044.1| probable metalloendopeptidase protein [Rhizobium etli CFN 42]
          Length = 408

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN + I H + I T Y H+    V+ G  V R   IGL+G +G +    
Sbjct: 321 VISAGW-TGGYGNMVEIDHGNGISTRYGHMSQVLVKIGDTVDRNDVIGLAGSTGRSTGTH 379

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R+N  A+DP+ F+
Sbjct: 380 LHYEVRQNGHAVDPVYFM 397


>gi|296134227|ref|YP_003641474.1| Peptidase M23 [Thermincola sp. JR]
 gi|296032805|gb|ADG83573.1| Peptidase M23 [Thermincola potens JR]
          Length = 378

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VG  +   G  ++I H + + T YSH+    V  GQ+V +G  I   G +G +  P 
Sbjct: 302 VTFVGW-MSGYGKVVVIDHGNGLTTTYSHLSAQLVSDGQEVKKGDIIAEVGSTGLSTGPH 360

Query: 62  VHFELRKNAIAMDPIKFL 79
           + F +R+N   ++P K+L
Sbjct: 361 LDFSVRENGTPVNPRKYL 378


>gi|315924533|ref|ZP_07920752.1| conserved hypothetical protein [Pseudoramibacter alactolyticus ATCC
           23263]
 gi|315622063|gb|EFV02025.1| conserved hypothetical protein [Pseudoramibacter alactolyticus ATCC
           23263]
          Length = 389

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GN ++I H + + T+Y H     V KGQ+V++G  IG  G +G++  P 
Sbjct: 311 VIFAGTS-GGYGNCVMINHGNGVTTLYGHQSRIAVSKGQRVNQGDVIGYVGSTGHSTGPH 369

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HF +  N   ++P+++++
Sbjct: 370 LHFGIMVNGDYVNPLRYVQ 388


>gi|332706613|ref|ZP_08426674.1| membrane protein, putative metalloendopeptidase [Lyngbya majuscula
           3L]
 gi|332354497|gb|EGJ33976.1| membrane protein, putative metalloendopeptidase [Lyngbya majuscula
           3L]
          Length = 805

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    G  + I+H D  +T+Y+H    +V++GQ+V +G  I   G +G +  P
Sbjct: 722 VVVSAGWNSGGYGKLVEIKHPDGSLTLYAHNSRIFVRRGQQVGQGQRIAAMGSTGYSTGP 781

Query: 61  QVHFELRKNAI-AMDPIKFLEEK 82
            +HFE+      A +PI +L  +
Sbjct: 782 HLHFEVHPRGRGAANPIAYLPTR 804


>gi|323135925|ref|ZP_08071008.1| Peptidase M23 [Methylocystis sp. ATCC 49242]
 gi|322399016|gb|EFY01535.1| Peptidase M23 [Methylocystis sp. ATCC 49242]
          Length = 497

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      GN + I H   + T Y+H+    V  GQ+V  G  +G  G +G +  P
Sbjct: 409 VVSVAGPQ-GGYGNMVEIDHGGGLSTRYAHLSAISVAPGQQVPPGGLVGRVGSTGRSTGP 467

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R +  A+DP +FL 
Sbjct: 468 HLHYEVRMDGEAVDPSRFLR 487


>gi|50122452|ref|YP_051619.1| lipoprotein NlpD [Pectobacterium atrosepticum SCRI1043]
 gi|49612978|emb|CAG76429.1| putative cell wall degradation lipoprotein [Pectobacterium
           atrosepticum SCRI1043]
          Length = 344

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q V+ G  I   G +G +   +
Sbjct: 265 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQDVTAGQKIATMGSTGTSS-VR 323

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 324 LHFEIRYKGKSVNPLRFLPQR 344


>gi|37524719|ref|NP_928063.1| lipoprotein NlpD [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36784144|emb|CAE13013.1| Lipoprotein NlpD precursor [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 331

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q +  G  I   G +G +   +
Sbjct: 252 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQDIKAGQKIATMGSTGTSS-VR 310

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 311 LHFEIRYKGKSVNPLRYLPQR 331


>gi|253689711|ref|YP_003018901.1| Peptidase M23 [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251756289|gb|ACT14365.1| Peptidase M23 [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 344

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q V+ G  I   G +G +   +
Sbjct: 265 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQDVTAGQKIATMGSTGTSS-VR 323

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 324 LHFEIRYKGKSVNPLRFLPQR 344


>gi|12483894|gb|AAG53882.1|AF275947_1 lipoprotein NlpD [Escherichia coli]
          Length = 164

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 85  VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 143

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 144 LHFEIRYKGKSVNPLRYLPQR 164


>gi|304407662|ref|ZP_07389313.1| Peptidase M23 [Paenibacillus curdlanolyticus YK9]
 gi|304343145|gb|EFM08988.1| Peptidase M23 [Paenibacillus curdlanolyticus YK9]
          Length = 404

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 44/82 (53%), Gaps = 3/82 (3%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +VI  G      GNT+++ H + + T+Y HI T    V+ G+ V RG  I   G +GN+ 
Sbjct: 324 VVITAGW-TSGYGNTVILDHGNGLWTLYGHIRTGGIKVKVGENVKRGEKIAEVGSTGNST 382

Query: 59  HPQVHFELRKNAIAMDPIKFLE 80
              +HFE+R N    DP  +L+
Sbjct: 383 GNHLHFEVRINGTPKDPSSYLK 404


>gi|94496287|ref|ZP_01302865.1| Peptidase M23/M37 [Sphingomonas sp. SKA58]
 gi|94424466|gb|EAT09489.1| Peptidase M23/M37 [Sphingomonas sp. SKA58]
          Length = 392

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VG      GN + + H + I+T Y+H+       G KV+RG TIG  G +G +  P 
Sbjct: 292 VSFVG-QRSGYGNVVEVTHGNGIMTRYAHLSGFAAHIGDKVARGETIGRMGSTGRSTGPH 350

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R N  A++P +FLE +
Sbjct: 351 LHFEVRLNGQAINPRRFLEAR 371


>gi|166365231|ref|YP_001657504.1| putative peptidase [Microcystis aeruginosa NIES-843]
 gi|166087604|dbj|BAG02312.1| putative peptidase [Microcystis aeruginosa NIES-843]
          Length = 608

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G +    GN + +RH D   T+Y+H     V++GQ V +G  I   G +G +  P 
Sbjct: 526 VIASGWNSGGYGNLVKLRHPDGSTTLYAHNSRLLVRRGQTVQQGEPIAQMGSTGFSTGPH 585

Query: 62  VHFELRKNAI-AMDPIKFLEEK 82
           +HFE+  +   A++P+ FL  +
Sbjct: 586 LHFEVHPSGQGAVNPMAFLPGR 607


>gi|157369076|ref|YP_001477065.1| lipoprotein NlpD [Serratia proteamaculans 568]
 gi|157320840|gb|ABV39937.1| peptidase M23B [Serratia proteamaculans 568]
          Length = 328

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 249 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 307

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 308 LHFEIRYKGKSVNPLRYLPQR 328


>gi|270264029|ref|ZP_06192297.1| lipoprotein NlpD [Serratia odorifera 4Rx13]
 gi|270042222|gb|EFA15318.1| lipoprotein NlpD [Serratia odorifera 4Rx13]
          Length = 328

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 249 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 307

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 308 LHFEIRYKGKSVNPLRFLPQR 328


>gi|260575221|ref|ZP_05843221.1| Peptidase M23 [Rhodobacter sp. SW2]
 gi|259022481|gb|EEW25777.1| Peptidase M23 [Rhodobacter sp. SW2]
          Length = 446

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G      G  + IRH   I T+Y H+       GQ+VSRG  IG  G SG +   
Sbjct: 362 VVIEAGWGN-GYGRMVKIRHAFGIETLYGHLSQIRADVGQRVSRGDRIGDMGNSGRSTGT 420

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R     ++P+ F++
Sbjct: 421 HLHYEVRIGGTPVNPMTFIK 440


>gi|85375471|ref|YP_459533.1| peptidase M23/M37 [Erythrobacter litoralis HTCC2594]
 gi|84788554|gb|ABC64736.1| Peptidase M23/M37 [Erythrobacter litoralis HTCC2594]
          Length = 377

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V YVG      G T+ I H + ++T Y+H+     ++GQKV  G  IG  G +G +  P 
Sbjct: 280 VSYVGWK-SGYGKTVEIDHGNGLMTRYAHMSRFVAKRGQKVDAGSPIGAIGSTGRSTGPH 338

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N  A++P  FLE
Sbjct: 339 LHFEVRINERAVNPRPFLE 357


>gi|332295074|ref|YP_004436997.1| Peptidase M23 [Thermodesulfobium narugense DSM 14796]
 gi|332178177|gb|AEE13866.1| Peptidase M23 [Thermodesulfobium narugense DSM 14796]
          Length = 314

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 40/79 (50%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G  L   G T++I H +   T+Y+H     V+ GQ+V +   I   G +G    P
Sbjct: 229 VVVFAGWYLSGYGLTVIIDHGNGYETLYAHDSAFAVKVGQRVKKDQVIAYIGLTGFTTGP 288

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VH+E+      ++P+  +
Sbjct: 289 HVHYEVHHYGRVINPMSVI 307


>gi|227327751|ref|ZP_03831775.1| lipoprotein NlpD [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 340

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q V+ G  I   G +G +   +
Sbjct: 261 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQDVTAGQKIATMGSTGTSS-VR 319

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 320 LHFEIRYKGKSVNPLRFLPQR 340


>gi|251793633|ref|YP_003008363.1| outer membrane antigenic lipoprotein B [Aggregatibacter aphrophilus
           NJ8700]
 gi|247535030|gb|ACS98276.1| outer membrane antigenic lipoprotein B [Aggregatibacter aphrophilus
           NJ8700]
          Length = 402

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V+  Q+V  G  I   G +G     +
Sbjct: 323 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDSILVKDQQEVKAGQQIAKMGSTG-TNGVK 381

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  +
Sbjct: 382 LHFEIRYKGKSVDPTRYLPRR 402


>gi|116074888|ref|ZP_01472149.1| Peptidoglycan-binding LysM [Synechococcus sp. RS9916]
 gi|116068110|gb|EAU73863.1| Peptidoglycan-binding LysM [Synechococcus sp. RS9916]
          Length = 338

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G      G  + + H D   T Y+H     V+KGQ V +G TI L G +G +  P
Sbjct: 255 VVVYSGWS-SGYGYLVEMSHGDGTSTRYAHNSRLLVRKGQLVPQGQTISLMGSTGRSTGP 313

Query: 61  QVHFELRK-NAIAMDPIKFLEEK 82
            +HFE+RK    A+DP+  L  +
Sbjct: 314 HLHFEIRKPGGAAVDPMSLLSSR 336


>gi|268591357|ref|ZP_06125578.1| lipoprotein NlpD [Providencia rettgeri DSM 1131]
 gi|291313334|gb|EFE53787.1| lipoprotein NlpD [Providencia rettgeri DSM 1131]
          Length = 356

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V+  Q V+ G  I   G +G +   +
Sbjct: 277 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTLLVRDQQDVTAGQKIATMGSTGTSS-VR 335

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 336 LHFEIRYKGKSVNPLRYLPQR 356


>gi|332529100|ref|ZP_08405064.1| peptidase M23 [Hylemonella gracilis ATCC 19624]
 gi|332041323|gb|EGI77685.1| peptidase M23 [Hylemonella gracilis ATCC 19624]
          Length = 339

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+I+H+++ +T Y+H     V++ Q V RG  I   G S +A   +
Sbjct: 260 VVYAGSGLRGYGNLIIIKHNNTYLTAYAHNRALLVKEDQAVKRGQKIAEMGNS-DADRVK 318

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    ++P ++L ++
Sbjct: 319 LHFEVRRQGKPVNPAQYLPKR 339


>gi|296327835|ref|ZP_06870372.1| cell wall metalloendopeptidase [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|296155049|gb|EFG95829.1| cell wall metalloendopeptidase [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 372

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+I+HD+   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 294 VVTFAGN-MSGYGKIIIIKHDNGYETRYAHLSVISTNVGEHVNKGDLIGKTGNSGRTTGA 352

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 353 HLHFEIRHNGVPKNPMKYLQ 372


>gi|322831413|ref|YP_004211440.1| Peptidase M23 [Rahnella sp. Y9602]
 gi|321166614|gb|ADW72313.1| Peptidase M23 [Rahnella sp. Y9602]
          Length = 340

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 261 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVQAGQKIATMGSTGTSS-VR 319

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 320 LHFEIRYKGKSVNPLRYLPQR 340


>gi|300718098|ref|YP_003742901.1| Lipoprotein [Erwinia billingiae Eb661]
 gi|299063934|emb|CAX61054.1| Lipoprotein [Erwinia billingiae Eb661]
          Length = 388

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 309 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 367

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 368 LHFEIRYKGKSVNPLRYLPQR 388


>gi|313893726|ref|ZP_07827293.1| peptidase, M23 family [Veillonella sp. oral taxon 158 str. F0412]
 gi|313441740|gb|EFR60165.1| peptidase, M23 family [Veillonella sp. oral taxon 158 str. F0412]
          Length = 401

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G  +   G  ++I H + + T+Y+H     V +GQ V +G  +  +G +GN+  P 
Sbjct: 325 VVWSGW-MGGYGYAVVIDHGNGMSTLYAHNSELAVSEGQDVGKGQVVAYAGSTGNSTGPH 383

Query: 62  VHFELRKNAIAMDPIKFL 79
           VHFE+R +   +DP+ +L
Sbjct: 384 VHFEVRISGDPVDPMGYL 401


>gi|148255346|ref|YP_001239931.1| putative metalloendopeptidase [Bradyrhizobium sp. BTAi1]
 gi|146407519|gb|ABQ36025.1| putative metalloendopeptidase [Bradyrhizobium sp. BTAi1]
          Length = 453

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  + + H + + T Y H+    V+ GQ+V  G  IG  G +G +  P 
Sbjct: 368 VVNAGWS-GGYGRMVEVDHGNGLSTRYGHLSEINVKIGQQVKIGDIIGEVGSTGRSTGPH 426

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R +  A+DP KFL 
Sbjct: 427 LHYETRIDGEAVDPQKFLR 445


>gi|315499740|ref|YP_004088543.1| peptidase m23 [Asticcacaulis excentricus CB 48]
 gi|315417752|gb|ADU14392.1| Peptidase M23 [Asticcacaulis excentricus CB 48]
          Length = 379

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + I H +   T Y+H+ +  V+ GQ+V  G  +G  G +G +   
Sbjct: 293 IVSFAG-VRSGYGNCVEIDHGNGFKTRYAHMQSFAVRAGQRVGVGQRVGAMGSTGRSTGV 351

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+  N    +P +F++
Sbjct: 352 HLHYEVWLNGRPQNPARFVK 371


>gi|261822743|ref|YP_003260849.1| lipoprotein NlpD [Pectobacterium wasabiae WPP163]
 gi|261606756|gb|ACX89242.1| Peptidase M23 [Pectobacterium wasabiae WPP163]
          Length = 345

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q V+ G  I   G +G +   +
Sbjct: 266 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQDVTAGQKIATMGSTGTSS-VR 324

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++FL ++
Sbjct: 325 LHFEIRYKGKSVNPLRFLPQR 345


>gi|116669360|ref|YP_830293.1| peptidase M23B [Arthrobacter sp. FB24]
 gi|116609469|gb|ABK02193.1| peptidase M23B [Arthrobacter sp. FB24]
          Length = 253

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      GN ++I H + + T Y+H+ +  VQ GQKV+RG  + LSG +G +    
Sbjct: 176 VTFSGWHPYGGGNRVVIDHGNGLETTYNHLSSSSVQVGQKVNRGDVVALSGTTGASTGCH 235

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+  N   +DP+ +L
Sbjct: 236 LHFEVMVNGEVVDPLGWL 253


>gi|3820468|emb|CAA76806.1| NlpD [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
          Length = 105

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 26  VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 84

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 85  LHFEIRYKGKSVNPLRYLPQR 105


>gi|317128766|ref|YP_004095048.1| peptidase M23 [Bacillus cellulosilyticus DSM 2522]
 gi|315473714|gb|ADU30317.1| Peptidase M23 [Bacillus cellulosilyticus DSM 2522]
          Length = 308

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V          GNTI+I H +   T+Y+H++   V+ G  V +G  IG  G +G +    
Sbjct: 225 VTLADWH-GGYGNTIIIDHGNGYETLYAHLNYIDVEVGDNVKKGDHIGGMGTTGRSTGVH 283

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+ ++   +DP  ++
Sbjct: 284 LHYEILRDGEHIDPYIYM 301


>gi|254504111|ref|ZP_05116262.1| M23 peptidase domain protein [Labrenzia alexandrii DFL-11]
 gi|222440182|gb|EEE46861.1| M23 peptidase domain protein [Labrenzia alexandrii DFL-11]
          Length = 477

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 52/81 (64%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY GN+L   GN +L+RHD+  V+ Y+H     V++G  V RG  + L+G +G+   PQ
Sbjct: 397 VIYAGNELKGYGNLVLVRHDEGWVSAYAHNSVLNVKRGDTVRRGDPVALAGATGSVNQPQ 456

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           VHFELR+    +DP+K+L  +
Sbjct: 457 VHFELRQGNKPVDPLKYLPRR 477


>gi|118589127|ref|ZP_01546534.1| Peptidase M23B [Stappia aggregata IAM 12614]
 gi|118438456|gb|EAV45090.1| Peptidase M23B [Stappia aggregata IAM 12614]
          Length = 326

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 52/81 (64%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY GN+L   GN IL+RHDD  V+ Y+H     V++G  + RG  + L+G +G+   PQ
Sbjct: 246 VIYSGNELKGYGNLILVRHDDGWVSAYAHNSELKVKRGDTIRRGDVVALAGATGSVNQPQ 305

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR+    +DP+K+L  +
Sbjct: 306 LHFELRQGNKPVDPLKYLPRR 326


>gi|146340486|ref|YP_001205534.1| putative metalloendopeptidase [Bradyrhizobium sp. ORS278]
 gi|146193292|emb|CAL77308.1| putative metalloendopeptidase [Bradyrhizobium sp. ORS278]
          Length = 408

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  + + H + + T Y H+    V+ GQ+V  G  +G  G +G +  P 
Sbjct: 323 VVNAGWS-GGYGRMVEVDHGNGLSTRYGHLSEINVKIGQQVKIGDIVGEVGSTGRSTGPH 381

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R +  A+DP KFL 
Sbjct: 382 LHYETRIDGEAVDPQKFLR 400


>gi|85716187|ref|ZP_01047162.1| Peptidase M23B [Nitrobacter sp. Nb-311A]
 gi|85697020|gb|EAQ34903.1| Peptidase  M23B [Nitrobacter sp. Nb-311A]
          Length = 446

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 50/80 (62%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G  + RG  I  SG+SG A  P
Sbjct: 365 VVAYAGNELKGYGNLVLVRHSNGYVTAYAHASNLLVKRGDSIKRGQVIAKSGQSGEAGSP 424

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK +  +DP+ FL 
Sbjct: 425 QLHFEIRKGSTPVDPLNFLN 444


>gi|313895936|ref|ZP_07829490.1| peptidase, M23 family [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312975361|gb|EFR40822.1| peptidase, M23 family [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 330

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  +   G  ++I H   I T+Y H  +  V  GQ V++G  I   G +GN+  P 
Sbjct: 254 VEYAGW-ISGYGYAVIINHGGGISTLYGHCQSLEVSTGQSVAQGELIAECGSTGNSTGPH 312

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R +   ++P+++L
Sbjct: 313 CHFEVRVSGEPVNPLEYL 330


>gi|257060096|ref|YP_003137984.1| peptidase M23 [Cyanothece sp. PCC 8802]
 gi|256590262|gb|ACV01149.1| Peptidase M23 [Cyanothece sp. PCC 8802]
          Length = 727

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G +    G  + +RH D  VT+Y+H     V++GQ+V +G  I   G +G +  P 
Sbjct: 645 VITSGWNSGGYGKLVKVRHPDGSVTLYAHNSRLLVRRGQQVEQGQQIAEMGSTGYSTGPH 704

Query: 62  VHFELRKNAI-AMDPIKFLEEK 82
           +HFE+  N   A++PI  L  K
Sbjct: 705 LHFEVHPNGRGAVNPIAMLPRK 726


>gi|218247020|ref|YP_002372391.1| peptidase M23 [Cyanothece sp. PCC 8801]
 gi|218167498|gb|ACK66235.1| Peptidase M23 [Cyanothece sp. PCC 8801]
          Length = 727

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G +    G  + +RH D  VT+Y+H     V++GQ+V +G  I   G +G +  P 
Sbjct: 645 VITSGWNSGGYGKLVKVRHPDGSVTLYAHNSRLLVRRGQQVEQGQQIAEMGSTGYSTGPH 704

Query: 62  VHFELRKNAI-AMDPIKFLEEK 82
           +HFE+  N   A++PI  L  K
Sbjct: 705 LHFEVHPNGRGAVNPIAMLPRK 726


>gi|281417452|ref|ZP_06248472.1| Peptidase M23 [Clostridium thermocellum JW20]
 gi|281408854|gb|EFB39112.1| Peptidase M23 [Clostridium thermocellum JW20]
          Length = 373

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ G +    G T++I H   I T+Y+H     V KG KV +G TI  +G +G A   
Sbjct: 295 IVIFSGWED-GYGYTVIIDHGGGITTLYAHCSKLLVNKGDKVRKGQTIAQAGSTGTATGS 353

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R +    +P+ +++
Sbjct: 354 HLHFEVRIDGNVTNPLDYIK 373


>gi|220930240|ref|YP_002507149.1| peptidase M23 [Clostridium cellulolyticum H10]
 gi|220000568|gb|ACL77169.1| Peptidase M23 [Clostridium cellulolyticum H10]
          Length = 282

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G      G  I+I HD+   T+Y H     V KG+ V +G  I L G +G +  P 
Sbjct: 199 VIYAGYS-SGYGRHIIIDHDNGFKTIYGHSSKLLVNKGKTVKKGQKIALVGSTGRSTGPH 257

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R + IA+DPIK++E K
Sbjct: 258 LHFEIRISDIAVDPIKYIEFK 278


>gi|125973252|ref|YP_001037162.1| peptidase M23B [Clostridium thermocellum ATCC 27405]
 gi|256003730|ref|ZP_05428718.1| Peptidase M23 [Clostridium thermocellum DSM 2360]
 gi|125713477|gb|ABN51969.1| peptidase M23B [Clostridium thermocellum ATCC 27405]
 gi|255992291|gb|EEU02385.1| Peptidase M23 [Clostridium thermocellum DSM 2360]
 gi|316940517|gb|ADU74551.1| Peptidase M23 [Clostridium thermocellum DSM 1313]
          Length = 373

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ G +    G T++I H   I T+Y+H     V KG KV +G TI  +G +G A   
Sbjct: 295 IVIFSGWED-GYGYTVIIDHGGGITTLYAHCSKLLVNKGDKVRKGQTIAQAGSTGTATGS 353

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R +    +P+ +++
Sbjct: 354 HLHFEVRIDGNVTNPLDYIK 373


>gi|6175917|gb|AAF05333.1|AF182102_1 lipoprotein [Escherichia coli]
 gi|6175923|gb|AAF05337.1|AF182104_1 lipoprotein [Escherichia coli]
 gi|6175926|gb|AAF05339.1|AF182105_1 lipoprotein [Escherichia coli]
 gi|6175929|gb|AAF05341.1|AF182106_1 lipoprotein [Escherichia coli]
 gi|6175932|gb|AAF05343.1|AF182107_1 lipoprotein [Escherichia coli]
          Length = 162

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 83  VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 141

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 142 LHFEIRYKGKSVNPLRYLPQR 162


>gi|121535113|ref|ZP_01666930.1| peptidase M23B [Thermosinus carboxydivorans Nor1]
 gi|121306363|gb|EAX47288.1| peptidase M23B [Thermosinus carboxydivorans Nor1]
          Length = 300

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      G T++I H     T+Y H+    V  GQ V  G  I   G +G +  P 
Sbjct: 223 VIFTGWK-GGYGYTVMIEHGAEYTTLYGHLADYVVTLGQYVETGQLIAYMGNTGYSTGPH 281

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    ++P+  L 
Sbjct: 282 LHFEVRRGGQPVNPLSVLP 300


>gi|310659387|ref|YP_003937108.1| peptidase m23b [Clostridium sticklandii DSM 519]
 gi|308826165|emb|CBH22203.1| Peptidase M23B precursor [Clostridium sticklandii]
          Length = 373

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      G  +++ H   IVT+Y+H  +  V  GQ V +G TI   G +G +  P 
Sbjct: 295 VIFAGTK-GSYGKAVIVDHGGGIVTLYAHCSSILVSDGQDVKKGETIAKVGSTGYSTGPH 353

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N   ++P  ++
Sbjct: 354 LHFEVRVNGDYVNPASYI 371


>gi|326204312|ref|ZP_08194171.1| Peptidase M23 [Clostridium papyrosolvens DSM 2782]
 gi|325985587|gb|EGD46424.1| Peptidase M23 [Clostridium papyrosolvens DSM 2782]
          Length = 375

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G +    GN ++I H   + T+Y+H     VQ+G  + +G T+G  G +G +  P 
Sbjct: 298 VIMAGWN-GGYGNCVIIDHGGGLATLYAHQSKIMVQEGDYLKKGDTVGKVGTTGLSTGPH 356

Query: 62  VHFELRKNAIAMDPIKF 78
           +HFE+RK+    +P+ +
Sbjct: 357 LHFEVRKSGNTTNPLDY 373


>gi|258517058|ref|YP_003193280.1| Peptidase M23 [Desulfotomaculum acetoxidans DSM 771]
 gi|257780763|gb|ACV64657.1| Peptidase M23 [Desulfotomaculum acetoxidans DSM 771]
          Length = 376

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI VG+ +   GN ++I H   ++T+Y+H+    V  GQ+V+RG  I   G +G +  P 
Sbjct: 300 VIQVGS-MTGYGNIVMINHGGGLITLYAHLSRQLVSSGQQVTRGQVIAKVGSTGMSTGPH 358

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N  A++P+ +L
Sbjct: 359 LHFEVRLNGSAVNPMGYL 376


>gi|92117858|ref|YP_577587.1| peptidase M23B [Nitrobacter hamburgensis X14]
 gi|91800752|gb|ABE63127.1| peptidase M23B [Nitrobacter hamburgensis X14]
          Length = 455

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  + I H + + T Y H+    V+ GQ +  G  +G  G +G +  P 
Sbjct: 370 VVSAGWA-GGYGRMVEIDHGNGLSTRYGHLSAIDVKVGQSIKIGQVVGEVGSTGRSTGPH 428

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R +  A+DP KFL 
Sbjct: 429 LHYETRIDGDAVDPQKFLR 447


>gi|19703812|ref|NP_603374.1| cell wall endopeptidase [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|19713960|gb|AAL94673.1| Cell wall endopeptidase family M23/M37 [Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586]
          Length = 321

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+I+HD+   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 243 VVTFAGN-MSGYGKIIIIKHDNGYETRYAHLSVISTNVGEHVNKGDLIGKTGNSGRTTGA 301

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 302 HLHFEIRHNGVPKNPMKYLQ 321


>gi|260437820|ref|ZP_05791636.1| peptidase, M23B family [Butyrivibrio crossotus DSM 2876]
 gi|292809844|gb|EFF69049.1| peptidase, M23B family [Butyrivibrio crossotus DSM 2876]
          Length = 518

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      G  + IRH D  +T Y H+++  V  GQ V++G  I  SG +G +  P
Sbjct: 440 VVTMAGW-YGNYGYCVDIRHSDGSMTRYGHLNSIAVTYGQTVTQGQVIAYSGNTGYSTGP 498

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R N  +++P+ ++
Sbjct: 499 HLHFEIRINGQSVNPLNYI 517


>gi|150391820|ref|YP_001321869.1| peptidase M23B [Alkaliphilus metalliredigens QYMF]
 gi|149951682|gb|ABR50210.1| peptidase M23B [Alkaliphilus metalliredigens QYMF]
          Length = 377

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G+     G T++I H  SIVT+Y+H     V  G +V+ G  I  +G +G +  P 
Sbjct: 298 VILAGDQ-GGYGRTVMIDHGGSIVTLYAHNSRLVVSVGDQVTTGQVIAKAGSTGMSTGPH 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+N   +DP+ ++  +
Sbjct: 357 LHFEVRENGKYVDPMPYVRGR 377


>gi|307294968|ref|ZP_07574810.1| Peptidase M23 [Sphingobium chlorophenolicum L-1]
 gi|306879442|gb|EFN10660.1| Peptidase M23 [Sphingobium chlorophenolicum L-1]
          Length = 392

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VG      GN + + H + ++T Y+H+     + GQ V+RG  I   G +G +  P 
Sbjct: 292 VSFVG-QRSGYGNVVEVTHGNGLMTRYAHLSRFDARIGQSVARGEKIARMGSTGRSTGPH 350

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R N  A++P +FLE +
Sbjct: 351 LHFEVRVNGNAINPRRFLEAR 371


>gi|292900378|ref|YP_003539747.1| lipoprotein [Erwinia amylovora ATCC 49946]
 gi|291200226|emb|CBJ47354.1| lipoprotein [Erwinia amylovora ATCC 49946]
          Length = 379

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 358

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 359 LHFEIRYKGKSVNPLRYLPQR 379


>gi|213029653|ref|ZP_03344100.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar Typhi
           str. 404ty]
          Length = 125

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 46  VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 104

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 105 LHFEIRYKGKSVNPLRYLPQR 125


>gi|6643919|gb|AAF20815.1|AF198628_1 NlpD [Xenorhabdus nematophila]
          Length = 154

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HDD  ++ Y+H DT  V++ Q V  G  I   G +G +   +
Sbjct: 75  VVYAGNALRGYGNLIIIKHDDDYLSAYAHNDTMLVREQQDVQAGQKISTMGSTGTSS-VR 133

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 134 LHFEIRYKGKSVNPLRYLSQR 154


>gi|292487250|ref|YP_003530122.1| lipoprotein nlpD/lppB [Erwinia amylovora CFBP1430]
 gi|291552669|emb|CBA19714.1| Lipoprotein nlpD/lppB homolog precursor [Erwinia amylovora
           CFBP1430]
 gi|312171352|emb|CBX79611.1| Lipoprotein nlpD/lppB homolog precursor [Erwinia amylovora ATCC
           BAA-2158]
          Length = 377

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|152993704|ref|YP_001359425.1| M24/M37 family peptidase [Sulfurovum sp. NBC37-1]
 gi|151425565|dbj|BAF73068.1| peptidase, M23/M37 family [Sulfurovum sp. NBC37-1]
          Length = 429

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G      G  + IRH     + Y+H     V++GQKV +G  IG  G SG +  P 
Sbjct: 279 VSYAGWK-GGYGRVVQIRHGGGYESFYAHQSRMRVKRGQKVKKGQIIGYVGSSGRSTGPH 337

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HF L+KN   +DP+K+L +K
Sbjct: 338 LHFGLKKNGRWVDPMKYLRKK 358


>gi|316934002|ref|YP_004108984.1| peptidase M23 [Rhodopseudomonas palustris DX-1]
 gi|315601716|gb|ADU44251.1| Peptidase M23 [Rhodopseudomonas palustris DX-1]
          Length = 479

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 52/80 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G++L   GN +LIRH +  V+ Y+H     V++G+ + RG  I  SG+SG+   P
Sbjct: 398 VVAYAGSELKGYGNLVLIRHSNGYVSAYAHASELMVKRGESIKRGQVIAKSGQSGDVSSP 457

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK +  +DP+KFL 
Sbjct: 458 QLHFEIRKGSTPVDPLKFLN 477


>gi|153009667|ref|YP_001370882.1| peptidase M23B [Ochrobactrum anthropi ATCC 49188]
 gi|151561555|gb|ABS15053.1| peptidase M23B [Ochrobactrum anthropi ATCC 49188]
          Length = 438

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  +  SG SGNA+ P
Sbjct: 358 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQILVQRGQKVRRGEEVAKSGMSGNAKSP 417

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 418 KLHFEVRKNSAPVNPSKYLES 438


>gi|254304071|ref|ZP_04971429.1| M23B subfamily peptidase [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148324263|gb|EDK89513.1| M23B subfamily peptidase [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 372

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRHD+   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 294 VVTFAGN-MSGYGKIIIIRHDNGYETRYAHLSVISTNVGEHVNKGDLIGKTGNSGRTTGA 352

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 353 HLHFEIRHNGVPKNPMKYLQ 372


>gi|303240522|ref|ZP_07327038.1| Peptidase M23 [Acetivibrio cellulolyticus CD2]
 gi|302591924|gb|EFL61656.1| Peptidase M23 [Acetivibrio cellulolyticus CD2]
          Length = 307

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +   +    G  ++I H + I T+Y H     V++GQ V +G  I   G +G +  P 
Sbjct: 228 VTFADVN-GNYGKCVIINHSNGITTLYGHASKLLVKEGQNVKKGDVIAKVGSTGRSTGPH 286

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R N   ++PI +L++K
Sbjct: 287 LHFEVRVNGNQVNPIDYLDKK 307


>gi|257454693|ref|ZP_05619949.1| M23 peptidase domain protein [Enhydrobacter aerosaccus SK60]
 gi|257448003|gb|EEV22990.1| M23 peptidase domain protein [Enhydrobacter aerosaccus SK60]
          Length = 231

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + + H +  VT Y+H    YV  G  V     I   G +G +   
Sbjct: 148 VVTFSGWGT-GYGRYVEVDHGNGTVTRYTHTSANYVNVGDTVYANQQIAAVGNTGRSTGA 206

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R+N  A++P  +L
Sbjct: 207 HLHYEVRQNGQAVNPQTYL 225


>gi|37520359|ref|NP_923736.1| hypothetical protein glr0790 [Gloeobacter violaceus PCC 7421]
 gi|35211352|dbj|BAC88731.1| glr0790 [Gloeobacter violaceus PCC 7421]
          Length = 389

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G      G  +++ H  ++ T+Y+H    +V  GQ V +G  +   G +G +  P 
Sbjct: 312 VLYAGW-YGGYGRCVIVSHGGTLSTLYAHASRLFVTVGQTVKKGDPLAAVGSTGFSTGPH 370

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N   ++P+ +L 
Sbjct: 371 LHFEVRVNGSPVNPLDYLR 389


>gi|254454170|ref|ZP_05067607.1| peptidase, M23/M37 family [Octadecabacter antarcticus 238]
 gi|198268576|gb|EDY92846.1| peptidase, M23/M37 family [Octadecabacter antarcticus 238]
          Length = 431

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + ++H   I T Y+H +   V+ GQ++SRG  IG  G SG +  P
Sbjct: 347 VVTFAGWS-SGYGRLVKVQHAFGIETRYAHQNRIRVEVGQRLSRGDRIGDIGNSGRSTGP 405

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R     ++P+ ++ 
Sbjct: 406 HLHYEIRVGGRPVNPMIYIR 425


>gi|289805537|ref|ZP_06536166.1| lipoprotein NlpD [Salmonella enterica subsp. enterica serovar
          Typhi str. AG3]
 gi|558644|emb|CAA57639.1| unnamed protein product [Salmonella enterica]
          Length = 94

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2  VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
          V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 15 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 73

Query: 62 VHFELRKNAIAMDPIKFLEEK 82
          +HFE+R    +++P+++L ++
Sbjct: 74 LHFEIRYKGKSVNPLRYLPQR 94


>gi|304399207|ref|ZP_07381074.1| Peptidase M23 [Pantoea sp. aB]
 gi|304353261|gb|EFM17641.1| Peptidase M23 [Pantoea sp. aB]
          Length = 322

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 243 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 301

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 302 LHFEIRYKGKSVNPLRYLPQR 322


>gi|56697093|ref|YP_167456.1| M24/M37 family peptidase [Ruegeria pomeroyi DSS-3]
 gi|56678830|gb|AAV95496.1| peptidase, M23/M37 family [Ruegeria pomeroyi DSS-3]
          Length = 497

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  I IRH   I T Y+H     V+ GQ+VSRG  I   G +G +   
Sbjct: 413 VVTHAGWQ-SGFGKLIKIRHAFGIETYYAHNSQLRVKVGQRVSRGDHIADMGSTGRSTGT 471

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+  N   ++P+ +++
Sbjct: 472 HLHYEVHVNGRPVNPMTYIK 491


>gi|192291552|ref|YP_001992157.1| peptidase M23 [Rhodopseudomonas palustris TIE-1]
 gi|192285301|gb|ACF01682.1| Peptidase M23 [Rhodopseudomonas palustris TIE-1]
          Length = 471

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 51/80 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G++L   GN +LIRH +  V+ Y+H     V++G+ + RG  I  SG+SG    P
Sbjct: 390 VVAYAGSELKGYGNLVLIRHSNGYVSAYAHASELMVKRGETIKRGQVIAKSGQSGEVSSP 449

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK +  +DP+KFL 
Sbjct: 450 QLHFEIRKGSTPVDPLKFLN 469


>gi|39935904|ref|NP_948180.1| peptidase M23B [Rhodopseudomonas palustris CGA009]
 gi|39649758|emb|CAE28279.1| Peptidoglycan-binding LysM:Peptidase M23/M37 [Rhodopseudomonas
           palustris CGA009]
          Length = 471

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 51/80 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G++L   GN +LIRH +  V+ Y+H     V++G+ + RG  I  SG+SG    P
Sbjct: 390 VVAYAGSELKGYGNLVLIRHSNGYVSAYAHASELMVKRGETIKRGQVIAKSGQSGEVSSP 449

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK +  +DP+KFL 
Sbjct: 450 QLHFEIRKGSTPVDPLKFLN 469


>gi|253988172|ref|YP_003039528.1| lipoprotein NlpD [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253779622|emb|CAQ82783.1| lipoprotein nlpd [Photorhabdus asymbiotica]
          Length = 345

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V + Q +  G  I   G +G +   +
Sbjct: 266 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVSEQQDIKAGQKIATMGSTGTSS-VR 324

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 325 LHFEIRYKGKSVNPLRYLPQR 345


>gi|296125657|ref|YP_003632909.1| peptidase M23 [Brachyspira murdochii DSM 12563]
 gi|296017473|gb|ADG70710.1| Peptidase M23 [Brachyspira murdochii DSM 12563]
          Length = 412

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GN +++RHD    T Y H+++   + G  V  G  IG  G +G +    
Sbjct: 326 VIFAGYS-GGYGNLVIVRHDKGYTTYYGHLNSITTKAGANVGVGVMIGRMGSTGRSTGSH 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+N +A++P  F+  K
Sbjct: 385 LHFEVRRNGVALNPADFIPIK 405


>gi|326408908|gb|ADZ65973.1| outer membrane antigenic lipoprotein B precursor [Brucella
           melitensis M28]
          Length = 329

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 249 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 308

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 309 KLHFEVRKNSAPVNPTKYLES 329


>gi|306840381|ref|ZP_07473147.1| Outer membrane antigenic lipoprotein B precursor [Brucella sp. BO2]
 gi|306289645|gb|EFM60847.1| Outer membrane antigenic lipoprotein B precursor [Brucella sp. BO2]
          Length = 329

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 249 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 308

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 309 KLHFEVRKNSAPVNPTKYLES 329


>gi|306843786|ref|ZP_07476384.1| Outer membrane antigenic lipoprotein B precursor [Brucella sp. BO1]
 gi|306275864|gb|EFM57580.1| Outer membrane antigenic lipoprotein B precursor [Brucella sp. BO1]
          Length = 394

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 314 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 373

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 374 KLHFEVRKNSAPVNPTKYLES 394


>gi|294852242|ref|ZP_06792915.1| peptidase M23B [Brucella sp. NVSL 07-0026]
 gi|294820831|gb|EFG37830.1| peptidase M23B [Brucella sp. NVSL 07-0026]
          Length = 432

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 412 KLHFEVRKNSAPVNPTKYLES 432


>gi|261324995|ref|ZP_05964192.1| peptidase M23B [Brucella neotomae 5K33]
 gi|261300975|gb|EEY04472.1| peptidase M23B [Brucella neotomae 5K33]
          Length = 432

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 412 KLHFEVRKNSAPVNPTKYLES 432


>gi|261218755|ref|ZP_05933036.1| peptidase M23B [Brucella ceti M13/05/1]
 gi|261321746|ref|ZP_05960943.1| peptidase M23B [Brucella ceti M644/93/1]
 gi|260923844|gb|EEX90412.1| peptidase M23B [Brucella ceti M13/05/1]
 gi|261294436|gb|EEX97932.1| peptidase M23B [Brucella ceti M644/93/1]
          Length = 432

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 412 KLHFEVRKNSAPVNPTKYLES 432


>gi|256113435|ref|ZP_05454276.1| peptidase M23B [Brucella melitensis bv. 3 str. Ether]
 gi|265994824|ref|ZP_06107381.1| peptidase M23B [Brucella melitensis bv. 3 str. Ether]
 gi|262765937|gb|EEZ11726.1| peptidase M23B [Brucella melitensis bv. 3 str. Ether]
          Length = 432

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 412 KLHFEVRKNSAPVNPTKYLES 432


>gi|256060995|ref|ZP_05451152.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella neotomae
           5K33]
          Length = 427

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 347 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 406

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 407 KLHFEVRKNSAPVNPTKYLES 427


>gi|254718992|ref|ZP_05180803.1| peptidase M23B [Brucella sp. 83/13]
 gi|265983983|ref|ZP_06096718.1| peptidase M23B [Brucella sp. 83/13]
 gi|306840122|ref|ZP_07472908.1| Outer membrane antigenic lipoprotein B precursor [Brucella sp. NF
           2653]
 gi|264662575|gb|EEZ32836.1| peptidase M23B [Brucella sp. 83/13]
 gi|306404850|gb|EFM61143.1| Outer membrane antigenic lipoprotein B precursor [Brucella sp. NF
           2653]
          Length = 432

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 412 KLHFEVRKNSAPVNPTKYLES 432


>gi|254713991|ref|ZP_05175802.1| peptidase M23B [Brucella ceti M644/93/1]
 gi|254716950|ref|ZP_05178761.1| peptidase M23B [Brucella ceti M13/05/1]
          Length = 427

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 347 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 406

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 407 KLHFEVRKNSAPVNPTKYLES 427


>gi|189024074|ref|YP_001934842.1| peptidoglycan-binding LysM [Brucella abortus S19]
 gi|225627377|ref|ZP_03785414.1| Peptidoglycan-binding LysM [Brucella ceti str. Cudo]
 gi|225852401|ref|YP_002732634.1| peptidase M23B [Brucella melitensis ATCC 23457]
 gi|237815319|ref|ZP_04594317.1| Peptidoglycan-binding LysM [Brucella abortus str. 2308 A]
 gi|254689138|ref|ZP_05152392.1| peptidase M23B [Brucella abortus bv. 6 str. 870]
 gi|254709990|ref|ZP_05171801.1| peptidase M23B [Brucella pinnipedialis B2/94]
 gi|254730171|ref|ZP_05188749.1| peptidase M23B [Brucella abortus bv. 4 str. 292]
 gi|256044562|ref|ZP_05447466.1| peptidase M23B [Brucella melitensis bv. 1 str. Rev.1]
 gi|256159610|ref|ZP_05457372.1| peptidase M23B [Brucella ceti M490/95/1]
 gi|256264102|ref|ZP_05466634.1| peptidoglycan-binding LysM [Brucella melitensis bv. 2 str. 63/9]
 gi|260545420|ref|ZP_05821161.1| peptidoglycan-binding LysM [Brucella abortus NCTC 8038]
 gi|260563914|ref|ZP_05834400.1| peptidoglycan-binding LysM [Brucella melitensis bv. 1 str. 16M]
 gi|260754638|ref|ZP_05866986.1| peptidase M23B [Brucella abortus bv. 6 str. 870]
 gi|260757861|ref|ZP_05870209.1| peptidase M23B [Brucella abortus bv. 4 str. 292]
 gi|260761684|ref|ZP_05874027.1| peptidase M23B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883664|ref|ZP_05895278.1| peptidase M23B [Brucella abortus bv. 9 str. C68]
 gi|261213888|ref|ZP_05928169.1| peptidase M23B [Brucella abortus bv. 3 str. Tulya]
 gi|261222073|ref|ZP_05936354.1| peptidase M23B [Brucella ceti B1/94]
 gi|261314365|ref|ZP_05953562.1| peptidase M23B [Brucella pinnipedialis M163/99/10]
 gi|261317539|ref|ZP_05956736.1| peptidase M23B [Brucella pinnipedialis B2/94]
 gi|261752206|ref|ZP_05995915.1| peptidase M23B [Brucella suis bv. 5 str. 513]
 gi|261758092|ref|ZP_06001801.1| peptidoglycan-binding LysM [Brucella sp. F5/99]
 gi|265988573|ref|ZP_06101130.1| peptidase M23B [Brucella pinnipedialis M292/94/1]
 gi|265990987|ref|ZP_06103544.1| peptidase M23B [Brucella melitensis bv. 1 str. Rev.1]
 gi|265998038|ref|ZP_06110595.1| peptidase M23B [Brucella ceti M490/95/1]
 gi|297248238|ref|ZP_06931956.1| peptidase M23B [Brucella abortus bv. 5 str. B3196]
 gi|189019646|gb|ACD72368.1| Peptidoglycan-binding LysM [Brucella abortus S19]
 gi|225617382|gb|EEH14427.1| Peptidoglycan-binding LysM [Brucella ceti str. Cudo]
 gi|225640766|gb|ACO00680.1| peptidase M23B [Brucella melitensis ATCC 23457]
 gi|237790156|gb|EEP64366.1| Peptidoglycan-binding LysM [Brucella abortus str. 2308 A]
 gi|260096827|gb|EEW80702.1| peptidoglycan-binding LysM [Brucella abortus NCTC 8038]
 gi|260153930|gb|EEW89022.1| peptidoglycan-binding LysM [Brucella melitensis bv. 1 str. 16M]
 gi|260668179|gb|EEX55119.1| peptidase M23B [Brucella abortus bv. 4 str. 292]
 gi|260672116|gb|EEX58937.1| peptidase M23B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674746|gb|EEX61567.1| peptidase M23B [Brucella abortus bv. 6 str. 870]
 gi|260873192|gb|EEX80261.1| peptidase M23B [Brucella abortus bv. 9 str. C68]
 gi|260915495|gb|EEX82356.1| peptidase M23B [Brucella abortus bv. 3 str. Tulya]
 gi|260920657|gb|EEX87310.1| peptidase M23B [Brucella ceti B1/94]
 gi|261296762|gb|EEY00259.1| peptidase M23B [Brucella pinnipedialis B2/94]
 gi|261303391|gb|EEY06888.1| peptidase M23B [Brucella pinnipedialis M163/99/10]
 gi|261738076|gb|EEY26072.1| peptidoglycan-binding LysM [Brucella sp. F5/99]
 gi|261741959|gb|EEY29885.1| peptidase M23B [Brucella suis bv. 5 str. 513]
 gi|262552506|gb|EEZ08496.1| peptidase M23B [Brucella ceti M490/95/1]
 gi|263001771|gb|EEZ14346.1| peptidase M23B [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094304|gb|EEZ18165.1| peptidoglycan-binding LysM [Brucella melitensis bv. 2 str. 63/9]
 gi|264660770|gb|EEZ31031.1| peptidase M23B [Brucella pinnipedialis M292/94/1]
 gi|297175407|gb|EFH34754.1| peptidase M23B [Brucella abortus bv. 5 str. B3196]
 gi|326538626|gb|ADZ86841.1| peptidase M23B [Brucella melitensis M5-90]
          Length = 432

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 412 KLHFEVRKNSAPVNPTKYLES 432


>gi|163843159|ref|YP_001627563.1| Outer membrane antigenic lipoprotein B precursor [Brucella suis
           ATCC 23445]
 gi|163673882|gb|ABY37993.1| Outer membrane antigenic lipoprotein B precursor [Brucella suis
           ATCC 23445]
          Length = 432

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 412 KLHFEVRKNSAPVNPTKYLES 432


>gi|161618848|ref|YP_001592735.1| Outer membrane antigenic lipoprotein B precursor [Brucella canis
           ATCC 23365]
 gi|260566555|ref|ZP_05837025.1| peptidoglycan-binding LysM [Brucella suis bv. 4 str. 40]
 gi|261754865|ref|ZP_05998574.1| peptidase M23B [Brucella suis bv. 3 str. 686]
 gi|161335659|gb|ABX61964.1| Outer membrane antigenic lipoprotein B precursor [Brucella canis
           ATCC 23365]
 gi|260156073|gb|EEW91153.1| peptidoglycan-binding LysM [Brucella suis bv. 4 str. 40]
 gi|261744618|gb|EEY32544.1| peptidase M23B [Brucella suis bv. 3 str. 686]
          Length = 432

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 352 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 411

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 412 KLHFEVRKNSAPVNPTKYLES 432


>gi|148559896|ref|YP_001258867.1| M24/M37 family peptidase [Brucella ovis ATCC 25840]
 gi|148371153|gb|ABQ61132.1| peptidase, M23/M37 family [Brucella ovis ATCC 25840]
          Length = 427

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 347 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 406

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 407 KLHFEVRKNSAPVNPTKYLES 427


>gi|23501774|ref|NP_697901.1| M24/M37 family peptidase [Brucella suis 1330]
 gi|254704196|ref|ZP_05166024.1| M24/M37 family peptidase [Brucella suis bv. 3 str. 686]
 gi|23347704|gb|AAN29816.1| peptidase, M23/M37 family [Brucella suis 1330]
          Length = 427

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 347 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 406

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 407 KLHFEVRKNSAPVNPTKYLES 427


>gi|17987362|ref|NP_539996.1| lipoprotein NlpD [Brucella melitensis bv. 1 str. 16M]
 gi|62289833|ref|YP_221626.1| M24/M37 family peptidase [Brucella abortus bv. 1 str. 9-941]
 gi|82699758|ref|YP_414332.1| peptidoglycan-binding protein LysM [Brucella melitensis biovar
           Abortus 2308]
 gi|254693622|ref|ZP_05155450.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella abortus bv.
           3 str. Tulya]
 gi|254697272|ref|ZP_05159100.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254701652|ref|ZP_05163480.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella suis bv. 5
           str. 513]
 gi|254706902|ref|ZP_05168730.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella
           pinnipedialis M163/99/10]
 gi|256031484|ref|ZP_05445098.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella
           pinnipedialis M292/94/1]
 gi|256254890|ref|ZP_05460426.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella ceti B1/94]
 gi|256257388|ref|ZP_05462924.1| peptidoglycan-binding LysM:peptidase M23/M37 [Brucella abortus bv.
           9 str. C68]
 gi|256369316|ref|YP_003106824.1| peptidase, M23/M37 family [Brucella microti CCM 4915]
 gi|260168618|ref|ZP_05755429.1| peptidase, M23/M37 family protein [Brucella sp. F5/99]
 gi|17983047|gb|AAL52260.1| lipoprotein nlpd [Brucella melitensis bv. 1 str. 16M]
 gi|62195965|gb|AAX74265.1| peptidase, M23/M37 family [Brucella abortus bv. 1 str. 9-941]
 gi|82615859|emb|CAJ10863.1| Peptidoglycan-binding LysM:Peptidase M23/M37 [Brucella melitensis
           biovar Abortus 2308]
 gi|255999476|gb|ACU47875.1| peptidase, M23/M37 family [Brucella microti CCM 4915]
          Length = 427

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  I  SG SGNA+ P
Sbjct: 347 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQIMVQRGQKVRRGEEIAKSGMSGNAKSP 406

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 407 KLHFEVRKNSAPVNPTKYLES 427


>gi|310814915|ref|YP_003962879.1| peptidase, M23/M37 family protein [Ketogulonicigenium vulgare Y25]
 gi|308753650|gb|ADO41579.1| peptidase, M23/M37 family protein [Ketogulonicigenium vulgare Y25]
          Length = 423

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      G  + IRH     T Y+H++   V+ GQ+VSRG  I  SG +G +  P 
Sbjct: 340 VTFAGWQ-SGYGRIVKIRHQFGFETRYAHLNEINVRVGQRVSRGDHIADSGNTGRSTGPH 398

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R N  A +P+ ++ 
Sbjct: 399 LHYEVRVNGAAQNPLNYIR 417


>gi|695758|emb|CAA57297.1| NlpD [Salmonella enterica subsp. enterica serovar Typhi]
          Length = 119

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 40  VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 98

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 99  LHFEIRYKGKSVNPLRYLPQR 119


>gi|332981018|ref|YP_004462459.1| peptidase M23 [Mahella australiensis 50-1 BON]
 gi|332698696|gb|AEE95637.1| Peptidase M23 [Mahella australiensis 50-1 BON]
          Length = 533

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G D    G  + + H + +VT Y+H     V+ GQ V++G  I   G +G +  P 
Sbjct: 459 VIFAGWD-GNYGKLVKVDHGNGMVTYYAHTSRIAVKIGQAVAKGQLIAYVGTTGRSTGPH 517

Query: 62  VHFELRKNAIAMDPIK 77
           VHFE+RKN   ++P++
Sbjct: 518 VHFEVRKNGKPINPMR 533


>gi|329928708|ref|ZP_08282557.1| peptidase, M23 family [Paenibacillus sp. HGF5]
 gi|328937489|gb|EGG33907.1| peptidase, M23 family [Paenibacillus sp. HGF5]
          Length = 422

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 3/80 (3%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSH--IDTPYVQKGQKVSRGHTIGLSGKSGNAQH 59
           VI         GN +++ H   + T+Y H       V +G KVSRG  I   G +G +  
Sbjct: 344 VILAEWW-SGYGNCVIVDHGGGVWTLYGHIRNGGIKVSEGDKVSRGQKIAEVGSTGQSTG 402

Query: 60  PQVHFELRKNAIAMDPIKFL 79
           P +HFE+R N   ++P  +L
Sbjct: 403 PHLHFEVRVNGSPVNPSPYL 422


>gi|315649801|ref|ZP_07902884.1| Peptidase M23 [Paenibacillus vortex V453]
 gi|315274775|gb|EFU38156.1| Peptidase M23 [Paenibacillus vortex V453]
          Length = 422

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 3/80 (3%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSH--IDTPYVQKGQKVSRGHTIGLSGKSGNAQH 59
           VI         GN +++ H   + T+Y H       V +G KVSRG  I   G +G +  
Sbjct: 344 VILAEWW-SGYGNCVIVDHGGGVWTLYGHIRNGGIKVSEGDKVSRGQKIAEVGSTGQSTG 402

Query: 60  PQVHFELRKNAIAMDPIKFL 79
           P +HFE+R N   ++P  +L
Sbjct: 403 PHLHFEVRVNGSPVNPSPYL 422


>gi|261409611|ref|YP_003245852.1| peptidase M23 [Paenibacillus sp. Y412MC10]
 gi|261286074|gb|ACX68045.1| Peptidase M23 [Paenibacillus sp. Y412MC10]
          Length = 422

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 3/80 (3%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSH--IDTPYVQKGQKVSRGHTIGLSGKSGNAQH 59
           VI         GN +++ H   + T+Y H       V +G KVSRG  I   G +G +  
Sbjct: 344 VILAEWW-SGYGNCVIVDHGGGVWTLYGHIRNGGIKVSEGDKVSRGQKIAEVGSTGQSTG 402

Query: 60  PQVHFELRKNAIAMDPIKFL 79
           P +HFE+R N   ++P  +L
Sbjct: 403 PHLHFEVRVNGSPVNPSPYL 422


>gi|260913451|ref|ZP_05919929.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
 gi|260632391|gb|EEX50564.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
          Length = 475

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H ++  V+  Q+VS G  I   G SG     +
Sbjct: 396 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNESILVKDQQEVSAGQQIAKMGSSGTNS-VK 454

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L ++
Sbjct: 455 LHFEIRYKGKSVDPMRYLPKR 475


>gi|284048029|ref|YP_003398368.1| Peptidase M23 [Acidaminococcus fermentans DSM 20731]
 gi|283952250|gb|ADB47053.1| Peptidase M23 [Acidaminococcus fermentans DSM 20731]
          Length = 377

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 49/79 (62%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G  +   GN ++I H   +VT+Y H  +  V +G++VS+G TI L+G +GN+  P 
Sbjct: 300 VVFAGW-MGGYGNAVMIDHGGGMVTLYGHNSSITVGEGEQVSKGQTIALAGSTGNSTGPH 358

Query: 62  VHFELRKNAIAMDPIKFLE 80
            HFE+R +   + P+++L 
Sbjct: 359 CHFEVRIHGEVVSPLQYLP 377


>gi|67920950|ref|ZP_00514469.1| Peptidase M23B [Crocosphaera watsonii WH 8501]
 gi|67857067|gb|EAM52307.1| Peptidase  M23B [Crocosphaera watsonii WH 8501]
          Length = 199

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G     LG  + IRH D  V+VY H     V  GQ V +G  I   G +G +  P
Sbjct: 96  VVVFAGWSNKGLGYQVSIRHPDGNVSVYGHNQRLLVTSGQNVEQGQQIAEMGSTGFSTGP 155

Query: 61  QVHFELRKNA-IAMDPIKFLEEKIP 84
            +HFE+R     A++PI FL  + P
Sbjct: 156 HLHFEIRPGGRKAINPIAFLPGQRP 180


>gi|89897609|ref|YP_521096.1| hypothetical protein DSY4863 [Desulfitobacterium hafniense Y51]
 gi|89337057|dbj|BAE86652.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 383

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN +++ H     T+Y H      + G  V  G  I   G +G +  P 
Sbjct: 306 VIMAGW-YGAYGNAVIVDHGGGYTTLYGHNSKLAAKVGDMVQAGDLISYVGSTGWSTGPH 364

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N    DP++F  
Sbjct: 365 LHFEVRINGETTDPMQFFR 383


>gi|219670736|ref|YP_002461171.1| peptidase M23 [Desulfitobacterium hafniense DCB-2]
 gi|219540996|gb|ACL22735.1| Peptidase M23 [Desulfitobacterium hafniense DCB-2]
          Length = 377

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN +++ H     T+Y H      + G  V  G  I   G +G +  P 
Sbjct: 300 VIMAGW-YGAYGNAVIVDHGGGYTTLYGHNSKLAAKVGDMVQAGDLISYVGSTGWSTGPH 358

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N    DP++F  
Sbjct: 359 LHFEVRINGETTDPMQFFR 377


>gi|262066965|ref|ZP_06026577.1| cell wall endopeptidase family M23/M37 [Fusobacterium periodonticum
           ATCC 33693]
 gi|291379313|gb|EFE86831.1| cell wall endopeptidase family M23/M37 [Fusobacterium periodonticum
           ATCC 33693]
          Length = 387

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRHD+   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 309 VVTFAGN-MSGYGKIIIIRHDNGYETRYAHLSVISTNVGEHVNQGDLIGKTGNSGRTTGA 367

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L 
Sbjct: 368 HLHFEIRHNGVPKNPMKYLR 387


>gi|160947220|ref|ZP_02094387.1| hypothetical protein PEPMIC_01153 [Parvimonas micra ATCC 33270]
 gi|158446354|gb|EDP23349.1| hypothetical protein PEPMIC_01153 [Parvimonas micra ATCC 33270]
          Length = 398

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 51/80 (63%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G +    GN ++I++ ++IV VY H  +  V+ GQ+VS+G  I L G +GN+  P
Sbjct: 319 VVISSGWN-GSYGNAVMIKYTNNIVIVYGHNSSLIVRAGQRVSKGQVISLVGSTGNSTGP 377

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N   +DP+K+L 
Sbjct: 378 HLHFEVRYNGYPVDPLKYLN 397


>gi|163754031|ref|ZP_02161154.1| hypothetical protein KAOT1_20452 [Kordia algicida OT-1]
 gi|161326245|gb|EDP97571.1| hypothetical protein KAOT1_20452 [Kordia algicida OT-1]
          Length = 324

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 45/78 (57%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+   N     G  I I H    V++Y+H+    V+KG+KV RG  IG  G +G +Q P
Sbjct: 222 VVVRADNSSSGFGKHIRIDHGYGYVSLYAHLSKYNVRKGRKVKRGDLIGFVGSTGRSQAP 281

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E+RKN   ++PI F
Sbjct: 282 HLHYEIRKNGEKINPINF 299


>gi|159043725|ref|YP_001532519.1| peptidase M23B [Dinoroseobacter shibae DFL 12]
 gi|157911485|gb|ABV92918.1| peptidase M23B [Dinoroseobacter shibae DFL 12]
          Length = 442

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G      G  + IRH     TVY+H+    V++GQ+VSRG  IG  G +G +   
Sbjct: 358 VVVDAGWH-SGFGRMVKIRHAFGYQTVYAHMSKLRVKEGQRVSRGDRIGDMGSTGRSTGV 416

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+ ++   ++P+ F++
Sbjct: 417 HLHYEVHQSGKPVNPMTFIK 436


>gi|317493946|ref|ZP_07952363.1| peptidase family M23 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918273|gb|EFV39615.1| peptidase family M23 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 329

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 250 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 308

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 309 LHFEIRYKGKSVNPLRYLPQR 329


>gi|294634770|ref|ZP_06713299.1| lipoprotein [Edwardsiella tarda ATCC 23685]
 gi|291091829|gb|EFE24390.1| lipoprotein [Edwardsiella tarda ATCC 23685]
          Length = 313

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 234 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGASS-VR 292

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 293 LHFEIRYKGKSVNPLQYLPQR 313


>gi|75675964|ref|YP_318385.1| peptidase M23B [Nitrobacter winogradskyi Nb-255]
 gi|74420834|gb|ABA05033.1| Peptidase M23B [Nitrobacter winogradskyi Nb-255]
          Length = 453

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 50/80 (62%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G  + RG  I  SG+SG A  P
Sbjct: 372 VVAYAGNELKGYGNLVLVRHSNGYVTAYAHARELMVKRGDSIRRGQVIAKSGQSGEAGSP 431

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK +  +DP+ FL 
Sbjct: 432 QLHFEIRKGSTPVDPLNFLN 451


>gi|269140217|ref|YP_003296918.1| outer membrane lipoprotein [Edwardsiella tarda EIB202]
 gi|267985878|gb|ACY85707.1| outer membrane lipoprotein [Edwardsiella tarda EIB202]
          Length = 316

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 237 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGASS-VR 295

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 296 LHFEIRYKGKSVNPLQYLPQR 316


>gi|254467976|ref|ZP_05081382.1| peptidase M23B [beta proteobacterium KB13]
 gi|207086786|gb|EDZ64069.1| peptidase M23B [beta proteobacterium KB13]
          Length = 298

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G    + GN + I+H   I T Y+H     V+KG  V++   I L G +G +  P
Sbjct: 218 IVIAAGKAP-DYGNYVKIKHGGGIETRYAHASKLLVKKGDLVNKDQVIALVGNTGRSTGP 276

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +H+E+R N  ++DP K+L++K
Sbjct: 277 HLHYEIRLNGRSLDPRKYLKKK 298


>gi|291299962|ref|YP_003511240.1| peptidase M23 [Stackebrandtia nassauensis DSM 44728]
 gi|290569182|gb|ADD42147.1| Peptidase M23 [Stackebrandtia nassauensis DSM 44728]
          Length = 231

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G++    G ++ I H + + T+Y H     VQ G KVS G  IGL+G +G+   P 
Sbjct: 148 VVQAGSN-GGYGLSVTIDHGNGVETLYGHHSQLSVQVGDKVSAGDVIGLAGSTGDITGPH 206

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+  +   +DP  +LE+K
Sbjct: 207 LHFEVHVDGEPVDPAAYLEKK 227


>gi|160931704|ref|ZP_02079098.1| hypothetical protein CLOLEP_00536 [Clostridium leptum DSM 753]
 gi|156869349|gb|EDO62721.1| hypothetical protein CLOLEP_00536 [Clostridium leptum DSM 753]
          Length = 443

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G+     GN ++I H +   T+Y+H    YV +GQ VS+G  I   G SGN+   
Sbjct: 363 VVTIAGDLNDGYGNYVVIDHGNGYKTLYAHGSAIYVTQGQYVSKGQPILAVGNSGNSYGS 422

Query: 61  QVHFELRKNAIAMDPIKF 78
            +HFE+ +N   ++P+ F
Sbjct: 423 HLHFEIIENGTEVNPLNF 440


>gi|225619789|ref|YP_002721046.1| putative metalloendopeptidase-like membrane protein [Brachyspira
           hyodysenteriae WA1]
 gi|225214608|gb|ACN83342.1| putative metalloendopeptidase-like membrane protein [Brachyspira
           hyodysenteriae WA1]
          Length = 393

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GN +++RHD    T Y H+++   + G  V  G  IG  G +G +    
Sbjct: 307 VIFAGYS-GGYGNLVIVRHDKGYTTYYGHLNSITTKAGATVGVGVMIGRMGSTGRSTGSH 365

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+N +A++P  F+  K
Sbjct: 366 LHFEVRRNGVALNPADFIPIK 386


>gi|317049279|ref|YP_004116927.1| peptidase M23 [Pantoea sp. At-9b]
 gi|316950896|gb|ADU70371.1| Peptidase M23 [Pantoea sp. At-9b]
          Length = 362

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 283 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 341

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 342 LHFEIRYKGKSVNPLRYLPQR 362


>gi|127512144|ref|YP_001093341.1| peptidase M23B [Shewanella loihica PV-4]
 gi|126637439|gb|ABO23082.1| peptidase M23B [Shewanella loihica PV-4]
          Length = 310

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H D  ++ Y+H D   V++ Q V+ G T+   G++G      
Sbjct: 231 VVYAGNALRGYGNLVIIKHSDDYLSAYAHADKILVKEKQFVTAGQTVAKMGQTG-TNRVM 289

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R +  ++DP+KFL +
Sbjct: 290 LHFEIRYHGKSVDPLKFLPK 309


>gi|149180954|ref|ZP_01859455.1| hypothetical protein BSG1_10956 [Bacillus sp. SG-1]
 gi|148851238|gb|EDL65387.1| hypothetical protein BSG1_10956 [Bacillus sp. SG-1]
          Length = 478

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G D    GN ++I H++   +VY+H+ +  V  GQ VS G +IG  G++G +    
Sbjct: 401 VVSAGWDSGGYGNKVIIDHNNGYRSVYAHLSSISVSAGQTVSAGASIGNMGQTGQSTGVH 460

Query: 62  VHFELRKNAIAMDPIKF 78
           +H E+ KN   ++P+  
Sbjct: 461 LHLEVYKNGALVNPLSL 477


>gi|78043269|ref|YP_359041.1| M24/M37 family peptidase [Carboxydothermus hydrogenoformans Z-2901]
 gi|77995384|gb|ABB14283.1| peptidase, M23/M37 family [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 371

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   G  I++ H   + T+Y+H+    V  GQ+V +G  IG  G +G +  P 
Sbjct: 295 VIYAGT-MKGYGKVIIVDHGGGVSTLYAHLSAIRVSVGQRVEKGEHIGDVGSTGLSSGPH 353

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF +  N   ++P+++L
Sbjct: 354 LHFGVLVNGEYVNPMQYL 371


>gi|304405928|ref|ZP_07387586.1| Peptidase M23 [Paenibacillus curdlanolyticus YK9]
 gi|304345171|gb|EFM11007.1| Peptidase M23 [Paenibacillus curdlanolyticus YK9]
          Length = 520

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 49/79 (62%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G +    GN ++I H +   T+Y H+ +  V++GQ V +G  +G+ G +G++   
Sbjct: 443 VVEFAG-EKNGYGNCVIINHKNGYKTLYGHMSSIAVKQGQVVEKGDKVGVMGNTGHSTGT 501

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE++KN +  +P+K+L
Sbjct: 502 HLHFEIQKNGVVQNPLKYL 520


>gi|83591217|ref|YP_431226.1| peptidase M23B [Moorella thermoacetica ATCC 39073]
 gi|83574131|gb|ABC20683.1| Peptidase M23B [Moorella thermoacetica ATCC 39073]
          Length = 297

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 42/80 (52%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  + I H + + TVY+H     V++G+ V  G  I   G +GNA  P 
Sbjct: 218 VVLSGWGNSVYGRMVKIDHGNGLETVYAHTSRNLVKEGEYVQAGEAIAEVGATGNASGPH 277

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           VHFE+R+   A++P +FL  
Sbjct: 278 VHFEVREKGKAVNPERFLAR 297


>gi|239831767|ref|ZP_04680096.1| Outer membrane antigenic lipoprotein B precursor [Ochrobactrum
           intermedium LMG 3301]
 gi|239824034|gb|EEQ95602.1| Outer membrane antigenic lipoprotein B precursor [Ochrobactrum
           intermedium LMG 3301]
          Length = 439

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 58/81 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+LIRHD+ +VTVY H     VQ+GQKV RG  +  SG SGNA+ P
Sbjct: 359 VVIYAGDGLKEFGQTVLIRHDNGLVTVYGHNSQILVQRGQKVRRGEEVAKSGMSGNAKSP 418

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN+  ++P K+LE 
Sbjct: 419 KLHFEVRKNSAPVNPNKYLES 439


>gi|83858488|ref|ZP_00952010.1| peptidase, M23/M37 family protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853311|gb|EAP91163.1| peptidase, M23/M37 family protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 412

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 36/79 (45%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G      G T+ + H     T Y H+ +  V++G  V  G  +G  G +G +    
Sbjct: 329 VVYAGWR-AGYGRTVEVDHGYGFRTRYGHLHSIDVRRGDDVELGQRLGGMGSTGRSTGTH 387

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+      +DP  ++ 
Sbjct: 388 LHYEIWFRGEHIDPEDYIR 406


>gi|206896082|ref|YP_002247290.1| membrane protein [Coprothermobacter proteolyticus DSM 5265]
 gi|206738699|gb|ACI17777.1| membrane protein [Coprothermobacter proteolyticus DSM 5265]
          Length = 386

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ G      G  ++I H D   TVY+H+    V+ GQKVS G  +G  G +G A  P
Sbjct: 307 VVIWAGWKT-GYGLCVIIDHQDGYGTVYAHMSRIAVKSGQKVSAGTVVGYEGSTGWATGP 365

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R      +P KF++
Sbjct: 366 HLHFEIRIQGEPTNPAKFVQ 385


>gi|114771122|ref|ZP_01448562.1| peptidase, M23/M37 family protein [alpha proteobacterium HTCC2255]
 gi|114548404|gb|EAU51290.1| peptidase, M23/M37 family protein [alpha proteobacterium HTCC2255]
          Length = 445

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ GN+    G  I IRH    +T Y+H+    V+KGQKV +G  IG  G SG +   
Sbjct: 361 VVIFAGNN-GGYGRLIKIRHSQGFITYYAHLHKINVKKGQKVLQGEKIGSMGNSGRSTGV 419

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R     ++ I +++
Sbjct: 420 HLHYEIRLGGKPINAINYMK 439


>gi|296284793|ref|ZP_06862791.1| peptidase M23/M37 [Citromicrobium bathyomarinum JL354]
          Length = 396

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VG      GN + I H   ++T Y+H+     + GQ+V  G  IG  G +G +  P 
Sbjct: 289 VTFVGRK-GGYGNVVEISHGQGLLTRYAHMSRFEARVGQRVEAGTVIGAIGSTGRSTGPH 347

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N  A++P  FLE
Sbjct: 348 LHFEVRVNGTAVNPRTFLE 366


>gi|304560048|gb|ADM42712.1| Lipoprotein NlpD precursor [Edwardsiella tarda FL6-60]
          Length = 273

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 194 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGASS-VR 252

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 253 LHFEIRYKGKSVNPLQYLPQR 273


>gi|313617202|gb|EFR89696.1| M48 family peptidase [Listeria innocua FSL S4-378]
          Length = 189

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 7/85 (8%)

Query: 2   VIYVG-----NDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKS 54
           V++ G     +     G  + I H +   T+Y+H+      V  GQ+VS+G  IG+ G +
Sbjct: 105 VVFSGFGATGSGFGGYGYVVKIDHGNGFQTLYAHMRAGSLKVVTGQQVSQGQPIGIMGST 164

Query: 55  GNAQHPQVHFELRKNAIAMDPIKFL 79
           G +    +HFE+ KN I +DP  ++
Sbjct: 165 GQSTGQHLHFEIHKNGIPVDPAPYI 189


>gi|307302617|ref|ZP_07582373.1| Peptidase M23 [Sinorhizobium meliloti BL225C]
 gi|306902981|gb|EFN33572.1| Peptidase M23 [Sinorhizobium meliloti BL225C]
          Length = 467

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G      GN I I H + + T Y+H+    V  G  V     I  SG +G +  P 
Sbjct: 380 VTAAGPA-GGYGNMIEIDHGNGVSTRYAHLSAILVNVGDAVKADAVIAKSGSTGRSTGPH 438

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R N  A+DP +FL 
Sbjct: 439 LHYEVRLNGHAVDPARFLR 457


>gi|307318464|ref|ZP_07597898.1| Peptidase M23 [Sinorhizobium meliloti AK83]
 gi|306895804|gb|EFN26556.1| Peptidase M23 [Sinorhizobium meliloti AK83]
          Length = 467

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G      GN I I H + + T Y+H+    V  G  V     I  SG +G +  P 
Sbjct: 380 VTAAGPA-GGYGNMIEIDHGNGVSTRYAHLSAILVNVGDAVKADAVIAKSGSTGRSTGPH 438

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R N  A+DP +FL 
Sbjct: 439 LHYEVRLNGHAVDPARFLR 457


>gi|195970168|ref|NP_385850.2| hypothetical protein SMc00539 [Sinorhizobium meliloti 1021]
 gi|187904180|emb|CAC46323.2| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
          Length = 441

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G      GN I I H + + T Y+H+    V  G  V     I  SG +G +  P 
Sbjct: 354 VTAAGPA-GGYGNMIEIDHGNGVSTRYAHLSAILVNVGDAVKADAVIAKSGSTGRSTGPH 412

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R N  A+DP +FL 
Sbjct: 413 LHYEVRLNGHAVDPARFLR 431


>gi|332558412|ref|ZP_08412734.1| peptidase M23B [Rhodobacter sphaeroides WS8N]
 gi|332276124|gb|EGJ21439.1| peptidase M23B [Rhodobacter sphaeroides WS8N]
          Length = 447

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G      G  I IRH+  I TVY H+    V+KGQ+VSRG  IG  G +G +   
Sbjct: 363 VVIQAGTA-SGYGKVIKIRHEFGIQTVYGHLSRIRVEKGQRVSRGDRIGDMGSTGRSTGT 421

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R +   ++P+ F++
Sbjct: 422 HLHYEVRVDGSPVNPMTFIK 441


>gi|237741511|ref|ZP_04571992.1| cell wall endopeptidase [Fusobacterium sp. 4_1_13]
 gi|256844846|ref|ZP_05550304.1| M23B subfamily peptidase [Fusobacterium sp. 3_1_36A2]
 gi|294785873|ref|ZP_06751161.1| cell wall endopeptidase family M23/M37 [Fusobacterium sp. 3_1_27]
 gi|229429159|gb|EEO39371.1| cell wall endopeptidase [Fusobacterium sp. 4_1_13]
 gi|256718405|gb|EEU31960.1| M23B subfamily peptidase [Fusobacterium sp. 3_1_36A2]
 gi|294487587|gb|EFG34949.1| cell wall endopeptidase family M23/M37 [Fusobacterium sp. 3_1_27]
          Length = 373

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRH++   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 295 VVTFAGN-MSGYGKIIIIRHENGYETRYAHLSVISTNVGEHVNQGDLIGKTGNSGRTTGA 353

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 354 HLHFEIRHNGVPKNPMKYLQ 373


>gi|221639395|ref|YP_002525657.1| peptidase M23B [Rhodobacter sphaeroides KD131]
 gi|221160176|gb|ACM01156.1| Peptidase M23B [Rhodobacter sphaeroides KD131]
          Length = 447

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G      G  I IRH+  I TVY H+    V+KGQ+VSRG  IG  G +G +   
Sbjct: 363 VVIQAGTA-SGYGKVIKIRHEFGIQTVYGHLSRIRVEKGQRVSRGDRIGDMGSTGRSTGT 421

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R +   ++P+ F++
Sbjct: 422 HLHYEVRVDGSPVNPMTFIK 441


>gi|241204839|ref|YP_002975935.1| peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858729|gb|ACS56396.1| Peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 440

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      GN + + H + I T Y H+    V+ G  V R   IGL+G +G +    
Sbjct: 353 VVSAGW-TGGYGNMVEVDHGNGISTRYGHMSEVLVKVGDTVGRNDVIGLAGSTGRSTGTH 411

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R++  A+DP+ F+ 
Sbjct: 412 LHYEVRQDGHAVDPVYFMN 430


>gi|147679196|ref|YP_001213411.1| membrane protein [Pelotomaculum thermopropionicum SI]
 gi|146275293|dbj|BAF61042.1| membrane protein [Pelotomaculum thermopropionicum SI]
          Length = 472

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    GNT+ I H   IVT Y+H+ +  V+ GQ+V RG  IGL G +GN   P
Sbjct: 394 IVASAGWE-GGYGNTVEINHGGGIVTRYAHLSSIKVRSGQRVDRGELIGLVGATGNTTGP 452

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+  +    DP+ +L 
Sbjct: 453 HLHFEVLISGQPRDPLDYLP 472


>gi|77463532|ref|YP_353036.1| putative metalopeptidase [Rhodobacter sphaeroides 2.4.1]
 gi|126462388|ref|YP_001043502.1| peptidase M23B [Rhodobacter sphaeroides ATCC 17029]
 gi|77387950|gb|ABA79135.1| Putative metalopeptidase [Rhodobacter sphaeroides 2.4.1]
 gi|126104052|gb|ABN76730.1| peptidase M23B [Rhodobacter sphaeroides ATCC 17029]
          Length = 447

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G      G  I IRH+  I TVY H+    V+KGQ+VSRG  IG  G +G +   
Sbjct: 363 VVIQAGTA-SGYGKVIKIRHEFGIQTVYGHLSRIRVEKGQRVSRGDRIGDMGSTGRSTGT 421

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R +   ++P+ F++
Sbjct: 422 HLHYEVRVDGSPVNPMTFIK 441


>gi|282848906|ref|ZP_06258296.1| peptidase, M23 family [Veillonella parvula ATCC 17745]
 gi|294793620|ref|ZP_06758757.1| peptidase, M23B family [Veillonella sp. 3_1_44]
 gi|282581411|gb|EFB86804.1| peptidase, M23 family [Veillonella parvula ATCC 17745]
 gi|294455190|gb|EFG23562.1| peptidase, M23B family [Veillonella sp. 3_1_44]
          Length = 393

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G  +   G  ++I H + + T+Y H     V +GQ V +G  I  +G +GN+  P 
Sbjct: 317 VAWSGW-MGGYGYAVVIDHGNGMSTLYGHNSELAVSEGQDVGKGQVIAYAGSTGNSTGPH 375

Query: 62  VHFELRKNAIAMDPIKFL 79
           VHFE+R +   +DP+ +L
Sbjct: 376 VHFEVRISGDPVDPMGYL 393


>gi|238921112|ref|YP_002934627.1| peptidase M23B [Edwardsiella ictaluri 93-146]
 gi|238870681|gb|ACR70392.1| peptidase M23B [Edwardsiella ictaluri 93-146]
          Length = 271

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 192 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGASS-VR 250

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 251 LHFEIRYKGKSVNPLQYLPQR 271


>gi|115524981|ref|YP_781892.1| peptidase M23B [Rhodopseudomonas palustris BisA53]
 gi|115518928|gb|ABJ06912.1| peptidase M23B [Rhodopseudomonas palustris BisA53]
          Length = 455

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  + I H + + T Y H+   +V+ G  +  G  IG  G +G +  P 
Sbjct: 369 VVASGWS-GGYGRMVEIDHGNGLSTRYGHMSEIHVKVGDAIKIGQEIGAVGSTGRSTGPH 427

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R +  A+DP KFL 
Sbjct: 428 LHYETRIDGEAVDPQKFLR 446


>gi|317129070|ref|YP_004095352.1| peptidase M23 [Bacillus cellulosilyticus DSM 2522]
 gi|315474018|gb|ADU30621.1| Peptidase M23 [Bacillus cellulosilyticus DSM 2522]
          Length = 318

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 44/78 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G D    G  ++I+H+D+  TVY+H+++  V  G  V +G  IG  G +G +    
Sbjct: 232 VTEAGWDSGGYGRMVVIKHNDAYETVYAHLNSIEVSAGDYVKKGEMIGGMGSTGRSTGVH 291

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+ +N   +DP +++
Sbjct: 292 LHYEILRNGEYVDPYQYM 309


>gi|294791759|ref|ZP_06756907.1| peptidase, M23B family [Veillonella sp. 6_1_27]
 gi|294456989|gb|EFG25351.1| peptidase, M23B family [Veillonella sp. 6_1_27]
          Length = 395

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G  +   G  ++I H + + T+Y H     V +GQ V +G  I  +G +GN+  P 
Sbjct: 319 VAWSGW-MGGYGYAVVIDHGNGMSTLYGHNSELAVSEGQDVGKGQVIAYAGSTGNSTGPH 377

Query: 62  VHFELRKNAIAMDPIKFL 79
           VHFE+R +   +DP+ +L
Sbjct: 378 VHFEVRISGDPVDPMGYL 395


>gi|34763967|ref|ZP_00144860.1| Cell wall endopeptidase, family M23/M37 [Fusobacterium nucleatum
           subsp. vincentii ATCC 49256]
 gi|27886258|gb|EAA23541.1| Cell wall endopeptidase, family M23/M37 [Fusobacterium nucleatum
           subsp. vincentii ATCC 49256]
          Length = 320

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRH++   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 242 VVTFAGN-MSGYGKIIIIRHENGYETRYAHLSVISTNVGEHVNQGDLIGKTGNSGRTTGA 300

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 301 HLHFEIRHNGVPKNPMKYLQ 320


>gi|307946880|ref|ZP_07662215.1| lipoprotein NlpD [Roseibium sp. TrichSKD4]
 gi|307770544|gb|EFO29770.1| lipoprotein NlpD [Roseibium sp. TrichSKD4]
          Length = 585

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 51/80 (63%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY GN+L   GN +L+RHDD  V+ Y+H     V++G+ + RG  +  +G +G+   PQ
Sbjct: 505 VIYAGNELKGYGNLVLVRHDDGWVSAYAHNSKLQVKRGETIRRGDVVANAGATGSVSQPQ 564

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           VHFELR+    ++P+++L  
Sbjct: 565 VHFELRRGNKPVNPMRYLPR 584


>gi|90020502|ref|YP_526329.1| Fe-S type hydro-lyases tartrate/fumarate alpha region
           [Saccharophagus degradans 2-40]
 gi|89950102|gb|ABD80117.1| peptidase M23B [Saccharophagus degradans 2-40]
          Length = 310

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V +  ++    GN + I H +   T Y H     V+ G  V +G  I L G SG +  P
Sbjct: 228 VVTWS-SERSGYGNLVEINHGNGYKTRYGHCKENLVKVGDVVKKGQVIALMGSSGRSTGP 286

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+ K+  A+DP  ++
Sbjct: 287 HVHFEVYKHGRAVDPSTYI 305


>gi|269797870|ref|YP_003311770.1| peptidase M23 [Veillonella parvula DSM 2008]
 gi|269094499|gb|ACZ24490.1| Peptidase M23 [Veillonella parvula DSM 2008]
          Length = 393

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G  +   G  ++I H + + T+Y H     V +GQ V +G  I  +G +GN+  P 
Sbjct: 317 VAWSGW-MGGYGYAVVIDHGNGMSTLYGHNSELAVSEGQDVGKGQVIAYAGSTGNSTGPH 375

Query: 62  VHFELRKNAIAMDPIKFL 79
           VHFE+R +   +DP+ +L
Sbjct: 376 VHFEVRISGDPVDPMGYL 393


>gi|295111661|emb|CBL28411.1| Membrane proteins related to metalloendopeptidases [Synergistetes
           bacterium SGP1]
          Length = 414

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 4/84 (4%)

Query: 1   MVIYVGND----LVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGN 56
           +V   G +        GN +L+ H + + T+Y+H     V+ GQK+  G  I   G++G 
Sbjct: 331 VVARTGTNKTPCYSGYGNFVLVNHGNGLQTLYAHCQKVTVKVGQKLQEGQIIANVGRTGR 390

Query: 57  AQHPQVHFELRKNAIAMDPIKFLE 80
           A    +HFE+R N   ++P+ +L 
Sbjct: 391 ATTNHLHFEVRVNGKPVNPVLYLR 414


>gi|15603479|ref|NP_246553.1| hypothetical protein PM1614 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12722011|gb|AAK03698.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 467

 Score = 98.3 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H ++  V+  Q+V  G  I   G SG     +
Sbjct: 388 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNESILVKDQQEVRAGQQIAKMGSSGTNS-VK 446

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L ++
Sbjct: 447 LHFEIRYKGKSVDPTRYLPKR 467


>gi|291295747|ref|YP_003507145.1| Peptidase M23 [Meiothermus ruber DSM 1279]
 gi|290470706|gb|ADD28125.1| Peptidase M23 [Meiothermus ruber DSM 1279]
          Length = 402

 Score = 98.3 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 41/79 (51%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G      G  ++I H  +  T+Y+H+    V+ GQ V RG  IG  G +G +  P 
Sbjct: 324 VDTAGWSRYGYGLHVIINHGGAQETLYAHMSRIVVRPGQWVDRGDLIGYVGSTGWSTGPH 383

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R   +A +P+ +L 
Sbjct: 384 LHFEVRVGGVARNPLAYLP 402


>gi|116252339|ref|YP_768177.1| transmembrane peptidase family protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115256987|emb|CAK08081.1| putative transmembrane peptidase family protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 440

 Score = 98.3 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN + + H + I T Y H+    V+ G  V R   IGL+G +G +    
Sbjct: 353 VISAGW-TGGYGNMVEVDHGNGISTRYGHMSEVLVKVGDTVDRNDVIGLAGSTGRSTGTH 411

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R++  A+DP+ F+ 
Sbjct: 412 LHYEVRQDGHAVDPVYFMN 430


>gi|307941921|ref|ZP_07657274.1| peptidase M23B [Roseibium sp. TrichSKD4]
 gi|307774827|gb|EFO34035.1| peptidase M23B [Roseibium sp. TrichSKD4]
          Length = 405

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      G  ++++H + + T Y+H+    V+KG  VS G  IG  G +G +  P 
Sbjct: 317 VIHAGWK-GGYGKVVILQHPNGLTTRYAHMSRIKVKKGASVSAGQVIGNIGSTGRSTGPH 375

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R++  A+DP  F+
Sbjct: 376 LHYEVRRDKKAIDPATFI 393


>gi|330446960|ref|ZP_08310611.1| nlpD putative outer membrane lipoprotein [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328491151|dbj|GAA05108.1| nlpD putative outer membrane lipoprotein [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 266

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G+ L   GN ++I+H +  ++ Y+H D   V++ Q V  G  I   G +G +   
Sbjct: 187 VVVYAGDALPGYGNLVIIKHGEDYLSAYAHNDKILVKEQQTVKAGQKIASMGSTGASS-V 245

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+R    ++DP+++L +
Sbjct: 246 RLHFEIRYKGKSVDPMRYLPK 266


>gi|328949897|ref|YP_004367232.1| Peptidase M23 [Marinithermus hydrothermalis DSM 14884]
 gi|328450221|gb|AEB11122.1| Peptidase M23 [Marinithermus hydrothermalis DSM 14884]
          Length = 310

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      GN ++I H     T+Y H+    V++GQ+V RG  IG  G +G +  P 
Sbjct: 226 VVTAGWS-RIFGNYVVIDHGYGYRTLYGHMSRIRVKRGQRVERGQRIGDVGSTGRSSGPH 284

Query: 62  VHFELRKNAIAMDPIKFLE 80
           VH+ + +N   +DP  +L+
Sbjct: 285 VHYTVFRNGKPVDPRDYLD 303


>gi|255262757|ref|ZP_05342099.1| peptidase, M23/M37 family [Thalassiobium sp. R2A62]
 gi|255105092|gb|EET47766.1| peptidase, M23/M37 family [Thalassiobium sp. R2A62]
          Length = 438

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ G      G  + I+H+  I T Y+H+    VQ GQ+VSRG  IG  G SG +   
Sbjct: 354 VVIHSGWS-SGYGRLVKIQHEFGIETRYAHLSKLRVQVGQRVSRGQRIGDMGNSGRSTGT 412

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R     ++P+ ++ 
Sbjct: 413 HLHYEVRVGGRPVNPMIYIR 432


>gi|294102440|ref|YP_003554298.1| Peptidase M23 [Aminobacterium colombiense DSM 12261]
 gi|293617420|gb|ADE57574.1| Peptidase M23 [Aminobacterium colombiense DSM 12261]
          Length = 404

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVG  L   G  I+I H   + TVY+H+ +  V +GQ VS+G  IG  G +G +  P 
Sbjct: 327 VLYVGW-LRGYGQIIIIDHGRDLSTVYAHLSSTGVDEGQGVSKGQVIGHVGSTGVSTGPH 385

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N  A DP+K+L+
Sbjct: 386 LHFEVRVNGDARDPMKYLQ 404


>gi|323529577|ref|YP_004231729.1| peptidase M23 [Burkholderia sp. CCGE1001]
 gi|323386579|gb|ADX58669.1| Peptidase M23 [Burkholderia sp. CCGE1001]
          Length = 337

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G +    GN + I H + ++T Y H     V+ G  V     I   G SG +  P 
Sbjct: 252 VVLAG-EKSGYGNAVEIDHGNGLMTRYGHASRIVVRAGDLVLPRQYIADVGSSGRSTGPH 310

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+  N   +DP  +L
Sbjct: 311 LHFEVLVNGAPVDPAAYL 328


>gi|262273682|ref|ZP_06051495.1| peptidase M23 [Grimontia hollisae CIP 101886]
 gi|262222097|gb|EEY73409.1| peptidase M23 [Grimontia hollisae CIP 101886]
          Length = 336

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D  +V + Q V +G  I   G SG     +
Sbjct: 257 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDRVFVSERQSVKKGQRIASMGSSGTNS-VR 315

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 316 LHFEIRYKGKSVNPLRYLPKR 336


>gi|51894445|ref|YP_077136.1| putative metalloendopeptidase [Symbiobacterium thermophilum IAM
           14863]
 gi|51858134|dbj|BAD42292.1| putative metalloendopeptidase [Symbiobacterium thermophilum IAM
           14863]
          Length = 435

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDS-IVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQH 59
           MV+Y G +    GN I I H    +VT Y+H+    V  GQ+V++G  IG  G +G +  
Sbjct: 356 MVVYRGWN-GNYGNMIEIDHGGGKMVTWYAHLSGFNVSVGQQVNKGDIIGYVGSTGYSTG 414

Query: 60  PQVHFELRKNAIAMDPIKF 78
           P +HFE+R +   ++P+ +
Sbjct: 415 PHLHFEIRIDGDPVNPLNY 433


>gi|84503039|ref|ZP_01001135.1| peptidase, M23/M37 family protein [Oceanicola batsensis HTCC2597]
 gi|84388583|gb|EAQ01455.1| peptidase, M23/M37 family protein [Oceanicola batsensis HTCC2597]
          Length = 433

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I+H   I T Y+H+    V+ GQ+VSRG  IG  G SG    P
Sbjct: 349 VVTHAGWQ-SGYGRIVKIQHQFGIETRYAHMSRIRVKVGQRVSRGDRIGDMGASGRVTGP 407

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R    A++P+ +++
Sbjct: 408 HLHYEVRVGGKAVNPMIYIK 427


>gi|294010607|ref|YP_003544067.1| peptidase M23B [Sphingobium japonicum UT26S]
 gi|292673937|dbj|BAI95455.1| peptidase M23B [Sphingobium japonicum UT26S]
          Length = 396

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VG      GN + + H + I+T Y+H+     + GQ+V+RG  I   G +G +  P 
Sbjct: 296 VSFVG-QRSGYGNVVEVTHGNGILTRYAHLSGFSARVGQQVARGGAIARMGSTGRSTGPH 354

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R N  A++P +FLE +
Sbjct: 355 LHFEVRVNGNAINPRRFLEAR 375


>gi|331006080|ref|ZP_08329416.1| Lipoprotein NlpD precursor [gamma proteobacterium IMCC1989]
 gi|330420117|gb|EGG94447.1| Lipoprotein NlpD precursor [gamma proteobacterium IMCC1989]
          Length = 307

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSG-NAQHP 60
           ++Y G+ L   G  I+I+H+D  ++ Y+H     V++GQKV  G  I   G SG  A  P
Sbjct: 224 IVYAGSGLRGYGQLIIIKHNDRYLSAYAHNSRIRVKEGQKVKVGQHIADIGSSGSRANIP 283

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
           ++HFE+R+N  +++P+ +L ++
Sbjct: 284 KLHFEIRRNGQSVNPLTYLPKR 305


>gi|27379434|ref|NP_770963.1| hypothetical protein bll4323 [Bradyrhizobium japonicum USDA 110]
 gi|27352585|dbj|BAC49588.1| bll4323 [Bradyrhizobium japonicum USDA 110]
          Length = 457

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  I + H + + T Y H+    V+ G+ V  G  +GL G +G +  P 
Sbjct: 372 VVSAGWS-GGYGRMIEVDHGNGLATRYGHLSEINVKVGEIVKIGQVVGLVGSTGRSTGPH 430

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R +  A+DP KFL 
Sbjct: 431 LHYETRIDGEAVDPQKFLR 449


>gi|87124503|ref|ZP_01080352.1| putative peptidase [Synechococcus sp. RS9917]
 gi|86168075|gb|EAQ69333.1| putative peptidase [Synechococcus sp. RS9917]
          Length = 334

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 43/82 (52%), Gaps = 2/82 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      G  + + H D   T Y+H     V+KGQ V +G TI L G +G +  P 
Sbjct: 252 VVFSGWS-SGYGYLVELAHGDGTATRYAHNSRLVVRKGQMVPQGTTISLMGSTGRSTGPH 310

Query: 62  VHFELRK-NAIAMDPIKFLEEK 82
           +HFE+RK    A DP+ FL  +
Sbjct: 311 LHFEIRKPGGAATDPMPFLPSR 332


>gi|320538976|ref|ZP_08038651.1| putative predicted outer membrane lipoprotein [Serratia symbiotica
           str. Tucson]
 gi|320030909|gb|EFW12913.1| putative predicted outer membrane lipoprotein [Serratia symbiotica
           str. Tucson]
          Length = 318

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  +   G +G +   +
Sbjct: 239 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKVATMGSTGTSS-VR 297

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+ +L ++
Sbjct: 298 LHFEIRYKGKSVNPLHYLPQR 318


>gi|119478820|ref|ZP_01618627.1| Membrane protein [marine gamma proteobacterium HTCC2143]
 gi|119448327|gb|EAW29584.1| Membrane protein [marine gamma proteobacterium HTCC2143]
          Length = 285

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G D    G  + I H    +T Y+H     V+ G  V +G  I L G SG +  P
Sbjct: 203 VVTWSG-DRYGYGQMVEINHGSGYMTRYAHNMENKVEMGDIVKQGQVIALMGSSGRSTGP 261

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+ K+  A+DP  ++
Sbjct: 262 HVHFEVYKHGRAVDPSTYI 280


>gi|310766651|gb|ADP11601.1| lipoprotein NlpD [Erwinia sp. Ejp617]
          Length = 377

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|209549506|ref|YP_002281423.1| peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535262|gb|ACI55197.1| Peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 439

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN + + H + I T Y H+    V+ G  V R   IGL+G +G +    
Sbjct: 352 VISAGW-TGGYGNMVEVDHGNGISTRYGHMSQVLVKVGDTVGRSDVIGLAGSTGRSTGTH 410

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R++  A+DP+ F+ 
Sbjct: 411 LHYEVRQDGHAVDPVYFMN 429


>gi|90580345|ref|ZP_01236152.1| hypothetical lipoprotein NlpD [Vibrio angustum S14]
 gi|90438647|gb|EAS63831.1| hypothetical lipoprotein NlpD [Vibrio angustum S14]
          Length = 283

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H +  ++ Y+H D   V++ Q+V  G  I   G +G +   +
Sbjct: 205 VVYAGDALPGYGNLVIIKHGEDYLSAYAHNDKILVKEQQQVKAGQKIASMGSTGASS-VR 263

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    ++DP+++L +
Sbjct: 264 LHFEIRYKGKSVDPMRYLPK 283


>gi|289523288|ref|ZP_06440142.1| peptidase, M23/M37 family [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289502980|gb|EFD24144.1| peptidase, M23/M37 family [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 399

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 49/79 (62%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G  L   G  I++ H   + TVY+H+    V++GQ V++G  IG  G +G A  P 
Sbjct: 322 VLFTGW-LKGYGQVIILDHGGDMTTVYAHLSAINVREGQVVNQGDVIGRVGNTGVATGPH 380

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R NA A+DP+K+L 
Sbjct: 381 LHFEVRINANAVDPLKYLP 399


>gi|168053993|ref|XP_001779418.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162669216|gb|EDQ55808.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 540

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      G T+ + H +  VT+Y+H D  +VQ GQ V +G  I LSG +G++  P 
Sbjct: 461 VTWSGWK-GGYGKTVCMDHGNGFVTLYAHCDNLHVQPGQFVRKGQVIALSGNTGHSTGPH 519

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE++K+   +DP+ +L 
Sbjct: 520 LHFEIQKDGRTVDPLAYLP 538


>gi|313903601|ref|ZP_07836991.1| Peptidase M23 [Thermaerobacter subterraneus DSM 13965]
 gi|313466154|gb|EFR61678.1| Peptidase M23 [Thermaerobacter subterraneus DSM 13965]
          Length = 519

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+     +   GNTI+I HD++  T+Y H+   YV+ GQ V RG  IGL G +G +   
Sbjct: 441 IVV-ASRYMSGYGNTIIIAHDETYSTLYGHLSRRYVEPGQVVRRGQVIGLMGTTGASTGT 499

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF +  N   ++P+ +L 
Sbjct: 500 HLHFGVWVNGQPVNPMPYLR 519


>gi|254504257|ref|ZP_05116408.1| M23 peptidase domain protein [Labrenzia alexandrii DFL-11]
 gi|222440328|gb|EEE47007.1| M23 peptidase domain protein [Labrenzia alexandrii DFL-11]
          Length = 449

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      G  + IRH +  VT Y+H+       G  V  G  IG  G +G +  P 
Sbjct: 362 VIFAGWK-GGYGKMVEIRHANGFVTRYAHLSKIRTSDGSHVVAGDVIGNIGSTGRSTGPH 420

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R+N    +P  FL 
Sbjct: 421 LHYEVRQNDRPTNPATFLR 439


>gi|157374436|ref|YP_001473036.1| peptidase M23B [Shewanella sediminis HAW-EB3]
 gi|157316810|gb|ABV35908.1| peptidase M23B [Shewanella sediminis HAW-EB3]
          Length = 304

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q V+ G T+   G +G      
Sbjct: 225 VVYAGSALRGYGNLVIIKHSDDYLSAYAHADKILVKEKQFVAVGQTLAKMGSTG-TDRVM 283

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+K+L ++
Sbjct: 284 LHFEIRYHGKSVNPLKYLPKQ 304


>gi|116668482|gb|ABK15513.1| lipoprotein [Pseudomonas alkylphenolia]
          Length = 293

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 214 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKVGQTIAEMGSTG-TDRVK 272

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 273 LHFEIRRQGKPVDPLQFLPRR 293


>gi|296157939|ref|ZP_06840772.1| Peptidase M23 [Burkholderia sp. Ch1-1]
 gi|295891707|gb|EFG71492.1| Peptidase M23 [Burkholderia sp. Ch1-1]
          Length = 328

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G +    GN + I H + ++T Y H     V  G  V     I   G +G +  P 
Sbjct: 243 VVLAG-EKSGYGNAVEIDHGNGLMTRYGHASRIVVHVGDLVLPRQYIADVGSTGRSTGPH 301

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+  N   ++P+ +L
Sbjct: 302 LHFEVLVNGAPVNPVAYL 319


>gi|153009594|ref|YP_001370809.1| peptidase M23B [Ochrobactrum anthropi ATCC 49188]
 gi|151561482|gb|ABS14980.1| peptidase M23B [Ochrobactrum anthropi ATCC 49188]
          Length = 450

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      GN + I H +   T ++H+    V+ GQ+V+ G  +G +G SG +    
Sbjct: 364 VVKAGR-FGGYGNMVEIDHGNGFSTRFAHLSRVLVRDGQQVATGAVVGEAGSSGRSTGSH 422

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R+N  A++P+ FL+
Sbjct: 423 LHYEVRENGRAINPVNFLK 441


>gi|259909442|ref|YP_002649798.1| lipoprotein NlpD [Erwinia pyrifoliae Ep1/96]
 gi|224965064|emb|CAX56596.1| lipoprotein NlpD [Erwinia pyrifoliae Ep1/96]
 gi|283479515|emb|CAY75431.1| Lipoprotein nlpD/lppB homolog precursor [Erwinia pyrifoliae DSM
           12163]
          Length = 377

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 298 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-VR 356

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 357 LHFEIRYKGKSVNPLRYLPQR 377


>gi|251799693|ref|YP_003014424.1| peptidase M23 [Paenibacillus sp. JDR-2]
 gi|247547319|gb|ACT04338.1| Peptidase M23 [Paenibacillus sp. JDR-2]
          Length = 390

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 49/81 (60%), Gaps = 2/81 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQH 59
           V+ V       GNTI+I H + + T+Y H+      V+KGQ V +G  I  SG +G++  
Sbjct: 310 VVIVAQVWSGYGNTIIIDHGNGLWTLYGHLRNGGIMVEKGQSVKKGEKIAESGNTGDSTG 369

Query: 60  PQVHFELRKNAIAMDPIKFLE 80
           P +HFE+RKN +A+DP  +L+
Sbjct: 370 PHLHFEVRKNQVAVDPAGYLK 390


>gi|51244851|ref|YP_064735.1| hypothetical protein DP0999 [Desulfotalea psychrophila LSv54]
 gi|50875888|emb|CAG35728.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 321

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V     +    GN +LI H +   T Y H+    V+KG K+ RG TIGL G SG +  P
Sbjct: 229 IVEKAFYN-GGYGNYVLISHKNGYKTAYGHMKKFLVRKGDKIQRGQTIGLVGNSGRSTGP 287

Query: 61  QVHFELRKNAIAMDPIKFLEEKIP 84
            +H+E+  N   ++P K+L  KIP
Sbjct: 288 HLHYEVILNRKTINPSKYLAIKIP 311


>gi|170718645|ref|YP_001783843.1| peptidase M23B [Haemophilus somnus 2336]
 gi|168826774|gb|ACA32145.1| peptidase M23B [Haemophilus somnus 2336]
          Length = 345

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+I+H+DS ++ Y+H ++  V+  Q+V  G  I   G SG     +
Sbjct: 266 VVYAGDALRGYGNLIIIKHNDSYLSAYAHNESILVKDQQEVKAGQQIAKMGSSGTNT-IK 324

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    ++DP+++L +
Sbjct: 325 LHFEIRYKGQSVDPMRYLPK 344


>gi|257462251|ref|ZP_05626668.1| cell wall endopeptidase [Fusobacterium sp. D12]
 gi|317059920|ref|ZP_07924405.1| cell wall endopeptidase [Fusobacterium sp. D12]
 gi|313685596|gb|EFS22431.1| cell wall endopeptidase [Fusobacterium sp. D12]
          Length = 381

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+I+HD+   T Y+H+     + G+ V RG  IG +G +G    P
Sbjct: 304 VVSFAGN-MSGYGKIIIIKHDNGFETRYAHLSQISTRVGEHVERGELIGKTGNTGRTTGP 362

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R++   ++P+K+L
Sbjct: 363 HLHFEIRRSGKTLNPMKYL 381


>gi|326390791|ref|ZP_08212344.1| Peptidase M23 [Thermoanaerobacter ethanolicus JW 200]
 gi|325993185|gb|EGD51624.1| Peptidase M23 [Thermoanaerobacter ethanolicus JW 200]
          Length = 303

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G +    G  + I H++++ T Y+H+ +  V++ Q V  G  IG  G +G +  P 
Sbjct: 226 VVYAGWND-GYGLVVFIWHNNNLETRYAHLSSIAVKQRQIVKAGDVIGYVGSTGKSTGPH 284

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    A++P+ F +
Sbjct: 285 LHFEVRVGGRAVNPLDFFK 303


>gi|317969515|ref|ZP_07970905.1| peptidoglycan-binding LysM [Synechococcus sp. CB0205]
          Length = 368

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G +    G  + +RH D   + Y+H     V+ GQ V +G  I   G +G +  P 
Sbjct: 286 VVVAGWNNGGYGYLVELRHADGSRSRYAHNSRILVRVGQVVKQGTVISQMGSTGRSTGPH 345

Query: 62  VHFELRKNAI-AMDPIKFLEEK 82
           +HFE+      A++P++FL +K
Sbjct: 346 LHFEILPAGRGAVNPLQFLPQK 367


>gi|255535757|ref|YP_003096128.1| Peptidase M23B [Flavobacteriaceae bacterium 3519-10]
 gi|255341953|gb|ACU08066.1| Peptidase M23B [Flavobacteriaceae bacterium 3519-10]
          Length = 320

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GN +++ H + + T+Y H+ T  V+    ++    I  SG SG +  P 
Sbjct: 242 VIFAG-AKGGYGNCVIVAHGNGLATLYGHLSTISVKANDVINVNQVIAKSGNSGRSTGPH 300

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+ KN   ++P  FL 
Sbjct: 301 LHYEVHKNNTPVNPKLFLN 319


>gi|238898783|ref|YP_002924465.1| lipoprotein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|229466543|gb|ACQ68317.1| lipoprotein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 321

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H D  ++ Y+H D   V++ QKV  G  I   G SG +   +
Sbjct: 242 VVYAGNALRGYGNLIIIKHSDDYLSAYAHNDKILVREQQKVKAGQKIANMGSSGASS-VK 300

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 301 LHFEIRYKGKSVNPLQYLSQR 321


>gi|67923251|ref|ZP_00516737.1| Peptidoglycan-binding LysM:Peptidase M23B [Crocosphaera watsonii WH
           8501]
 gi|67854928|gb|EAM50201.1| Peptidoglycan-binding LysM:Peptidase  M23B [Crocosphaera watsonii
           WH 8501]
          Length = 686

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G +    G  + +RH D  VT+Y+H     V++GQKV +G  I   G +G +  P 
Sbjct: 602 VISAGWNSGGYGKLVKVRHPDGSVTLYAHNSRILVRRGQKVEQGQQIAEMGSTGFSTGPH 661

Query: 62  VHFELRKNAI-AMDPIKFLEE 81
           +H+E+      A +P+ FL +
Sbjct: 662 LHYEIHPKGRGAQNPMAFLPK 682


>gi|149377253|ref|ZP_01895000.1| Membrane protein [Marinobacter algicola DG893]
 gi|149358441|gb|EDM46916.1| Membrane protein [Marinobacter algicola DG893]
          Length = 317

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y  ++    GN + + H D +VT Y+H     V+ G  V +G  + L G +G +  P
Sbjct: 235 VVTYA-DERYGYGNLVEVDHGDGLVTRYAHAKAIKVKVGDVVQKGQVLALMGSTGRSTGP 293

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+ +N  + +P  +++ 
Sbjct: 294 HVHFEVIRNGKSENPETYIKR 314


>gi|296446882|ref|ZP_06888818.1| Peptidase M23 [Methylosinus trichosporium OB3b]
 gi|296255557|gb|EFH02648.1| Peptidase M23 [Methylosinus trichosporium OB3b]
          Length = 283

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I H   +VT Y+H+ +     GQ +  G  +G  G +G +  P
Sbjct: 196 VVAFAGPS-GGYGQMVEIDHGAGLVTRYAHLSSILASVGQPLEAGAVVGRIGSTGRSTGP 254

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R +   +DP +FL 
Sbjct: 255 HLHYEVRIDGEPVDPTRFLR 274


>gi|168061355|ref|XP_001782655.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162665888|gb|EDQ52558.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 498

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      G T+ + H +  +T+Y+H D  +VQ GQ V +G  I LSG +G++  P 
Sbjct: 419 VTWSGWK-GGYGKTVCMDHGNGYITLYAHCDNVHVQPGQFVRKGQVIALSGNTGHSTGPH 477

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+ K+   +DP+  L 
Sbjct: 478 LHFEIHKDGRTVDPLAHLP 496


>gi|152978240|ref|YP_001343869.1| peptidase M23B [Actinobacillus succinogenes 130Z]
 gi|150839963|gb|ABR73934.1| peptidase M23B [Actinobacillus succinogenes 130Z]
          Length = 419

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HDD  ++ Y+H D+  V+  Q+V  G  I   G SG     +
Sbjct: 340 VVYAGNALRGYGNLIIIKHDDDFLSAYAHNDSISVRDQQEVKAGQQIAKMGSSG-TNRVK 398

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  +
Sbjct: 399 LHFEIRYKGKSVDPTRYLPRR 419


>gi|88798285|ref|ZP_01113871.1| metalloendopeptidase-like membrane protein [Reinekea sp. MED297]
 gi|88779061|gb|EAR10250.1| metalloendopeptidase-like membrane protein [Reinekea sp. MED297]
          Length = 103

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y GN L   GN I++ H  S+++ Y+  D   V++  +V  G  I   GK G+   P
Sbjct: 24  VVVYAGNGLPGYGNLIILEHSGSLLSAYAFNDEMLVKEKDRVRSGQQIATMGKQGD--QP 81

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R+N   +DP+ +L ++
Sbjct: 82  GLHFEIRRNGKPVDPLTYLPDR 103


>gi|312143430|ref|YP_003994876.1| Peptidase M23 [Halanaerobium sp. 'sapolanicus']
 gi|311904081|gb|ADQ14522.1| Peptidase M23 [Halanaerobium sp. 'sapolanicus']
          Length = 333

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      G  ++I H   + T+Y+H     V + Q V +G  I  SG +GN+  P 
Sbjct: 255 VVFSGWS-GGYGKVVIIEHRKGLRTLYAHNSQLLVSERQTVDKGQVIARSGNTGNSTGPH 313

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE++ N    +P+ +L
Sbjct: 314 LHFEVQINGRPENPLDYL 331


>gi|258646389|ref|ZP_05733858.1| peptidase, M23/M37 family [Dialister invisus DSM 15470]
 gi|260403791|gb|EEW97338.1| peptidase, M23/M37 family [Dialister invisus DSM 15470]
          Length = 311

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G  +   G  + ++H D IVT Y H     V +GQ V +G  I L G +GN+  P 
Sbjct: 231 VTQAGW-VGGYGYLVEVKHADGIVTRYGHNSAVLVYEGQHVDQGSMIALMGSTGNSTGPH 289

Query: 62  VHFELRKNAIAMDPIKFLEE 81
            H+E+R N  A+DP+ FL +
Sbjct: 290 CHYEVRINGEAVDPMYFLPQ 309


>gi|239831797|ref|ZP_04680126.1| peptidase M23B [Ochrobactrum intermedium LMG 3301]
 gi|239824064|gb|EEQ95632.1| peptidase M23B [Ochrobactrum intermedium LMG 3301]
          Length = 450

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      GN + I H +   T ++H+    V+ GQ+V+ G  +G +G SG +    
Sbjct: 364 VVKAGR-FGGYGNMVEIDHGNGFSTRFAHLSRVLVRDGQQVAAGVVVGEAGSSGRSTGSH 422

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R+N  A++P+ FL+
Sbjct: 423 LHYEVRENGRAINPVNFLK 441


>gi|42523482|ref|NP_968862.1| hypothetical protein Bd2006 [Bdellovibrio bacteriovorus HD100]
 gi|39575688|emb|CAE79855.1| nlpD4 [Bdellovibrio bacteriovorus HD100]
          Length = 193

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 44/80 (55%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G +    G  +LI   +   T+Y+H D   V +GQKV +G  +G  G++G A    
Sbjct: 109 VIYAGREFRGYGKMVLIESGNGWATLYAHFDKILVSEGQKVRQGEVVGAMGRTGRATGVH 168

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+RK+   +DP+  L  
Sbjct: 169 LHFEVRKDRGPIDPLPLLPS 188


>gi|88801102|ref|ZP_01116649.1| metalloendopeptidase-like membrane protein [Reinekea sp. MED297]
 gi|88776181|gb|EAR07409.1| metalloendopeptidase-like membrane protein [Reinekea sp. MED297]
          Length = 306

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G+     G  + I H +  VT Y+H     V+ G  V +   I L G +G +  P
Sbjct: 223 VVTWAGSR-YGYGELVEINHGNGYVTRYAHCKEVLVEVGDVVKKSDIIALMGSTGRSTGP 281

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+  N  ++DP K++  
Sbjct: 282 HVHFEVLLNGKSVDPAKYINR 302


>gi|282858000|ref|ZP_06267201.1| neprilysin [Pyramidobacter piscolens W5455]
 gi|282584154|gb|EFB89521.1| neprilysin [Pyramidobacter piscolens W5455]
          Length = 502

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G  +   G T++IRHD +  T+Y H  +  ++KGQ V +G  I   G SG A  P 
Sbjct: 425 VIFSGW-MNGYGRTVIIRHDSTYTTLYGHCQSLMIRKGQNVKKGTVIATVGSSGRATGPH 483

Query: 62  VHFELRKNAIAMDPIKFLE 80
           VHFE+R+N    +P+ +L 
Sbjct: 484 VHFEVRRNDSPTNPMSYLR 502


>gi|288939903|ref|YP_003442143.1| peptidase M23 [Allochromatium vinosum DSM 180]
 gi|288895275|gb|ADC61111.1| Peptidase M23 [Allochromatium vinosum DSM 180]
          Length = 300

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      GN + IRH D +VT Y+H     V++G  + +G  I   G +G A  P 
Sbjct: 209 VVFSGRRN-GYGNLVDIRHRDGLVTRYAHNTANLVREGDLIRQGQQIATVGSTGTATGPH 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           VHFE+ +N  A+DP+ +L  +
Sbjct: 268 VHFEVIRNGRAVDPMPYLRSQ 288


>gi|318041385|ref|ZP_07973341.1| peptidoglycan-binding LysM [Synechococcus sp. CB0101]
          Length = 347

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G D    G  + +RH D   + Y+H     V+ GQ VS+G  I   G +G +  P 
Sbjct: 265 VVVAGWDDGGYGYLVELRHADGSRSRYAHNSRILVRVGQVVSQGTVISQMGSTGRSTGPH 324

Query: 62  VHFELRKNAI-AMDPIKFLEEK 82
           +HFE+      A++P++FL  +
Sbjct: 325 LHFEILPAGRGAVNPLQFLPAR 346


>gi|237737683|ref|ZP_04568164.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
 gi|229419563|gb|EEO34610.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
          Length = 332

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 47/80 (58%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G  +   G  I+I+H     T Y H+D   V+KGQ V  G  IG +G+SG    P 
Sbjct: 252 VTFAGT-MNGYGKIIIIQHSGGYETRYGHLDKIGVRKGQYVKTGELIGKTGQSGRVTGPH 310

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFELRKN  A++P+K++ +
Sbjct: 311 LHFELRKNGKALNPMKYMPK 330


>gi|254283440|ref|ZP_04958408.1| Fe-S type hydro-lyases tartrate/fumarate alpha region [gamma
           proteobacterium NOR51-B]
 gi|219679643|gb|EED35992.1| Fe-S type hydro-lyases tartrate/fumarate alpha region [gamma
           proteobacterium NOR51-B]
          Length = 307

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G +    G  + I H D ++T Y+H     V  G  V +G  I L G SG +  P
Sbjct: 225 VVSWSG-ERAGYGTMVDISHGDGLITRYAHNQENLVAVGDLVRQGEPIALMGSSGRSTGP 283

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +HFE+ K+   +DP  ++  
Sbjct: 284 HLHFEVYKHGRPVDPASYIRR 304


>gi|192291112|ref|YP_001991717.1| peptidase M23 [Rhodopseudomonas palustris TIE-1]
 gi|192284861|gb|ACF01242.1| Peptidase M23 [Rhodopseudomonas palustris TIE-1]
          Length = 456

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  + I H + + T Y H+     + GQ +  G  IG  G +G +  P 
Sbjct: 370 VVNAGWQ-GGYGQMVEIDHGNGLSTRYGHLSKIIAKVGQSIQIGQVIGEVGSTGRSTGPH 428

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R +  A+DP KFL 
Sbjct: 429 LHYETRIDGEAVDPQKFLR 447


>gi|159026080|emb|CAO86322.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 268

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G +    GN + +RH D   T+Y+H     V++GQ V +G  I   G SG +  P 
Sbjct: 186 VIASGWNSGGYGNLVKLRHPDGSTTLYAHNSRLLVRRGQTVQQGEPIAQMGSSGFSTGPH 245

Query: 62  VHFELRKNAI-AMDPIKFLEEK 82
           +HFE+  +   A++P+ FL  +
Sbjct: 246 LHFEVHPSGRGAVNPMAFLPGR 267


>gi|220930270|ref|YP_002507179.1| peptidase M23 [Clostridium cellulolyticum H10]
 gi|220000598|gb|ACL77199.1| Peptidase M23 [Clostridium cellulolyticum H10]
          Length = 375

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G +    GN ++I H   + T+Y+H     VQ G  + +G T+G  G +G +  P 
Sbjct: 298 VIMAGWN-GGYGNCVIIDHGGGLATLYAHQSKILVQVGDYLKKGDTVGKVGSTGLSTGPH 356

Query: 62  VHFELRKNAIAMDPIKF 78
           +HFE+RK     DP+ +
Sbjct: 357 LHFEVRKAGDTKDPLAY 373


>gi|108762233|ref|YP_633498.1| M23 peptidase domain-containing protein [Myxococcus xanthus DK
           1622]
 gi|108466113|gb|ABF91298.1| M23 peptidase domain protein [Myxococcus xanthus DK 1622]
          Length = 305

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G +    GN ++I H   I T Y H+    V+ G KV RG  I   G +G +  P 
Sbjct: 226 VVFAGLE-GGYGNVLVIDHGYGIKTRYGHLSKMLVKAGDKVKRGMHIAAVGNTGRSTGPH 284

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N I  +P KF+
Sbjct: 285 LHYEVRVNGIGQNPRKFI 302


>gi|39935521|ref|NP_947797.1| peptidase M23B [Rhodopseudomonas palustris CGA009]
 gi|39649373|emb|CAE27896.1| Peptidase M23/M37 [Rhodopseudomonas palustris CGA009]
          Length = 456

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  + I H + + T Y H+     + GQ +  G  IG  G +G +  P 
Sbjct: 370 VVNAGWQ-GGYGQMVEIDHGNGLSTRYGHLSKIIAKVGQSIQIGQVIGEVGSTGRSTGPH 428

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R +  A+DP KFL 
Sbjct: 429 LHYETRIDGEAVDPQKFLR 447


>gi|329848585|ref|ZP_08263613.1| peptidase family M23 family protein [Asticcacaulis biprosthecum
           C19]
 gi|328843648|gb|EGF93217.1| peptidase family M23 family protein [Asticcacaulis biprosthecum
           C19]
          Length = 476

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 4/84 (4%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+         G  + IRH +   T Y+H+ +  V+ GQKVS+G  IG  G +G +  P
Sbjct: 310 VVVDAKWW-GGYGRWVRIRHANGWETGYAHMSSIAVKPGQKVSQGQVIGYVGTTGRSTGP 368

Query: 61  QVHFELRKNAIAMDPIKFLEEKIP 84
            +HFE+ K+   +DP      K+P
Sbjct: 369 HLHFEVWKDKRPIDPRS---AKVP 389


>gi|89096801|ref|ZP_01169693.1| Membrane protein related to metalloendopeptidase [Bacillus sp. NRRL
           B-14911]
 gi|89088816|gb|EAR67925.1| Membrane protein related to metalloendopeptidase [Bacillus sp. NRRL
           B-14911]
          Length = 492

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 45/80 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  ++I H +   T+Y+H+D+  V+ GQ V +G  IG+ G +G++    
Sbjct: 413 VVSAGMTGDGYGKKVIIDHQNGYRTLYAHLDSIDVKIGQNVPKGTKIGMMGSTGDSTGVH 472

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+ KN    DP+K++  
Sbjct: 473 LHFEVYKNGSLQDPLKYVNR 492


>gi|26988354|ref|NP_743779.1| peptidase M23B [Pseudomonas putida KT2440]
 gi|24983105|gb|AAN67243.1|AE016351_5 lipoprotein NlpD [Pseudomonas putida KT2440]
          Length = 262

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 183 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 241

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 242 LHFEIRRQGKPVDPLQFLPRR 262


>gi|119962355|ref|YP_946807.1| M23 peptidase domain-containing protein [Arthrobacter aurescens
           TC1]
 gi|119949214|gb|ABM08125.1| M23 peptidase domain protein [Arthrobacter aurescens TC1]
          Length = 278

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 46/78 (58%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      GN +++ H + + T Y+H+ +  VQ GQ V+RG T+ LSG +G +    
Sbjct: 201 VTFAGWHEYGGGNRVVVDHGNGLETTYNHLSSFTVQVGQTVNRGDTVALSGTTGASTGCH 260

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE++ N   +DP+ +L
Sbjct: 261 LHFEVQVNGEVVDPMGWL 278


>gi|149926952|ref|ZP_01915211.1| peptidase M23B [Limnobacter sp. MED105]
 gi|149824504|gb|EDM83722.1| peptidase M23B [Limnobacter sp. MED105]
          Length = 273

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 55/81 (67%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++HD++++T Y+H  T  V++G+ V++G  I  +G+S ++  P+
Sbjct: 194 VVYSGNALRGYGNLIILKHDNNLLTAYAHNKTLLVKEGEPVTKGQKIAEAGQS-DSDRPK 252

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK    +DP+ +L  +
Sbjct: 253 LHFEVRKQGKPVDPMDYLPAR 273


>gi|299133778|ref|ZP_07026972.1| Peptidase M23 [Afipia sp. 1NLS2]
 gi|298591614|gb|EFI51815.1| Peptidase M23 [Afipia sp. 1NLS2]
          Length = 448

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G      G  + I H + + T Y H+    V+ G  V  G  +G  G +G +  P 
Sbjct: 363 VTSAGWS-GGYGRMVEIDHGNGLATRYGHLSQIDVKVGDVVKTGEVVGEVGSTGRSTGPH 421

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R N  A+DP +FL 
Sbjct: 422 LHYETRINGEAVDPQRFLR 440


>gi|90416343|ref|ZP_01224275.1| Membrane protein [marine gamma proteobacterium HTCC2207]
 gi|90332068|gb|EAS47282.1| Membrane protein [marine gamma proteobacterium HTCC2207]
          Length = 313

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G+ + I H D  VT Y H D   V  G  V +G  I   G SG +  P
Sbjct: 231 VVTWSGKR-SGYGDMVEINHGDGFVTRYGHNDENLVTLGSIVKKGQQIARMGSSGRSTGP 289

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+ KN   +DP  ++ +
Sbjct: 290 HVHFEVFKNGRTVDPASYIHK 310


>gi|167032189|ref|YP_001667420.1| peptidase M23B [Pseudomonas putida GB-1]
 gi|166858677|gb|ABY97084.1| peptidase M23B [Pseudomonas putida GB-1]
          Length = 285

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 206 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 264

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 265 LHFEIRRQGKPVDPLQFLPRR 285


>gi|291286280|ref|YP_003503096.1| Peptidase M23 [Denitrovibrio acetiphilus DSM 12809]
 gi|290883440|gb|ADD67140.1| Peptidase M23 [Denitrovibrio acetiphilus DSM 12809]
          Length = 305

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G      G  +++ H    +T Y H +   V+ G KVS+G  I   G +G +  P
Sbjct: 224 IVVFSGRK-AGYGKMVIVDHGYGYITKYGHNNKLLVKAGDKVSKGDFIAEVGSTGRSTGP 282

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VH+E+  N I ++P+KF+
Sbjct: 283 HVHYEVLVNGIPVNPLKFI 301


>gi|86750120|ref|YP_486616.1| peptidase M23B [Rhodopseudomonas palustris HaA2]
 gi|86573148|gb|ABD07705.1| Peptidase M23B [Rhodopseudomonas palustris HaA2]
          Length = 457

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  + I H + + T Y H+     + GQ V  G  IG  G +G +  P 
Sbjct: 371 VVNAGWQ-GGYGQMVEIDHGNGLSTRYGHLSKIIAKVGQSVQIGQMIGEIGSTGRSTGPH 429

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R +  A+DP KFL 
Sbjct: 430 LHYETRIDGEAVDPQKFLR 448


>gi|83593102|ref|YP_426854.1| peptidase M23B [Rhodospirillum rubrum ATCC 11170]
 gi|83576016|gb|ABC22567.1| peptidase M23B [Rhodospirillum rubrum ATCC 11170]
          Length = 465

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 50/79 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN++   GN +LI+H+   +T Y+H D   V++G+ VSRG TI   G SG    P
Sbjct: 379 VVAYAGNEIRGFGNLLLIKHEGGFMTAYAHNDALLVKRGETVSRGQTIARVGSSGGVGAP 438

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+R+N   +DP  +L
Sbjct: 439 QIHFEIRRNGKPIDPTPYL 457


>gi|89075069|ref|ZP_01161510.1| hypothetical lipoprotein NlpD [Photobacterium sp. SKA34]
 gi|89049156|gb|EAR54721.1| hypothetical lipoprotein NlpD [Photobacterium sp. SKA34]
          Length = 293

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H +  ++ Y+H D   V++ Q+V  G  I   G +G +   +
Sbjct: 215 VVYAGDALPGYGNLVIIKHGEDYLSAYAHNDKILVKEQQQVKAGQKIASMGSTGASS-VR 273

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    ++DP+++L +
Sbjct: 274 LHFEIRYKGKSVDPMRYLPK 293


>gi|299134933|ref|ZP_07028124.1| Peptidase M23 [Afipia sp. 1NLS2]
 gi|298589910|gb|EFI50114.1| Peptidase M23 [Afipia sp. 1NLS2]
          Length = 434

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 51/80 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN IL+RH +  VT Y+H     V++G  + RG  I  SG++G+   P
Sbjct: 353 VVAYAGNELKGYGNLILVRHANGYVTAYAHASELEVKRGDTIKRGQVIAKSGQTGDVGSP 412

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK +  +DP++FL 
Sbjct: 413 QLHFEIRKGSSPVDPLQFLN 432


>gi|296157775|ref|ZP_06840609.1| Peptidase M23 [Burkholderia sp. Ch1-1]
 gi|295892021|gb|EFG71805.1| Peptidase M23 [Burkholderia sp. Ch1-1]
          Length = 311

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H  +  V++G  V++G  I   G S ++    
Sbjct: 232 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRSLMVKEGDAVTKGQKIAEMGNS-DSDRVM 290

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 291 LHFEVRRQGKPVDPLKYLP 309


>gi|315635253|ref|ZP_07890530.1| lipoprotein [Aggregatibacter segnis ATCC 33393]
 gi|315475999|gb|EFU66754.1| lipoprotein [Aggregatibacter segnis ATCC 33393]
          Length = 394

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V+  Q+V  G  I   G +G     +
Sbjct: 315 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDSILVKDQQEVKAGQQIAKMGNTGTND-VK 373

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  +
Sbjct: 374 LHFEIRYKGKSVDPTRYLPRR 394


>gi|310779247|ref|YP_003967580.1| Peptidase M23 [Ilyobacter polytropus DSM 2926]
 gi|309748570|gb|ADO83232.1| Peptidase M23 [Ilyobacter polytropus DSM 2926]
          Length = 325

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  +   G  I+I+H     T  +H++   V+ GQ V +G  IG +G +G    P 
Sbjct: 247 VTYAGW-MSGYGKIIIIKHSGGYETRAAHLNNINVKPGQYVKQGQVIGKTGMTGRVTGPH 305

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RKN +  +P+K+L
Sbjct: 306 LHFEIRKNGVPYNPMKYL 323


>gi|300022791|ref|YP_003755402.1| peptidase M23 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524612|gb|ADJ23081.1| Peptidase M23 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 528

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 38/81 (46%), Positives = 54/81 (66%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RHD+  VT Y+H D   V++G KV RG  I  +GK+G+   P
Sbjct: 447 VVAYSGNELKGYGNLVLLRHDNGWVTAYAHNDELLVKRGDKVKRGQVISKAGKTGSVDQP 506

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           QVHFELR+ +  +DP  +LE+
Sbjct: 507 QVHFELRQGSRPVDPTPYLEK 527


>gi|212634212|ref|YP_002310737.1| peptidoglycan-binding LysM:peptidase M23B [Shewanella piezotolerans
           WP3]
 gi|212555696|gb|ACJ28150.1| Peptidoglycan-binding LysM:Peptidase M23B [Shewanella piezotolerans
           WP3]
          Length = 304

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q V+ G T+   G +G      
Sbjct: 225 VVYAGSALRGYGNLVIIKHSDDYLSAYAHADKILVKEKQAVNAGQTVAKMGSTG-TNRVM 283

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+K+L ++
Sbjct: 284 LHFEIRYHGKSVNPLKYLPKQ 304


>gi|312796083|ref|YP_004029005.1| peptidoglycan-specific endopeptidase, M23 family [Burkholderia
           rhizoxinica HKI 454]
 gi|312167858|emb|CBW74861.1| Peptidoglycan-specific endopeptidase, M23 family [Burkholderia
           rhizoxinica HKI 454]
          Length = 301

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 49/79 (62%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+ + +T Y+H  T  V++G  V++G TI   G S +A    
Sbjct: 222 VVYAGNGLRGYGNLIIIKHNATYLTAYAHNRTLLVKEGDPVTQGQTIAEMGGS-DADKVM 280

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+RK    +DP+K+L 
Sbjct: 281 LHFEVRKQGKPVDPMKYLP 299


>gi|237745061|ref|ZP_04575542.1| cell wall endopeptidase [Fusobacterium sp. 7_1]
 gi|229432290|gb|EEO42502.1| cell wall endopeptidase [Fusobacterium sp. 7_1]
          Length = 365

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRH++   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 287 VVTFAGN-MSGYGKIIIIRHENGYETRYAHLSVISTNVGEHVNKGDLIGKTGNSGRTTGA 345

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 346 HLHFEIRHNGVPKNPMKYLQ 365


>gi|48727550|gb|AAT46074.1| lipoprotein [Pseudomonas chlororaphis]
          Length = 294

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 215 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKVGQTIAEMGSTG-TDRVK 273

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 274 LHFEIRRQGKPVDPLQFLPRR 294


>gi|148549361|ref|YP_001269463.1| peptidase M23B [Pseudomonas putida F1]
 gi|148513419|gb|ABQ80279.1| peptidase M23B [Pseudomonas putida F1]
          Length = 262

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 183 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 241

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 242 LHFEIRRQGKPVDPLQFLPRR 262


>gi|307729586|ref|YP_003906810.1| Peptidase M23 [Burkholderia sp. CCGE1003]
 gi|307584121|gb|ADN57519.1| Peptidase M23 [Burkholderia sp. CCGE1003]
          Length = 312

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 233 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 291

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 292 LHFEVRRQGKPVDPLKYLP 310


>gi|167581695|ref|ZP_02374569.1| lipoprotein NlpD, putative [Burkholderia thailandensis TXDOH]
          Length = 296

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 217 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 275

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 276 LHFEVRRQGKPVDPLKYLP 294


>gi|167569722|ref|ZP_02362596.1| lipoprotein NlpD, putative [Burkholderia oklahomensis C6786]
          Length = 289

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 210 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 268

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 269 LHFEVRRQGKPVDPLKYLP 287


>gi|295689549|ref|YP_003593242.1| peptidase M23 [Caulobacter segnis ATCC 21756]
 gi|295431452|gb|ADG10624.1| Peptidase M23 [Caulobacter segnis ATCC 21756]
          Length = 383

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GNT+ + H     T Y+H+ +  V+ GQ+V+ G  +G  G +G +  P
Sbjct: 296 VVSFTG-VRAGYGNTVEVDHGGGFKTRYAHLSSIGVRVGQRVTIGSRVGAMGSTGRSTGP 354

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+  N  A +P +FL 
Sbjct: 355 HLHYEVWVNGKAQNPNRFLR 374


>gi|239996685|ref|ZP_04717209.1| peptidase, M23/M37 family protein [Alteromonas macleodii ATCC
           27126]
          Length = 292

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G D    G  + I H D  VT Y H DT  V  G  V++G  I   G +G +   
Sbjct: 212 IVTWAG-DRYGYGQLVEIDHGDGFVTRYGHNDTLTVSIGDVVTKGEPIAKMGNTGRSTGV 270

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VH+E+ +N   +DP+ F+ +K
Sbjct: 271 HVHYEVIRNGKQVDPLPFVYKK 292


>gi|149185304|ref|ZP_01863621.1| Peptidase M23/M37 [Erythrobacter sp. SD-21]
 gi|148831415|gb|EDL49849.1| Peptidase M23/M37 [Erythrobacter sp. SD-21]
          Length = 385

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VG      GNT+ I H + ++T Y+H+     + G+ V  G  IG  G +G +  P 
Sbjct: 288 VTFVGRK-GGYGNTVEITHGNGLMTRYAHMSAFRAKVGETVQPGEVIGAIGSTGRSSGPH 346

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N   ++P  FLE
Sbjct: 347 LHFEVRSNGRPLNPRTFLE 365


>gi|104783165|ref|YP_609663.1| peptidase M23B [Pseudomonas entomophila L48]
 gi|95112152|emb|CAK16879.1| putative Peptidase M23B [Pseudomonas entomophila L48]
          Length = 261

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 182 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 240

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 241 LHFEIRRQGKPVDPLQFLPRR 261


>gi|116328311|ref|YP_798031.1| metallopeptidase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116331037|ref|YP_800755.1| metallopeptidase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|116121055|gb|ABJ79098.1| Metallopeptidase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116124726|gb|ABJ75997.1| Metallopeptidase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 307

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G +    GNT++I H++   T+Y+H     + +G KVS G  IG  G++G+A  P
Sbjct: 212 VVSFAGVN-GGYGNTVIIDHENGYKTMYAHCSKITIDQGTKVSTGTVIGAIGRTGSATGP 270

Query: 61  QVHFELRKNAIAMDPIKFLEEKI 83
            +HFE+  N   ++P   L++ +
Sbjct: 271 HLHFEVFLNGTRVNPETALKKAL 293


>gi|304391528|ref|ZP_07373470.1| peptidase M23B [Ahrensia sp. R2A130]
 gi|303295757|gb|EFL90115.1| peptidase M23B [Ahrensia sp. R2A130]
          Length = 390

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G +    G  + I H   I T Y+H+   +V+KGQK+ RG  IG  G +G +  P 
Sbjct: 303 VVKAGRN-GGYGKMVEIDHGGGITTRYAHLSRIHVKKGQKIKRGKRIGKVGSTGRSTGPH 361

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R+    +DPI ++ 
Sbjct: 362 LHYEVRRKGRVLDPIHYVR 380


>gi|146340968|ref|YP_001206016.1| M23/M37 familypeptidase [Bradyrhizobium sp. ORS278]
 gi|146193774|emb|CAL77791.1| putative peptidoglycan-binding LysM:Peptidase M23/M37 family
           (NlpD/LppB-like) [Bradyrhizobium sp. ORS278]
          Length = 483

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 50/80 (62%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G  + RG  I  SG+SG    P
Sbjct: 402 VVAYAGNELKGYGNLVLVRHSNGYVTAYAHASELMVKRGDPIKRGQVIAKSGQSGEVGSP 461

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK +  +DP++FL 
Sbjct: 462 QLHFEIRKGSSPVDPLQFLN 481


>gi|148255769|ref|YP_001240354.1| putative peptidoglycan-binding LysM [Bradyrhizobium sp. BTAi1]
 gi|146407942|gb|ABQ36448.1| putative peptidoglycan-binding LysM [Bradyrhizobium sp. BTAi1]
          Length = 484

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 50/80 (62%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G  + RG  I  SG+SG    P
Sbjct: 403 VVAYAGNELKGYGNLVLVRHSNGYVTAYAHASELMVKRGDPIKRGQVIAKSGQSGEVGSP 462

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK +  +DP++FL 
Sbjct: 463 QLHFEIRKGSSPVDPLQFLN 482


>gi|115524712|ref|YP_781623.1| peptidase M23B [Rhodopseudomonas palustris BisA53]
 gi|115518659|gb|ABJ06643.1| peptidase M23B [Rhodopseudomonas palustris BisA53]
          Length = 459

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 52/80 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G+ + RG TI  SG++G    P
Sbjct: 378 VVAYAGNELKGYGNLVLVRHSNGFVTAYAHASEVLVKRGETIKRGQTIAKSGQTGEVGSP 437

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK +  +DP++FL 
Sbjct: 438 QLHFEIRKGSSPVDPLQFLN 457


>gi|86749853|ref|YP_486349.1| peptidase M23B [Rhodopseudomonas palustris HaA2]
 gi|86572881|gb|ABD07438.1| Peptidase M23B [Rhodopseudomonas palustris HaA2]
          Length = 474

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 52/80 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G+ + RG TI  SG+SG    P
Sbjct: 393 VVAYSGNELKGYGNLVLVRHSNGYVTAYAHASELMVKRGETIKRGQTIAKSGQSGEVGSP 452

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK +  +DP+KFL 
Sbjct: 453 QLHFEIRKGSSPVDPLKFLN 472


>gi|91977251|ref|YP_569910.1| peptidase M23B [Rhodopseudomonas palustris BisB5]
 gi|91683707|gb|ABE40009.1| peptidase M23B [Rhodopseudomonas palustris BisB5]
          Length = 478

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 52/80 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G+ + RG TI  SG+SG    P
Sbjct: 397 VVAYSGNELKGYGNLVLVRHSNGYVTAYAHASELMVKRGETIKRGQTIAKSGQSGEVGSP 456

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK +  +DP+KFL 
Sbjct: 457 QLHFEIRKGSSPVDPLKFLN 476


>gi|256026733|ref|ZP_05440567.1| cell wall endopeptidase [Fusobacterium sp. D11]
          Length = 373

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRH++   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 295 VVTFAGN-MSGYGKIIIIRHENGYETRYAHLSVISTNVGEHVNKGDLIGKTGNSGRTTGA 353

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 354 HLHFEIRHNGVPKNPMKYLQ 373


>gi|332519766|ref|ZP_08396230.1| Peptidase M23 [Lacinutrix algicola 5H-3-7-4]
 gi|332044325|gb|EGI80519.1| Peptidase M23 [Lacinutrix algicola 5H-3-7-4]
          Length = 323

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V    ++    G  I I H    V++Y+H+    V K QKV RG  IG  G +G ++ P
Sbjct: 221 VVTRADSNSSGYGKHIRIDHGYGYVSLYAHLYKYNVGKNQKVKRGDLIGFVGSTGRSEAP 280

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E+ K+   ++PI F
Sbjct: 281 HLHYEIFKDDQRINPINF 298


>gi|255596869|ref|XP_002536637.1| Glycyl-glycine endopeptidase ALE-1 precursor, putative [Ricinus
           communis]
 gi|223519024|gb|EEF25747.1| Glycyl-glycine endopeptidase ALE-1 precursor, putative [Ricinus
           communis]
          Length = 420

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      GN + + H   + T Y H+    V+ G+K+     IG +G +G +  P 
Sbjct: 333 VSFAGYS-GGYGNMVEVDHGKGVTTRYGHLSQILVRTGEKIELSDVIGKAGSTGRSTGPH 391

Query: 62  VHFELRKNAIAMDPIKFL 79
           VH+E+R N  A+DP++FL
Sbjct: 392 VHYEVRLNDEAVDPMRFL 409


>gi|254421164|ref|ZP_05034886.1| M23 peptidase domain protein [Brevundimonas sp. BAL3]
 gi|196183868|gb|EDX78846.1| M23 peptidase domain protein [Brevundimonas sp. BAL3]
          Length = 381

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GNT+ + H     T Y+H++T  VQ GQ V+ G  IG  G +G +   
Sbjct: 294 VVAYAG-VRSGYGNTVELDHGRGFKTRYAHLNTLGVQPGQSVALGQRIGGMGTTGRSTGV 352

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+  N    +P +FL 
Sbjct: 353 HLHYEVWLNGRPQNPARFLR 372


>gi|71277883|ref|YP_267822.1| putative lipoprotein NlpD [Colwellia psychrerythraea 34H]
 gi|71143623|gb|AAZ24096.1| putative lipoprotein NlpD [Colwellia psychrerythraea 34H]
          Length = 283

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   G  I+I+H+D  ++ Y+H D   V++ Q ++ G  I   G + +A    
Sbjct: 204 VVYAGNALRGYGKLIIIKHNDDYLSAYAHNDRILVKEQQIINIGDVIATMGDT-DANKVM 262

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+K+L +K
Sbjct: 263 LHFEIRFRGKSVNPLKYLPKK 283


>gi|254469903|ref|ZP_05083308.1| peptidase M23B [Pseudovibrio sp. JE062]
 gi|211961738|gb|EEA96933.1| peptidase M23B [Pseudovibrio sp. JE062]
          Length = 407

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V     +    G ++ I HD+ ++T Y+H+    V +GQ+V+ G  +G  G +G +  P
Sbjct: 307 IVSLSRYN-GGYGLSVEIVHDNGLITRYAHMQKLLVSEGQRVNMGDLVGTVGNTGRSTGP 365

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R N   ++P++F+ 
Sbjct: 366 HLHYEVRLNGKPVNPMRFIR 385


>gi|316934389|ref|YP_004109371.1| peptidase M23 [Rhodopseudomonas palustris DX-1]
 gi|315602103|gb|ADU44638.1| Peptidase M23 [Rhodopseudomonas palustris DX-1]
          Length = 456

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  + I H + + T Y H+     + GQ+V  G  +G  G +G +  P 
Sbjct: 370 VVSAGWA-GGYGQMVEIDHGNGLTTRYGHLSKIIAKVGQQVGIGQIVGEIGSTGRSTGPH 428

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R +  A+DP KFL 
Sbjct: 429 LHYETRIDGEAVDPQKFLR 447


>gi|166032791|ref|ZP_02235620.1| hypothetical protein DORFOR_02506 [Dorea formicigenerans ATCC
           27755]
 gi|166027148|gb|EDR45905.1| hypothetical protein DORFOR_02506 [Dorea formicigenerans ATCC
           27755]
          Length = 377

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G      GN I+I H + ++T Y H +T +V  GQKVS+G  IG  G +GN+  P 
Sbjct: 301 VTSAGYSGKA-GNLIIINHGNGLLTYYMHCNTIFVSAGQKVSKGQNIGQVGTTGNSTGPH 359

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++  N   ++P+ +L
Sbjct: 360 LHFQVMNNGKPVNPMNYL 377


>gi|302669930|ref|YP_003829890.1| metallopeptidase M23 family protein [Butyrivibrio proteoclasticus
           B316]
 gi|302394403|gb|ADL33308.1| metallopeptidase M23 family [Butyrivibrio proteoclasticus B316]
          Length = 529

 Score = 96.7 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G      G  + IRH D   T Y H+    V  GQKVS+G  I LSG +G +  P 
Sbjct: 452 VTRAGWG-SGYGYCVYIRHADGRETRYGHLSKVLVSVGQKVSQGQKIALSGNTGVSTGPH 510

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+  N   ++P+ +L 
Sbjct: 511 LHFEILINGSQVNPLNYLN 529


>gi|317062139|ref|ZP_07926624.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
 gi|313687815|gb|EFS24650.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
          Length = 360

 Score = 96.7 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  +   G  I+++H +   T Y+H+D   V+ GQ V++G  IG +G SG    P 
Sbjct: 281 VSYAGY-MNGYGKIIILKHSNGYETRYAHLDKIGVKVGQNVNKGELIGKTGMSGRVTGPH 339

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN    +P+ +L  K
Sbjct: 340 LHFEVRKNGKTENPMSYLTRK 360


>gi|296445303|ref|ZP_06887262.1| Peptidase M23 [Methylosinus trichosporium OB3b]
 gi|296257258|gb|EFH04326.1| Peptidase M23 [Methylosinus trichosporium OB3b]
          Length = 526

 Score = 96.7 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 37/79 (46%), Positives = 50/79 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +LIRH +  V+ Y+H     V++G +V RG  I  SG+SGN   P
Sbjct: 445 VVAYAGNELKGYGNLVLIRHPNGFVSAYAHNGELEVKRGDQVKRGQNIAKSGQSGNVGTP 504

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFELRK A  +DP  +L
Sbjct: 505 QLHFELRKGATPVDPTSYL 523


>gi|158522495|ref|YP_001530365.1| peptidase M23B [Desulfococcus oleovorans Hxd3]
 gi|158511321|gb|ABW68288.1| peptidase M23B [Desulfococcus oleovorans Hxd3]
          Length = 313

 Score = 96.7 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 49/79 (62%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G     LGN ++I H + ++T Y H+   + ++G+ VSR   +G  G +G +  P
Sbjct: 234 VVLFSGRK-GSLGNAVMIDHGNGVITRYGHLSECFKKRGETVSREDVVGAVGNTGISTGP 292

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R N +A++P K++
Sbjct: 293 HLHYEVRINGVAVNPEKYI 311


>gi|212711365|ref|ZP_03319493.1| hypothetical protein PROVALCAL_02437 [Providencia alcalifaciens DSM
           30120]
 gi|212686094|gb|EEB45622.1| hypothetical protein PROVALCAL_02437 [Providencia alcalifaciens DSM
           30120]
          Length = 275

 Score = 96.7 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V+  Q V+ G  I   G +G +   +
Sbjct: 196 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTLLVRDQQDVAEGQKIATMGSTGTSS-VR 254

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 255 LHFEIRYKGKSVNPLRYLPQR 275


>gi|302392027|ref|YP_003827847.1| peptidase M23 [Acetohalobium arabaticum DSM 5501]
 gi|302204104|gb|ADL12782.1| Peptidase M23 [Acetohalobium arabaticum DSM 5501]
          Length = 320

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      G  ++I H     T+Y H     V+ G ++ RG  I  SG +G +  P 
Sbjct: 242 VIHAGWKN-GYGKLVMIDHGYGFRTLYGHNRRVNVRVGDEIERGDLIAYSGNTGRSSGPH 300

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +H+E++ N   ++P+ +++E
Sbjct: 301 LHYEIQVNGKPVNPMDYIKE 320


>gi|221198090|ref|ZP_03571136.1| LysM domain/M23 peptidase domain protein [Burkholderia multivorans
           CGD2M]
 gi|221204351|ref|ZP_03577368.1| LysM domain/M23 peptidase domain protein [Burkholderia multivorans
           CGD2]
 gi|221175208|gb|EEE07638.1| LysM domain/M23 peptidase domain protein [Burkholderia multivorans
           CGD2]
 gi|221182022|gb|EEE14423.1| LysM domain/M23 peptidase domain protein [Burkholderia multivorans
           CGD2M]
          Length = 290

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 211 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 269

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 270 LHFEVRRQGKPVDPMKYLP 288


>gi|221212760|ref|ZP_03585736.1| LysM domain/M23 peptidase domain protein [Burkholderia multivorans
           CGD1]
 gi|221166973|gb|EED99443.1| LysM domain/M23 peptidase domain protein [Burkholderia multivorans
           CGD1]
          Length = 289

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 210 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 268

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 269 LHFEVRRQGKPVDPMKYLP 287


>gi|161524625|ref|YP_001579637.1| peptidase M23B [Burkholderia multivorans ATCC 17616]
 gi|189350619|ref|YP_001946247.1| lipoprotein [Burkholderia multivorans ATCC 17616]
 gi|160342054|gb|ABX15140.1| peptidase M23B [Burkholderia multivorans ATCC 17616]
 gi|189334641|dbj|BAG43711.1| lipoprotein [Burkholderia multivorans ATCC 17616]
          Length = 292

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 213 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 271

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 272 LHFEVRRQGKPVDPMKYLP 290


>gi|325577190|ref|ZP_08147674.1| outer membrane antigenic lipoprotein B [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325160772|gb|EGC72893.1| outer membrane antigenic lipoprotein B [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 405

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G +G     +
Sbjct: 326 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVSDQQEVKAGQEIAKMGSTG-TNAVK 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 385 LHFEIRYKGKSVDPVRYLPRR 405


>gi|256823885|ref|YP_003147847.1| Peptidase M23 [Cyanothece sp. PCC 8802]
 gi|256592553|gb|ACV03398.1| Peptidase M23 [Cyanothece sp. PCC 8802]
          Length = 195

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G +    GN + +RH D  VT Y+H     V++ Q+V +G  I   G +G +  P
Sbjct: 115 VVISAGWNDGGYGNLVKVRHPDGSVTFYAHNSRLLVRRDQQVEQGQQIAEMGSTGRSTGP 174

Query: 61  QVHFELRKNAI-AMDPIKFLE 80
            +HFE+    I A++P+ FL 
Sbjct: 175 HLHFEVHPKGIGAVNPVAFLP 195


>gi|312135552|ref|YP_004002890.1| peptidase M23 [Caldicellulosiruptor owensensis OL]
 gi|311775603|gb|ADQ05090.1| Peptidase M23 [Caldicellulosiruptor owensensis OL]
          Length = 379

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G  +   G TI+I +   I T+Y+H+ +  V  GQKV +G  +G  G +G +  P 
Sbjct: 302 VILAGW-VSGYGKTIIIDNGSGISTLYAHLSSINVAVGQKVKKGEIVGYVGSTGYSTGPH 360

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N    DP+ FL+
Sbjct: 361 LHFEVRINGDVTDPLNFLK 379


>gi|289764730|ref|ZP_06524108.1| cell wall endopeptidase [Fusobacterium sp. D11]
 gi|289716285|gb|EFD80297.1| cell wall endopeptidase [Fusobacterium sp. D11]
          Length = 365

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRH++   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 287 VVTFAGN-MSGYGKIIIIRHENGYETRYAHLSVISTNVGEHVNKGDLIGKTGNSGRTTGA 345

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 346 HLHFEIRHNGVPKNPMKYLQ 365


>gi|86157773|ref|YP_464558.1| peptidase M23B [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774284|gb|ABC81121.1| peptidase M23B [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 243

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G      GN + + H   +VT+Y H     V+ GQ V+ G  +   G +G +  P
Sbjct: 151 VVVRAGPR-GGYGNAVEVDHGGGLVTLYGHAAEVRVRPGQVVAAGEELARVGSTGRSTGP 209

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R     +DP + L+
Sbjct: 210 HLHFEVRMAGRPVDPARALK 229


>gi|83943198|ref|ZP_00955658.1| peptidase, M23/M37 family protein [Sulfitobacter sp. EE-36]
 gi|83954333|ref|ZP_00963053.1| peptidase, M23/M37 family protein [Sulfitobacter sp. NAS-14.1]
 gi|83841370|gb|EAP80540.1| peptidase, M23/M37 family protein [Sulfitobacter sp. NAS-14.1]
 gi|83846206|gb|EAP84083.1| peptidase, M23/M37 family protein [Sulfitobacter sp. EE-36]
          Length = 442

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I+H+  + T Y+H+    V+ GQ+VSRG  IG  G SG +   
Sbjct: 358 VVTHAGWS-SGYGRLVKIQHEFGVETRYAHMSKLRVKVGQRVSRGQRIGDMGTSGRSTGV 416

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R    A++P+ F++
Sbjct: 417 HLHYEVRVGGKAVNPMIFIK 436


>gi|284042364|ref|YP_003392704.1| peptidase M23 [Conexibacter woesei DSM 14684]
 gi|283946585|gb|ADB49329.1| Peptidase M23 [Conexibacter woesei DSM 14684]
          Length = 352

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 37/76 (48%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G +    GN +++RH     T Y+H+       GQ V+ G  +G  G +G    P 
Sbjct: 228 VAFAGWNDGGYGNLVVVRHRLGFETWYAHMSRIGAVVGQSVAGGSVLGWVGSTGRTTGPH 287

Query: 62  VHFELRKNAIAMDPIK 77
           +HFE+R     +DP+ 
Sbjct: 288 LHFEVRLFGTPIDPVS 303


>gi|295676468|ref|YP_003604992.1| Peptidase M23 [Burkholderia sp. CCGE1002]
 gi|295436311|gb|ADG15481.1| Peptidase M23 [Burkholderia sp. CCGE1002]
          Length = 316

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 237 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 295

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 296 LHFEVRRQGKPVDPLKYLP 314


>gi|325290910|ref|YP_004267091.1| Peptidase M23 [Syntrophobotulus glycolicus DSM 8271]
 gi|324966311|gb|ADY57090.1| Peptidase M23 [Syntrophobotulus glycolicus DSM 8271]
          Length = 467

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      G  ILI H D + T Y+H     V  GQ V +G  IG  G++GNA  P 
Sbjct: 391 VISAGWS-GGYGYMILIDHGDGVETRYAHSSKLAVSAGQSVKKGQVIGYVGRTGNATGPH 449

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+  N   ++P+K++
Sbjct: 450 LHFEVIINGGTVNPLKYI 467


>gi|260494840|ref|ZP_05814970.1| M23B subfamily peptidase [Fusobacterium sp. 3_1_33]
 gi|260198002|gb|EEW95519.1| M23B subfamily peptidase [Fusobacterium sp. 3_1_33]
          Length = 365

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRH++   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 287 VVTFAGN-MSGYGKIIIIRHENGYETRYAHLSVISTNVGEHVNKGDLIGKTGNSGRTTGA 345

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N +  +P+K+L+
Sbjct: 346 HLHFEIRHNGVPKNPMKYLQ 365


>gi|256823514|ref|YP_003147477.1| peptidase M23 [Kangiella koreensis DSM 16069]
 gi|256797053|gb|ACV27709.1| Peptidase M23 [Kangiella koreensis DSM 16069]
          Length = 369

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 17/79 (21%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++    L   G  ++I H    +++Y   ++     G  V  G  +   G+SG +  P 
Sbjct: 292 VVFADW-LRGFGLMVIIDHGQGYLSLYGQNESLLKSTGDWVEAGEPVATVGRSGGSSEPG 350

Query: 62  VHFELRKNAIAMDPIKFLE 80
           ++FE+R      +P+ +++
Sbjct: 351 LYFEIRYKGKPQNPLSWIK 369


>gi|254786990|ref|YP_003074419.1| M23 peptidase domain-containing protein [Teredinibacter turnerae
           T7901]
 gi|237685357|gb|ACR12621.1| M23 peptidase domain protein [Teredinibacter turnerae T7901]
          Length = 310

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G +    G  + + H +   T Y+H     V+ G  + +G  + L G SG +  P
Sbjct: 228 VVTWSG-ERYGYGQMVEVNHGNGFSTRYAHCKENLVKVGDVIKKGQVVALMGSSGRSTGP 286

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+ KN   +DP  ++
Sbjct: 287 HVHFEVYKNGRTVDPATYI 305


>gi|301155392|emb|CBW14858.1| predicted outer membrane lipoprotein [Haemophilus parainfluenzae
           T3T1]
          Length = 405

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G +G     +
Sbjct: 326 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVSDQQEVKAGQEIAKMGSTG-TNAVK 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 385 LHFEIRYKGKSVDPVRYLPRR 405


>gi|120405821|ref|YP_955650.1| peptidase M23B [Mycobacterium vanbaalenii PYR-1]
 gi|119958639|gb|ABM15644.1| peptidase M23B [Mycobacterium vanbaalenii PYR-1]
          Length = 348

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G +    GN + +RH D  VT+Y H  +  V  G++V  G  I   G +GN+  P
Sbjct: 258 VVIAAGPE-GGYGNLVKLRHADGTVTLYGHNSSVLVNVGERVMAGDQIAKMGNTGNSTGP 316

Query: 61  QVHFELRKNAI-AMDPIKFLEEK 82
             HFE+  N    +DP+ +L ++
Sbjct: 317 HCHFEVHLNGTDRVDPVGWLAKR 339


>gi|282600222|ref|ZP_06257515.1| lipoprotein NlpD [Providencia rustigianii DSM 4541]
 gi|282566346|gb|EFB71881.1| lipoprotein NlpD [Providencia rustigianii DSM 4541]
          Length = 267

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V+  Q V+ G  I   G +G +   +
Sbjct: 188 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTLLVRDQQDVAEGQKIATMGSTGTSS-VR 246

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 247 LHFEIRYKGKSVNPLRYLPQR 267


>gi|113461643|ref|YP_719712.1| lipoprotein B [Haemophilus somnus 129PT]
 gi|112823686|gb|ABI25775.1| lipoprotein B [Haemophilus somnus 129PT]
          Length = 290

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+I+H+DS ++ Y+H ++  V+  Q+V  G  I   G SG     +
Sbjct: 211 VVYAGDALRGYGNLIIIKHNDSYLSAYAHNESILVKDQQEVKAGQQIAKMGSSGTNT-IK 269

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    ++DP+++L +
Sbjct: 270 LHFEIRYKGQSVDPMRYLPK 289


>gi|257467850|ref|ZP_05631946.1| cell wall endopeptidase [Fusobacterium ulcerans ATCC 49185]
          Length = 351

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  +   G  I+++H +   T Y+H+D   V+ GQ V++G  IG +G SG    P 
Sbjct: 272 VSYAGY-MNGYGKIIILKHSNGYETRYAHLDKIGVKVGQNVNKGELIGKTGMSGRVTGPH 330

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN    +P+ +L  K
Sbjct: 331 LHFEVRKNGKTENPMSYLTRK 351


>gi|300724641|ref|YP_003713966.1| lipoprotein [Xenorhabdus nematophila ATCC 19061]
 gi|297631183|emb|CBJ91878.1| lipoprotein [Xenorhabdus nematophila ATCC 19061]
          Length = 359

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HDD  ++ Y+H DT  V++ Q V  G  I   G +G +   +
Sbjct: 280 VVYAGNALRGYGNLIIIKHDDDYLSAYAHNDTMLVREQQDVQAGQKISTMGSTGTSS-VR 338

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 339 LHFEIRYKGKSVNPLRYLSQR 359


>gi|323526139|ref|YP_004228292.1| peptidase M23 [Burkholderia sp. CCGE1001]
 gi|323383141|gb|ADX55232.1| Peptidase M23 [Burkholderia sp. CCGE1001]
          Length = 315

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 236 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 294

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 295 LHFEVRRQGKPVDPLKYLP 313


>gi|325983049|ref|YP_004295451.1| peptidase M23 [Nitrosomonas sp. AL212]
 gi|325532568|gb|ADZ27289.1| Peptidase M23 [Nitrosomonas sp. AL212]
          Length = 307

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY      E GN + I H   +V+ Y+H     V+ G+ V +G  I   G +G +  P
Sbjct: 226 VVIYSDRH-SEYGNMVEIDHGGDLVSRYAHASKRIVKLGEVVLQGQKIAEVGSTGRSTGP 284

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +HFE+R      +P KFL++
Sbjct: 285 HLHFEIRHKDKPQNPAKFLKK 305


>gi|239907788|ref|YP_002954529.1| peptidase M23B family protein [Desulfovibrio magneticus RS-1]
 gi|239797654|dbj|BAH76643.1| peptidase M23B family protein [Desulfovibrio magneticus RS-1]
          Length = 348

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H     +VY H+    V+ G  V  G  I   G +G +  P
Sbjct: 261 VVTYAGTK-GGYGNVVEVEHPGGWKSVYGHLRGYAVRPGDSVQAGGKIAEVGSTGRSTGP 319

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFELR+    +DP   L
Sbjct: 320 HLHFELRRGGDTVDPHGLL 338


>gi|182420499|ref|ZP_02642929.2| peptidase, M23/M37 family [Clostridium perfringens NCTC 8239]
 gi|182380658|gb|EDT78137.1| peptidase, M23/M37 family [Clostridium perfringens NCTC 8239]
          Length = 399

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 40/78 (51%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+         GN ++I H     T+Y+H +   V  GQKV +G  + L G +G +  P 
Sbjct: 322 VVTAAEYHPAYGNMVIIDHGGGFSTLYAHANQLKVSVGQKVKQGQVVSLVGSTGYSTGPH 381

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R N   ++P+ ++
Sbjct: 382 AHFEIRINGQHVNPMDYI 399


>gi|229847189|ref|ZP_04467293.1| lipoprotein [Haemophilus influenzae 7P49H1]
 gi|229809865|gb|EEP45587.1| lipoprotein [Haemophilus influenzae 7P49H1]
          Length = 405

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVVDQQEVKAGQDIAKMGSSG-TNAVK 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 385 LHFEVRYKGKSVDPVRYLPRR 405


>gi|237800175|ref|ZP_04588636.1| lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331023032|gb|EGI03089.1| lipoprotein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 288

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|228472975|ref|ZP_04057732.1| peptidase, family M23 [Capnocytophaga gingivalis ATCC 33624]
 gi|228275557|gb|EEK14334.1| peptidase, family M23 [Capnocytophaga gingivalis ATCC 33624]
          Length = 324

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V    ++    G  I I H     T+Y H+    V+ GQKV RG  IG  G +G ++ P
Sbjct: 222 VVTRADSNSSGYGEHIRIDHGYGYETLYGHLSQYNVRPGQKVKRGDVIGYVGSTGRSEAP 281

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E++KN   ++PI F
Sbjct: 282 HLHYEVKKNGEHLNPINF 299


>gi|120555355|ref|YP_959706.1| peptidase M23B [Marinobacter aquaeolei VT8]
 gi|120325204|gb|ABM19519.1| peptidase M23B [Marinobacter aquaeolei VT8]
          Length = 318

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V +  ++    GN + I H D +VT Y+H     V+ G  V +   + L G +G +  P
Sbjct: 236 VVTWA-DERYGYGNLVEIDHGDGLVTRYAHAKAIKVKVGDVVQKSQVVALMGSTGRSTGP 294

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+ +N  + +P+K+++ 
Sbjct: 295 HVHFEVIRNGKSENPVKYIQR 315


>gi|163789501|ref|ZP_02183940.1| peptidase, M48 family protein [Carnobacterium sp. AT7]
 gi|159875355|gb|EDP69420.1| peptidase, M48 family protein [Carnobacterium sp. AT7]
          Length = 493

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 3/80 (3%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTP--YVQKGQKVSRGHTIGLSGKSGNAQH 59
           V++ G D    G  + I H + + T+Y+H+      V  GQ+VS+G  IG  G +G++  
Sbjct: 415 VVFAGYD-SGWGYYVKIDHGNGMQTLYAHMVAGSLLVSPGQQVSQGQQIGTMGTTGSSTG 473

Query: 60  PQVHFELRKNAIAMDPIKFL 79
             +HFE+ KN   ++P  +L
Sbjct: 474 VHLHFEMYKNGSRVNPASYL 493


>gi|332981243|ref|YP_004462684.1| peptidase M23 [Mahella australiensis 50-1 BON]
 gi|332698921|gb|AEE95862.1| Peptidase M23 [Mahella australiensis 50-1 BON]
          Length = 394

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           MVI  G  L   G  ++I H + I T+Y H  +  V  GQ+VS+G  I   G +G A  P
Sbjct: 316 MVIQSGW-LGAYGKAVIIDHGNGISTLYGHNSSLLVSIGQEVSQGQVIARVGMTGLATGP 374

Query: 61  QVHFELRKNAIAMDPIKFLE 80
             HFE+R N    +P+++ +
Sbjct: 375 HSHFEVRINGTPTNPMQYFK 394


>gi|260219680|emb|CBA26525.1| Lipoprotein nlpD/lppB homolog [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 297

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+++H+++ +T Y+H  T  V++ Q V RG  I   G S +A   +
Sbjct: 218 VVYAGSGLRGYGNLIILKHNNTYLTAYAHNQTLLVKEDQTVKRGQKIAEMGNS-DADRVK 276

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK    +DP K+L  +
Sbjct: 277 LHFEVRKQGKPVDPTKYLPAR 297


>gi|254520135|ref|ZP_05132191.1| peptidase [Clostridium sp. 7_2_43FAA]
 gi|226913884|gb|EEH99085.1| peptidase [Clostridium sp. 7_2_43FAA]
          Length = 443

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  +   G T++I H   + T+Y+H     V  GQ V+RG TI   G +G +  P
Sbjct: 366 VVAYSGW-ISGYGETVIIDHGGGVQTLYAHNSERLVSVGQTVARGETIARVGSTGMSTGP 424

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R N    +P+ ++
Sbjct: 425 HIHWEIRINGQHTNPMGYV 443


>gi|163746647|ref|ZP_02154004.1| peptidase, M23/M37 family, putative [Oceanibulbus indolifex HEL-45]
 gi|161379761|gb|EDQ04173.1| peptidase, M23/M37 family, putative [Oceanibulbus indolifex HEL-45]
          Length = 442

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I+H+  I T Y+H+    V+ GQ+VSRG  IG  G SG     
Sbjct: 358 VVTHAGWS-SGYGRLVKIQHEFGIETRYAHMSKLRVKVGQRVSRGQHIGDMGASGRVTGV 416

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R    A++P+ +++
Sbjct: 417 HLHYEVRVGGKAVNPMIYIK 436


>gi|91783465|ref|YP_558671.1| putative lipoprotein/metalloendopeptidase [Burkholderia xenovorans
           LB400]
 gi|91687419|gb|ABE30619.1| Putative lipoprotein/metalloendopeptidase [Burkholderia xenovorans
           LB400]
          Length = 311

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 232 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 290

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 291 LHFEVRRQGKPVDPLKYLP 309


>gi|323137662|ref|ZP_08072738.1| Peptidase M23 [Methylocystis sp. ATCC 49242]
 gi|322396959|gb|EFX99484.1| Peptidase M23 [Methylocystis sp. ATCC 49242]
          Length = 529

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 51/79 (64%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G++L   GN +LIRH +  V+ Y+H     V++G +V RG TI  SG+SGN   P
Sbjct: 448 VVAYAGSELKGYGNLVLIRHPNGFVSAYAHNGELEVKRGDQVKRGQTIAKSGQSGNVGSP 507

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFELRK +  +DP  +L
Sbjct: 508 QLHFELRKGSTPVDPTSYL 526


>gi|315442900|ref|YP_004075779.1| metalloendopeptidase-like membrane protein [Mycobacterium sp.
           Spyr1]
 gi|315261203|gb|ADT97944.1| metalloendopeptidase-like membrane protein [Mycobacterium sp.
           Spyr1]
          Length = 351

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G      GN + +RH D  VT+Y H  +  V  G++V  G  I   G +GN+  P
Sbjct: 261 IVISSG-AEGGYGNAVKLRHADGTVTLYGHNSSLLVSVGERVMAGDQIAKMGNTGNSTGP 319

Query: 61  QVHFELRKNAI-AMDPIKFLEEK 82
            +HFE+  N    +DP  +L ++
Sbjct: 320 HLHFEVHLNGTDRVDPTGWLAKR 342


>gi|288817521|ref|YP_003431868.1| putative lipoprotein [Hydrogenobacter thermophilus TK-6]
 gi|288786920|dbj|BAI68667.1| putative lipoprotein [Hydrogenobacter thermophilus TK-6]
 gi|308751124|gb|ADO44607.1| Peptidase M23 [Hydrogenobacter thermophilus TK-6]
          Length = 277

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G    + G  ++IRH    +T+Y H+    V++GQK+  G  +G  G +G +  P
Sbjct: 197 VVEFAGR-YFDYGKAVIIRHPSGYITLYGHLSQIDVKEGQKIKAGDIVGRVGSTGRSTGP 255

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +H+E+ KN   ++P+ F+  +
Sbjct: 256 HLHYEVIKNNRPINPLDFIAWR 277


>gi|254478374|ref|ZP_05091753.1| M23 peptidase domain protein [Carboxydibrachium pacificum DSM
           12653]
 gi|214035732|gb|EEB76427.1| M23 peptidase domain protein [Carboxydibrachium pacificum DSM
           12653]
          Length = 305

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G +    G  + I H++++ T Y+H+ +  V++ Q V  G  IG  G +G +  P 
Sbjct: 228 VVYAGWND-GYGLVVFIWHNNNLETRYAHLSSIAVKQRQVVRAGDVIGYVGSTGKSTGPH 286

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    A++P+ F +
Sbjct: 287 LHFEVRIGGRAVNPLDFFK 305


>gi|170692343|ref|ZP_02883506.1| peptidase M23B [Burkholderia graminis C4D1M]
 gi|170142773|gb|EDT10938.1| peptidase M23B [Burkholderia graminis C4D1M]
          Length = 315

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H  +  V++G  V++G  I   G S ++    
Sbjct: 236 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRSLMVKEGDAVTKGQKIAEMGNS-DSDRVM 294

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 295 LHFEVRRQGKPVDPLKYLP 313


>gi|187923826|ref|YP_001895468.1| peptidase M23 [Burkholderia phytofirmans PsJN]
 gi|187715020|gb|ACD16244.1| Peptidase M23 [Burkholderia phytofirmans PsJN]
          Length = 315

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H  +  V++G  V++G  I   G S ++    
Sbjct: 236 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRSLMVKEGDAVTKGQKIAEMGNS-DSDRVM 294

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 295 LHFEVRRQGKPVDPLKYLP 313


>gi|319897855|ref|YP_004136052.1| lipoprotein [Haemophilus influenzae F3031]
 gi|317433361|emb|CBY81741.1| Lipoprotein [Haemophilus influenzae F3031]
          Length = 400

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 321 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVVDQQEVKAGQDIAKMGSSG-TNAVK 379

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 380 LHFEVRYKGKSVDPVRYLPRR 400


>gi|89055020|ref|YP_510471.1| peptidase M23B [Jannaschia sp. CCS1]
 gi|88864569|gb|ABD55446.1| peptidase M23B [Jannaschia sp. CCS1]
          Length = 445

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GNT+ + H +  +T Y+H+    V +G++VSRG  +G  G +G     
Sbjct: 361 IVSFTGRQ-SGYGNTVEVEHANGFMTRYAHLSRIRVTEGERVSRGDLLGDMGCTGRCTGT 419

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+ +N   ++P+ F+ 
Sbjct: 420 HLHYEVHRNGTPVNPMTFIR 439


>gi|325954951|ref|YP_004238611.1| peptidase M23 [Weeksella virosa DSM 16922]
 gi|323437569|gb|ADX68033.1| Peptidase M23 [Weeksella virosa DSM 16922]
          Length = 332

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G++    GN + I H +   T+Y H+    V+ GQ+V RG  IG  G +G +    
Sbjct: 232 VEKTGSEN-GYGNMVKINHGNGYETLYGHMSKIKVKPGQRVKRGEIIGNVGNTGMSTGSH 290

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +H+E+ KN   ++P+ +  +
Sbjct: 291 LHYEIHKNGEVINPLTYFYK 310


>gi|312897456|ref|ZP_07756880.1| peptidase, M23 family [Megasphaera micronuciformis F0359]
 gi|310621517|gb|EFQ05053.1| peptidase, M23 family [Megasphaera micronuciformis F0359]
          Length = 320

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G  +   GN + I H + IVT Y H     V +GQ+V  G  I L+G +GN+  P 
Sbjct: 243 VTVAGW-VSGYGNLVEIDHGNGIVTRYGHNSMLLVVEGQEVKTGDIIALAGSTGNSTGPH 301

Query: 62  VHFELRKNAIAMDPIKFLE 80
           VH+E+R N    +PI FL 
Sbjct: 302 VHYEVRVNGSPTNPILFLP 320


>gi|15598819|ref|NP_252313.1| hypothetical protein PA3623 [Pseudomonas aeruginosa PAO1]
 gi|218890152|ref|YP_002439016.1| putative lipoprotein NlpD [Pseudomonas aeruginosa LESB58]
 gi|254236537|ref|ZP_04929860.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254242321|ref|ZP_04935643.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|1171734|sp|P45682|NLPD_PSEAE RecName: Full=Lipoprotein nlpD/lppB homolog; Flags: Precursor
 gi|9949781|gb|AAG07011.1|AE004782_9 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|440377|dbj|BAA05130.1| unnamed protein product [Pseudomonas aeruginosa]
 gi|52632372|gb|AAU85547.1| lipoprotein [Pseudomonas sp. M18]
 gi|126168468|gb|EAZ53979.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126195699|gb|EAZ59762.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218770375|emb|CAW26140.1| putative lipoprotein NlpD [Pseudomonas aeruginosa LESB58]
          Length = 297

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H+++ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 218 VVYAGSGLRGYGELVIIKHNETYVSAYGHNRRLLVREGQQVKVGQSIAEMGSTG-TDRVK 276

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 277 LHFEIRRQGKPVDPLQYLPRR 297


>gi|146308042|ref|YP_001188507.1| peptidase M23B [Pseudomonas mendocina ymp]
 gi|145576243|gb|ABP85775.1| peptidase M23B [Pseudomonas mendocina ymp]
          Length = 293

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G A   +
Sbjct: 214 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-ADRVK 272

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 273 LHFEIRRQGKPVDPLQYLPRR 293


>gi|92117340|ref|YP_577069.1| peptidase M23B [Nitrobacter hamburgensis X14]
 gi|91800234|gb|ABE62609.1| peptidase M23B [Nitrobacter hamburgensis X14]
          Length = 449

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 51/80 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN IL+RH +  VT Y+H     V++G  + RG  I  SG+SG A  P
Sbjct: 368 VVAYSGNELKGYGNLILVRHPNGYVTAYAHASELLVKRGDTIKRGQVIAKSGQSGEAASP 427

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK +  +DP++FL 
Sbjct: 428 QLHFEIRKGSTPVDPLQFLN 447


>gi|168333513|ref|ZP_02691782.1| peptidase M23B [Epulopiscium sp. 'N.t. morphotype B']
          Length = 465

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G  +   G T++I H D + T+Y H  T  V  G  V  G  I   G +G +   
Sbjct: 384 VVIIAGW-VNGFGYTVMIDHGDGLTTLYGHNSTLNVNVGDYVYAGQKIAGIGSTGYSTGN 442

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
             HFE+R +    +P  +L  K
Sbjct: 443 HSHFEVRVHGQHTNPWPYLGGK 464


>gi|300871512|ref|YP_003786385.1| LysM domain/M23/M37 peptidase domain-containing protein
           [Brachyspira pilosicoli 95/1000]
 gi|300689213|gb|ADK31884.1| LysM domain/M23/M37 peptidase domain protein [Brachyspira
           pilosicoli 95/1000]
          Length = 392

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GN +++RHD    T Y H++      G  V  G  IG  G +GN+    
Sbjct: 307 VIFAGYS-GGFGNLVIVRHDKGYTTYYGHLNKITTTVGANVGVGVMIGRMGSTGNSTGSH 365

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+N +A++P  F+ 
Sbjct: 366 LHFEVRRNGVALNPADFIP 384


>gi|114798467|ref|YP_761317.1| M23 family peptidase [Hyphomonas neptunium ATCC 15444]
 gi|114738641|gb|ABI76766.1| peptidase, M23 family [Hyphomonas neptunium ATCC 15444]
          Length = 405

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      G  + I H     + Y H+ +  V+KG  +  G  +G  G +G +    
Sbjct: 320 VVHAGPR-GGYGLLVEIDHGHGFKSRYGHLRSYTVKKGDVIKVGDLVGRMGSTGRSTGDH 378

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+  N    DP+KFL+
Sbjct: 379 LHYEVWYNDKPYDPMKFLK 397


>gi|269837678|ref|YP_003319906.1| peptidase M23 [Sphaerobacter thermophilus DSM 20745]
 gi|269786941|gb|ACZ39084.1| Peptidase M23 [Sphaerobacter thermophilus DSM 20745]
          Length = 407

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      G+ ++I H + I T Y H  +  V  G++V RG  + LSG +G +   
Sbjct: 326 VVRIAGWS-GAYGSLVVIDHGNGISTYYGHNSSVLVSPGERVERGQVVALSGNTGRSTGA 384

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VH+E+R N   +DP  FL
Sbjct: 385 HVHYEIRVNGTPVDPSPFL 403


>gi|188026336|ref|ZP_02997867.1| hypothetical protein PROSTU_03760 [Providencia stuartii ATCC 25827]
 gi|188022513|gb|EDU60553.1| hypothetical protein PROSTU_03760 [Providencia stuartii ATCC 25827]
          Length = 268

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V+  Q V+ G  I   G +G +   +
Sbjct: 189 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTLLVRDQQDVAAGQKIATMGSTGTSS-VR 247

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 248 LHFEIRYKGKSVNPLRYLPQR 268


>gi|84684979|ref|ZP_01012879.1| peptidase, M23/M37 family [Maritimibacter alkaliphilus HTCC2654]
 gi|84667314|gb|EAQ13784.1| peptidase, M23/M37 family [Rhodobacterales bacterium HTCC2654]
          Length = 410

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V +        G  I ++H+  + T Y+H+    V+KGQ+VSRG  IG  G SG +  P
Sbjct: 326 VVTHADWQ-SGYGRLIKVQHEFGLETRYAHLSRIRVKKGQRVSRGDLIGDMGNSGRSTGP 384

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R    A++P+ +++
Sbjct: 385 HLHYEVRVGGKAVNPMTYIK 404


>gi|317121054|ref|YP_004101057.1| peptidase M23 [Thermaerobacter marianensis DSM 12885]
 gi|315591034|gb|ADU50330.1| Peptidase M23 [Thermaerobacter marianensis DSM 12885]
          Length = 460

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+     +   GN I+I HD++  T+Y+H+   YV  G  V RG  IG+ G +G +   
Sbjct: 382 IVV-ASQYMSGYGNAIIIAHDETFSTLYAHLSRRYVGPGDVVRRGQVIGMVGTTGASTGT 440

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R N   +DP+ +L 
Sbjct: 441 HLHFEVRINGQPVDPMPYLR 460


>gi|149202093|ref|ZP_01879066.1| peptidase, M23/M37 family protein [Roseovarius sp. TM1035]
 gi|149144191|gb|EDM32222.1| peptidase, M23/M37 family protein [Roseovarius sp. TM1035]
          Length = 416

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G  L   G  I I+H   I T Y+H+    V  GQ+VSRG  IG  G SG +   
Sbjct: 332 VVTHAGW-LSGYGRLIKIQHAFGIETRYAHLSQIRVNVGQRVSRGERIGDMGNSGRSTGT 390

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R    +++P+ +++
Sbjct: 391 HLHYEVRVGDKSVNPMIYIK 410


>gi|120601199|ref|YP_965599.1| peptidase M23B [Desulfovibrio vulgaris DP4]
 gi|120561428|gb|ABM27172.1| peptidase M23B [Desulfovibrio vulgaris DP4]
 gi|311235284|gb|ADP88138.1| Peptidase M23 [Desulfovibrio vulgaris RCH1]
          Length = 301

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G D    GN ++++H   + T Y+H+    V++GQ + RG  IG  G SG    P 
Sbjct: 223 VTFAGTD-GAYGNCVILQHGAGLSTRYAHMQRFVVKEGQSIQRGDIIGYVGSSGRTTGPH 281

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N + ++P++++
Sbjct: 282 LHYEVRVNGVCVNPMRYI 299


>gi|52426323|ref|YP_089460.1| NlpD protein [Mannheimia succiniciproducens MBEL55E]
 gi|52308375|gb|AAU38875.1| NlpD protein [Mannheimia succiniciproducens MBEL55E]
          Length = 270

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V   Q+V  G  I   G SG     +
Sbjct: 191 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDSISVNDQQEVKAGQQIAKMGSSGTNS-TK 249

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP  +L  +
Sbjct: 250 LHFEIRYKGKSVDPTSYLPRR 270


>gi|225175302|ref|ZP_03729297.1| Peptidase M23 [Dethiobacter alkaliphilus AHT 1]
 gi|225169054|gb|EEG77853.1| Peptidase M23 [Dethiobacter alkaliphilus AHT 1]
          Length = 401

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 41/71 (57%)

Query: 10  VELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN 69
              GN +++ H   + T Y+H+   +V  G+ V RG  +G+ G +G +  P +HFE+R N
Sbjct: 331 RGYGNLVIVDHGGGVATAYAHLARFHVSNGETVGRGQPLGVIGSTGASTGPHLHFEVRIN 390

Query: 70  AIAMDPIKFLE 80
              ++P+ +++
Sbjct: 391 GERVNPLPYIQ 401


>gi|222148964|ref|YP_002549921.1| lipoprotein [Agrobacterium vitis S4]
 gi|221735950|gb|ACM36913.1| lipoprotein [Agrobacterium vitis S4]
          Length = 538

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 47/80 (58%), Positives = 58/80 (72%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY H D   VQ+GQKV RG  +  SG SGNA  P
Sbjct: 459 VVIYAGNGLKELGNTVLVRHDDGTVTVYGHADAISVQRGQKVQRGQQVATSGMSGNASQP 518

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+RK+A  ++P+ FLE
Sbjct: 519 TLHFEVRKDATPVNPMGFLE 538


>gi|116051620|ref|YP_789541.1| hypothetical protein PA14_17470 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115586841|gb|ABJ12856.1| putative lipoprotein NlpD [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 297

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H+++ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 218 VVYAGSGLRGYGELVIIKHNETYVSAYGHNRRLLVREGQQVKVGQSIAEMGSTG-TDRVK 276

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 277 LHFEIRRQGKPVDPLQYLPRR 297


>gi|260892377|ref|YP_003238474.1| peptidase M23 [Ammonifex degensii KC4]
 gi|260864518|gb|ACX51624.1| Peptidase M23 [Ammonifex degensii KC4]
          Length = 372

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIYVG  L   G  +++ H   + T+Y+H+    V +GQ+V +G  IG  G +G A  P 
Sbjct: 296 VIYVGT-LRGYGLVVMVDHGGGLTTLYAHLSATAVSEGQEVKKGKPIGSVGATGLATGPH 354

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N +  DP  ++
Sbjct: 355 LHFEVRVNGVPQDPAGYV 372


>gi|304315816|ref|YP_003850961.1| peptidase M23 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302777318|gb|ADL67877.1| Peptidase M23 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 311

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G +    G  + I H +++ T Y+H+    V KGQ V  G  IG  G +G +  P 
Sbjct: 234 VVYAGWND-GYGLVVFIWHSNNLETRYAHLSKIAVNKGQIVRAGDVIGYVGSTGKSTGPH 292

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    A++P+ F +
Sbjct: 293 LHFEVRNGGKAVNPLDFFK 311


>gi|254252248|ref|ZP_04945566.1| Peptidoglycan-binding LysM [Burkholderia dolosa AUO158]
 gi|124894857|gb|EAY68737.1| Peptidoglycan-binding LysM [Burkholderia dolosa AUO158]
          Length = 293

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 214 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 272

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 273 LHFEVRRQGKPVDPLKYLP 291


>gi|313500210|gb|ADR61576.1| Peptidase M23B [Pseudomonas putida BIRD-1]
          Length = 352

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 273 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 331

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 332 LHFEIRRQGKPVDPLQFLPRR 352


>gi|297566447|ref|YP_003685419.1| peptidase M23 [Meiothermus silvanus DSM 9946]
 gi|296850896|gb|ADH63911.1| Peptidase M23 [Meiothermus silvanus DSM 9946]
          Length = 414

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 37/79 (46%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G      G  ++I H   + T+Y H+    VQ GQ V RG  IG  G +G +  P 
Sbjct: 336 VETAGWSSWGYGLHVIIDHGSGVETLYGHMSRIAVQPGQFVERGQLIGYVGSTGWSTGPH 395

Query: 62  VHFELRKNAIAMDPIKFLE 80
            HFE+R      +P+ +L 
Sbjct: 396 CHFEVRVGGGTRNPLAYLP 414


>gi|85705243|ref|ZP_01036342.1| peptidase, M23/M37 family protein [Roseovarius sp. 217]
 gi|85670116|gb|EAQ24978.1| peptidase, M23/M37 family protein [Roseovarius sp. 217]
          Length = 416

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G  L   G  I I+H   I T Y+H+    V  GQ+VSRG  IG  G SG +   
Sbjct: 332 VVTHAGW-LSGYGRLIKIKHAFGIETRYAHLSQIRVNVGQRVSRGDRIGDMGNSGRSTGT 390

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R    +++P+ +++
Sbjct: 391 HLHYEVRVGDQSVNPMIYIK 410


>gi|329122517|ref|ZP_08251102.1| outer membrane antigenic lipoprotein B [Haemophilus aegyptius ATCC
           11116]
 gi|327473207|gb|EGF18629.1| outer membrane antigenic lipoprotein B [Haemophilus aegyptius ATCC
           11116]
          Length = 405

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVVDQQEVKAGQDIAKMGSSG-TNAVK 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 385 LHFEVRYKGKSVDPVRYLPRR 405


>gi|300864364|ref|ZP_07109237.1| hypothetical protein OSCI_850007 [Oscillatoria sp. PCC 6506]
 gi|300337639|emb|CBN54383.1| hypothetical protein OSCI_850007 [Oscillatoria sp. PCC 6506]
          Length = 834

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y   +    G  + + H +  VT+Y+H +   VQ+GQ+V++G  I   G +G +  P
Sbjct: 746 VVTYASWNDGGYGYLVEVTHANGTVTLYAHNNRILVQEGQRVAQGQQISEMGSTGFSTGP 805

Query: 61  QVHFELRKNAI-AMDPIKFLEE 81
            +HFE+  +A  A++P+ FL +
Sbjct: 806 HLHFEIHTSAQGAVNPMAFLPD 827


>gi|237739939|ref|ZP_04570420.1| cell wall endopeptidase [Fusobacterium sp. 2_1_31]
 gi|229421956|gb|EEO37003.1| cell wall endopeptidase [Fusobacterium sp. 2_1_31]
          Length = 249

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  I+IRHD+   T Y+H+       G+ V++G  IG +G SG     
Sbjct: 171 VVTFAGN-MSGYGKIIIIRHDNGYETRYAHLSVISTNVGEHVNQGDLIGKTGNSGRTTGA 229

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R+N +  +P+K+L 
Sbjct: 230 HLHFEIRQNGVPKNPMKYLR 249


>gi|182627068|ref|ZP_02954791.1| peptidase, M23/M37 family [Clostridium perfringens D str. JGS1721]
 gi|177907565|gb|EDT70209.1| peptidase, M23/M37 family [Clostridium perfringens D str. JGS1721]
          Length = 384

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 39/78 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+         GN ++I H     T+Y+H     V  GQKV +G  + L G +G +  P 
Sbjct: 307 VVTAAEYHPAYGNMVIIDHGGGFSTLYAHASQLKVSVGQKVKQGQVVSLVGSTGYSTGPH 366

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R N   ++P+ ++
Sbjct: 367 AHFEIRINGQHVNPMDYI 384


>gi|168213281|ref|ZP_02638906.1| peptidase, M23/M37 family [Clostridium perfringens CPE str. F4969]
 gi|170715168|gb|EDT27350.1| peptidase, M23/M37 family [Clostridium perfringens CPE str. F4969]
          Length = 384

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 39/78 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+         GN ++I H     T+Y+H     V  GQKV +G  + L G +G +  P 
Sbjct: 307 VVTAAEYHPAYGNMVIIDHGGGFSTLYAHASQLKVSVGQKVKQGQVVSLVGSTGYSTGPH 366

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R N   ++P+ ++
Sbjct: 367 AHFEIRINGQHVNPMDYI 384


>gi|168210238|ref|ZP_02635863.1| peptidase, M23/M37 family [Clostridium perfringens B str. ATCC
           3626]
 gi|170711721|gb|EDT23903.1| peptidase, M23/M37 family [Clostridium perfringens B str. ATCC
           3626]
          Length = 384

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 39/78 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+         GN ++I H     T+Y+H     V  GQKV +G  + L G +G +  P 
Sbjct: 307 VVTAAEYHPAYGNMVIIDHGGGFSTLYAHASQLKVSVGQKVKQGQVVSLVGSTGYSTGPH 366

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R N   ++P+ ++
Sbjct: 367 AHFEIRINGQHVNPMDYI 384


>gi|168205636|ref|ZP_02631641.1| peptidase, M23/M37 family [Clostridium perfringens E str. JGS1987]
 gi|170662829|gb|EDT15512.1| peptidase, M23/M37 family [Clostridium perfringens E str. JGS1987]
          Length = 384

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 39/78 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+         GN ++I H     T+Y+H     V  GQKV +G  + L G +G +  P 
Sbjct: 307 VVTAAEYHPAYGNMVIIDHGGGFSTLYAHASQLKVSVGQKVKQGQVVSLVGSTGYSTGPH 366

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R N   ++P+ ++
Sbjct: 367 AHFEIRINGQHVNPMDYI 384


>gi|110803618|ref|YP_697525.1| M24/M37 family peptidase [Clostridium perfringens SM101]
 gi|110684119|gb|ABG87489.1| peptidase, M23/M37 family [Clostridium perfringens SM101]
          Length = 399

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 39/78 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+         GN ++I H     T+Y+H     V  GQKV +G  + L G +G +  P 
Sbjct: 322 VVTAAEYHPAYGNMVIIDHGGGFSTLYAHASQLKVSVGQKVKQGQVVSLVGSTGYSTGPH 381

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R N   ++P+ ++
Sbjct: 382 AHFEIRINGQHVNPMDYI 399


>gi|110801116|ref|YP_694655.1| M24/M37 family peptidase [Clostridium perfringens ATCC 13124]
 gi|110675763|gb|ABG84750.1| peptidase, M23/M37 family [Clostridium perfringens ATCC 13124]
          Length = 399

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 39/78 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+         GN ++I H     T+Y+H     V  GQKV +G  + L G +G +  P 
Sbjct: 322 VVTAAEYHPAYGNMVIIDHGGGFSTLYAHASQLKVSVGQKVKQGQVVSLVGSTGYSTGPH 381

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R N   ++P+ ++
Sbjct: 382 AHFEIRINGQHVNPMDYI 399


>gi|53719138|ref|YP_108124.1| peptidase [Burkholderia pseudomallei K96243]
 gi|53723559|ref|YP_103015.1| lipoprotein NlpD [Burkholderia mallei ATCC 23344]
 gi|52209552|emb|CAH35505.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei
           K96243]
 gi|52426982|gb|AAU47575.1| lipoprotein NlpD, putative [Burkholderia mallei ATCC 23344]
          Length = 298

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 219 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 277

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 278 LHFEVRRQGKPVDPLKYLP 296


>gi|313109027|ref|ZP_07795000.1| putative lipoprotein NlpD [Pseudomonas aeruginosa 39016]
 gi|310881502|gb|EFQ40096.1| putative lipoprotein NlpD [Pseudomonas aeruginosa 39016]
          Length = 297

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H+++ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 218 VVYAGSGLRGYGELVIIKHNETYVSAYGHNRRLLVREGQQVKVGQSIAEMGSTG-TDRVK 276

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 277 LHFEIRRQGKPVDPLQYLPRR 297


>gi|303325583|ref|ZP_07356026.1| M23 peptidase domain protein [Desulfovibrio sp. 3_1_syn3]
 gi|302863499|gb|EFL86430.1| M23 peptidase domain protein [Desulfovibrio sp. 3_1_syn3]
          Length = 296

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI    D    GN++ I H   IVT Y H+    VQ GQ V RG  IG  G SG    P 
Sbjct: 218 VILAARD-GAYGNSVEINHGGGIVTKYGHMQRWAVQPGQWVKRGEIIGYIGMSGRTTGPH 276

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N + ++P++++
Sbjct: 277 LHYEVRLNGVPVNPMRYI 294


>gi|186475726|ref|YP_001857196.1| peptidase M23B [Burkholderia phymatum STM815]
 gi|184192185|gb|ACC70150.1| peptidase M23B [Burkholderia phymatum STM815]
          Length = 312

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 233 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 291

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 292 LHFEVRRQGKPVDPMKYLP 310


>gi|298291861|ref|YP_003693800.1| peptidase M23 [Starkeya novella DSM 506]
 gi|296928372|gb|ADH89181.1| Peptidase M23 [Starkeya novella DSM 506]
          Length = 391

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 50/79 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G++L   GN +L++H D  VT Y+H     V+KG  V RG  I  +G++GN   P
Sbjct: 310 VVAYAGSELKGYGNLVLVKHADGWVTAYAHNSELDVKKGDTVKRGQVIAKAGQTGNVSSP 369

Query: 61  QVHFELRKNAIAMDPIKFL 79
           QVHFE+RK +  +DP ++L
Sbjct: 370 QVHFEIRKGSQPVDPSQYL 388


>gi|18309184|ref|NP_561118.1| cell wall-binding protein [Clostridium perfringens str. 13]
 gi|18143859|dbj|BAB79908.1| probable cell wall-binding protein [Clostridium perfringens str.
           13]
          Length = 399

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 39/78 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+         GN ++I H     T+Y+H     V  GQKV +G  + L G +G +  P 
Sbjct: 322 VVTAAEYHPAYGNMVIIDHGGGFSTLYAHASQLKVSAGQKVKQGQVVSLVGSTGYSTGPH 381

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R N   ++P+ ++
Sbjct: 382 AHFEIRINGQHVNPMDYI 399


>gi|119897380|ref|YP_932593.1| lipoprotein [Azoarcus sp. BH72]
 gi|119669793|emb|CAL93706.1| conserved hypothetical lipoprotein [Azoarcus sp. BH72]
          Length = 302

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H+    +VY+H     V++  +VS+G  I   G + +A  P+
Sbjct: 223 VVYAGSGLRGYGKLVIIKHNQEYNSVYAHNQKLLVKEDDQVSQGQKIAELGST-DADRPK 281

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK    +DP+KFL  +
Sbjct: 282 LHFEIRKQGRPVDPMKFLSAR 302


>gi|167574175|ref|ZP_02367049.1| peptidase M23B [Burkholderia oklahomensis C6786]
          Length = 186

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN L   GN ++I+HDD  +T Y+H     V++G KV++G  I   G S +A   
Sbjct: 106 VVAYAGNSLRGYGNFVIIKHDDVYLTAYAHNRALMVKEGDKVAKGRKIAEMGSS-DADRV 164

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R+  + +DP+K+L  +
Sbjct: 165 MLHFEIRRKGVPVDPLKYLPAQ 186


>gi|108759235|ref|YP_632620.1| cell wall endopeptidase [Myxococcus xanthus DK 1622]
 gi|108463115|gb|ABF88300.1| cell wall peptidase, M23 family [Myxococcus xanthus DK 1622]
          Length = 311

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G      GN +++ H + ++T+Y+H     V+ GQKV R   I   G+SG    P 
Sbjct: 229 VLYAGEQ-RGYGNIVIVEHTNKLITLYAHNRDLRVRTGQKVRREQVIATVGESGRTSGPH 287

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R +   +DP+ FL
Sbjct: 288 LHFEVRLDGKPVDPLDFL 305


>gi|290476559|ref|YP_003469464.1| lipoprotein [Xenorhabdus bovienii SS-2004]
 gi|289175897|emb|CBJ82700.1| lipoprotein [Xenorhabdus bovienii SS-2004]
          Length = 336

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V+  Q V  G  I   G +G +   +
Sbjct: 257 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVRDSQDVQAGQKIATMGSTGTS-LVK 315

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P++ L ++
Sbjct: 316 LHFEIRYKGKSVNPLRHLPQR 336


>gi|85709764|ref|ZP_01040829.1| Peptidase M23/M37 [Erythrobacter sp. NAP1]
 gi|85688474|gb|EAQ28478.1| Peptidase M23/M37 [Erythrobacter sp. NAP1]
          Length = 358

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      G  + I H + I+T Y+H+     + GQ +  G T+G  G +G +  P 
Sbjct: 269 VTFAGRR-GGYGKCVEITHTNGIMTRYAHLSRIDAKVGQSIEAGETLGGLGSTGRSTGPH 327

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N   ++P  FLE
Sbjct: 328 LHFEVRVNGRPVNPRPFLE 346


>gi|254485766|ref|ZP_05098971.1| peptidase, M23/M37 family [Roseobacter sp. GAI101]
 gi|214042635|gb|EEB83273.1| peptidase, M23/M37 family [Roseobacter sp. GAI101]
          Length = 436

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      G  + I+H+  + T Y+H+    V+ GQ+VSRG  IG  G SG     
Sbjct: 352 VVTSAGWG-SGYGRLVKIQHEFGVETRYAHMSKIRVKVGQRVSRGQHIGDMGASGRVTGV 410

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R    A++P+ F++
Sbjct: 411 HLHYEVRVGGKAVNPMIFIK 430


>gi|121598281|ref|YP_993164.1| putative lipoprotein NlpD [Burkholderia mallei SAVP1]
 gi|124385128|ref|YP_001026061.1| putative lipoprotein NlpD [Burkholderia mallei NCTC 10229]
 gi|126441787|ref|YP_001059234.1| M23 family peptidase [Burkholderia pseudomallei 668]
 gi|126451107|ref|YP_001080671.1| putative lipoprotein NlpD [Burkholderia mallei NCTC 10247]
 gi|126454413|ref|YP_001066501.1| M23 family peptidase [Burkholderia pseudomallei 1106a]
 gi|134277130|ref|ZP_01763845.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           305]
 gi|167002253|ref|ZP_02268043.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei
           PRL-20]
 gi|167902386|ref|ZP_02489591.1| lipoprotein NlpD, putative [Burkholderia pseudomallei NCTC 13177]
 gi|167910628|ref|ZP_02497719.1| lipoprotein NlpD, putative [Burkholderia pseudomallei 112]
 gi|217421734|ref|ZP_03453238.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           576]
 gi|237812558|ref|YP_002897009.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           MSHR346]
 gi|238563550|ref|ZP_00438722.2| LysM domain/M23 peptidase domain protein [Burkholderia mallei GB8
           horse 4]
 gi|242315335|ref|ZP_04814351.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           1106b]
 gi|254177838|ref|ZP_04884493.1| putative lipoprotein NlpD [Burkholderia mallei ATCC 10399]
 gi|254189068|ref|ZP_04895579.1| peptidase, M23 family [Burkholderia pseudomallei Pasteur 52237]
 gi|254197841|ref|ZP_04904263.1| peptidase, M23 family [Burkholderia pseudomallei S13]
 gi|254199961|ref|ZP_04906327.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei FMH]
 gi|254206294|ref|ZP_04912646.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei JHU]
 gi|254260734|ref|ZP_04951788.1| peptidase, M23 family [Burkholderia pseudomallei 1710a]
 gi|254297418|ref|ZP_04964871.1| peptidase, M23 family [Burkholderia pseudomallei 406e]
 gi|254358291|ref|ZP_04974564.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei
           2002721280]
 gi|121227091|gb|ABM49609.1| putative lipoprotein NlpD [Burkholderia mallei SAVP1]
 gi|124293148|gb|ABN02417.1| putative lipoprotein NlpD [Burkholderia mallei NCTC 10229]
 gi|126221280|gb|ABN84786.1| peptidase, M23 family [Burkholderia pseudomallei 668]
 gi|126228055|gb|ABN91595.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           1106a]
 gi|126243977|gb|ABO07070.1| putative lipoprotein NlpD [Burkholderia mallei NCTC 10247]
 gi|134250780|gb|EBA50859.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           305]
 gi|147749557|gb|EDK56631.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei FMH]
 gi|147753737|gb|EDK60802.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei JHU]
 gi|148027418|gb|EDK85439.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei
           2002721280]
 gi|157806851|gb|EDO84021.1| peptidase, M23 family [Burkholderia pseudomallei 406e]
 gi|157936747|gb|EDO92417.1| peptidase, M23 family [Burkholderia pseudomallei Pasteur 52237]
 gi|160698877|gb|EDP88847.1| putative lipoprotein NlpD [Burkholderia mallei ATCC 10399]
 gi|169654582|gb|EDS87275.1| peptidase, M23 family [Burkholderia pseudomallei S13]
 gi|217395476|gb|EEC35494.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           576]
 gi|237505824|gb|ACQ98142.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           MSHR346]
 gi|238520505|gb|EEP83964.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei GB8
           horse 4]
 gi|242138574|gb|EES24976.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           1106b]
 gi|243062070|gb|EES44256.1| LysM domain/M23 peptidase domain protein [Burkholderia mallei
           PRL-20]
 gi|254219423|gb|EET08807.1| peptidase, M23 family [Burkholderia pseudomallei 1710a]
          Length = 296

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 217 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 275

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 276 LHFEVRRQGKPVDPLKYLP 294


>gi|169344289|ref|ZP_02865269.1| peptidase, M23/M37 family [Clostridium perfringens C str. JGS1495]
 gi|169297547|gb|EDS79649.1| peptidase, M23/M37 family [Clostridium perfringens C str. JGS1495]
          Length = 399

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 39/78 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+         GN ++I H     T+Y+H     V  GQKV +G  + L G +G +  P 
Sbjct: 322 VVTAAEYHPAYGNMVIIDHGGGFSTLYAHASQLKVSVGQKVKQGEVVSLVGSTGYSTGPH 381

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R N   ++P+ ++
Sbjct: 382 AHFEIRINGQHVNPMDYI 399


>gi|33865748|ref|NP_897307.1| putative peptidase [Synechococcus sp. WH 8102]
 gi|33632918|emb|CAE07729.1| putative peptidase [Synechococcus sp. WH 8102]
          Length = 346

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I H D   T Y+H     V KGQ V +G  I L G +G +  P
Sbjct: 263 IVTFAGWS-GAYGYLVEIAHGDGESTRYAHNSRLIVSKGQVVPQGAPIALMGSTGRSTGP 321

Query: 61  QVHFELRK-NAIAMDPIKFLEEK 82
            +HFE+R+    A++P+  L ++
Sbjct: 322 HLHFEIRRSGGAAVNPLSKLPQR 344


>gi|320450625|ref|YP_004202721.1| cell wall endopeptidase, family M23/M37 [Thermus scotoductus SA-01]
 gi|320150794|gb|ADW22172.1| cell wall endopeptidase, family M23/M37 [Thermus scotoductus SA-01]
          Length = 397

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 41/79 (51%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G   V  G  +++ H   + T+Y+H+    V+ GQ V  G  IG  G +G +  P 
Sbjct: 319 VEVAGWSSVGYGFHVVLDHGGGVETLYAHMSRIAVRAGQWVEAGQVIGYVGSTGWSTGPH 378

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R   +A +P+ +L 
Sbjct: 379 LHFEVRVGGVARNPLAYLP 397


>gi|294012656|ref|YP_003546116.1| putative metalloendopeptidase [Sphingobium japonicum UT26S]
 gi|292675986|dbj|BAI97504.1| putative metalloendopeptidase [Sphingobium japonicum UT26S]
          Length = 216

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      GN + I H   + T Y H+    V     V RG  IGL G +G +   
Sbjct: 110 IVSRAGWA-SGYGNLVQISHGGGMETRYGHMSKLLVSPNSYVHRGQLIGLMGSTGRSTGS 168

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R +  A++PI F+
Sbjct: 169 HLHYEVRVDGQAINPIPFV 187


>gi|145629596|ref|ZP_01785393.1| outer membrane antigenic lipoprotein B [Haemophilus influenzae
           22.1-21]
 gi|144978107|gb|EDJ87880.1| outer membrane antigenic lipoprotein B [Haemophilus influenzae
           22.1-21]
          Length = 405

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q++  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEIKAGQDIAKMGSSGTNT-VK 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L ++
Sbjct: 385 LHFEIRYKGKSVDPVRYLPKR 405


>gi|145589478|ref|YP_001156075.1| peptidase M23B [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145047884|gb|ABP34511.1| peptidase M23B [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 270

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++HD++ +T Y+H     V++G  V +G  I   G + +    +
Sbjct: 193 VVYAGNSLRGYGNLVIVKHDNTYLTAYAHNSKLLVKEGDTVRKGQKIAEMGDT-DTTSVK 251

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFELR N   ++P  +L+
Sbjct: 252 LHFELRVNGKPVNPTPYLQ 270


>gi|209885381|ref|YP_002289238.1| peptidase M23B [Oligotropha carboxidovorans OM5]
 gi|209873577|gb|ACI93373.1| peptidase M23B [Oligotropha carboxidovorans OM5]
          Length = 442

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 50/80 (62%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN IL+RH +  VT Y+H     V++G  + RG  I  SG++G    P
Sbjct: 361 VVAYSGNELKGYGNLILVRHANGYVTAYAHASELMVKRGDSIKRGQIIAKSGQTGEVGSP 420

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK +  +DP++FL 
Sbjct: 421 QLHFEIRKGSSPVDPLQFLN 440


>gi|148826652|ref|YP_001291405.1| lipoprotein [Haemophilus influenzae PittEE]
 gi|319775450|ref|YP_004137938.1| Lipoprotein [Haemophilus influenzae F3047]
 gi|148716812|gb|ABQ99022.1| lipoprotein [Haemophilus influenzae PittEE]
 gi|317450041|emb|CBY86255.1| Lipoprotein [Haemophilus influenzae F3047]
          Length = 405

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 VVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVVDQQEVKAGQDIAKMGSSG-TNAVK 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 385 LHFEVRYKGKSVDPVRYLPRR 405


>gi|46581642|ref|YP_012450.1| M24/M37 family peptidase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46451065|gb|AAS97710.1| peptidase, M23/M37 family [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 329

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G D    GN ++++H   + T Y+H+    V++GQ + RG  IG  G SG    P 
Sbjct: 251 VTFAGTD-GAYGNCVILQHGAGLSTRYAHMQRFVVKEGQSIQRGDIIGYVGSSGRTTGPH 309

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N + ++P++++
Sbjct: 310 LHYEVRVNGVCVNPMRYI 327


>gi|90424022|ref|YP_532392.1| peptidase M23B [Rhodopseudomonas palustris BisB18]
 gi|90106036|gb|ABD88073.1| peptidase M23B [Rhodopseudomonas palustris BisB18]
          Length = 464

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 52/80 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G+ + RG TI  SG+SG    P
Sbjct: 383 VVAYSGNELKGYGNLVLVRHSNGYVTAYAHASELMVKRGETIKRGQTIAKSGQSGEVGSP 442

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK +  +DP++FL 
Sbjct: 443 QLHFEIRKGSAPVDPLQFLN 462


>gi|226197348|ref|ZP_03792925.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|225930727|gb|EEH26737.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           Pakistan 9]
          Length = 296

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 217 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 275

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 276 LHFEVRRQGKPVDPLKYLP 294


>gi|332799601|ref|YP_004461100.1| peptidase M23 [Tepidanaerobacter sp. Re1]
 gi|332697336|gb|AEE91793.1| Peptidase M23 [Tepidanaerobacter sp. Re1]
          Length = 380

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G+     GNTI++ H   I T YSH+    V +G+KV +G  IGL G +G +  P 
Sbjct: 303 VIFSGS-YGGYGNTIIVSHGGGISTQYSHLSKLLVAEGKKVLKGDKIGLVGSTGWSTGPH 361

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HF + K+   ++P  +L+
Sbjct: 362 LHFGVIKDGEVVNPWNWLK 380


>gi|264679431|ref|YP_003279338.1| peptidase M23B [Comamonas testosteroni CNB-2]
 gi|299530514|ref|ZP_07043934.1| peptidase M23B [Comamonas testosteroni S44]
 gi|262209944|gb|ACY34042.1| peptidase M23B [Comamonas testosteroni CNB-2]
 gi|298721490|gb|EFI62427.1| peptidase M23B [Comamonas testosteroni S44]
          Length = 286

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN I+++H+++ +T Y+H  +  V++ Q V +G  I   G + +A   +
Sbjct: 207 VVYAGAGLRGYGNLIILKHNNTYLTAYAHNQSLLVKEDQAVKKGQKIAEMGST-DADRVK 265

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 266 LHFEVRRQGKPVDPSRYLPSR 286


>gi|78066591|ref|YP_369360.1| peptidase M23B [Burkholderia sp. 383]
 gi|77967336|gb|ABB08716.1| Peptidase M23B [Burkholderia sp. 383]
          Length = 294

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 215 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 273

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 274 LHFEVRRQGKPVDPLKYLP 292


>gi|103485523|ref|YP_615084.1| peptidase M23B [Sphingopyxis alaskensis RB2256]
 gi|98975600|gb|ABF51751.1| peptidase M23B [Sphingopyxis alaskensis RB2256]
          Length = 402

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VG      GN + + H   I+T Y+H+     + G KV+ G  I   G +G +    
Sbjct: 299 VSFVG-VKSGYGNVVEVDHGQGIMTRYAHLSGFTTRAGVKVAAGQQIAKMGSTGRSTGSH 357

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R N +A++P +FLE K
Sbjct: 358 LHFEVRLNGVAVNPRRFLEAK 378


>gi|222085791|ref|YP_002544321.1| lipoprotein precursor protein [Agrobacterium radiobacter K84]
 gi|221723239|gb|ACM26395.1| lipoprotein precursor protein [Agrobacterium radiobacter K84]
          Length = 572

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 59/80 (73%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY H D   V +GQKV RG T+  SG SG+ + P
Sbjct: 493 VVIYAGNGLKELGNTVLVRHDDGTVTVYGHADALSVARGQKVQRGQTLATSGMSGDVKQP 552

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RKN+  ++P+ FLE
Sbjct: 553 QLHFEVRKNSAPVNPMTFLE 572


>gi|228939640|ref|ZP_04102223.1| peptidase M23B [Bacillus thuringiensis serovar berliner ATCC 10792]
 gi|228956189|ref|ZP_04118072.1| peptidase M23B [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228803506|gb|EEM50242.1| peptidase M23B [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228820064|gb|EEM66106.1| peptidase M23B [Bacillus thuringiensis serovar berliner ATCC 10792]
 gi|326943381|gb|AEA19276.1| peptidase M23B [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 305

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G  +   GN +++ H +   T Y+H+++  V K  KV  G  IG  G +G++    
Sbjct: 226 VTFAGT-MGGYGNLVILDHGNGFETRYAHLNSITVSKDAKVIAGQIIGHVGSTGDSTGAH 284

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +H E R N   ++P+ F  +
Sbjct: 285 LHLETRMNGQVLNPLSFFNK 304


>gi|158423355|ref|YP_001524647.1| putative lipoprotein [Azorhizobium caulinodans ORS 571]
 gi|158330244|dbj|BAF87729.1| putative lipoprotein [Azorhizobium caulinodans ORS 571]
          Length = 363

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 48/78 (61%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y GN+L   GN +LI+H D  VT Y+H     V++G  V RG  I  +G+SG    PQ
Sbjct: 283 VAYAGNELKGYGNLVLIKHADGFVTAYAHNSEISVKRGDTVRRGQIIAKAGQSGGVTTPQ 342

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RK +  +DP +++
Sbjct: 343 LHFEIRKGSQPVDPSQYV 360


>gi|134300902|ref|YP_001114398.1| peptidase M23B [Desulfotomaculum reducens MI-1]
 gi|134053602|gb|ABO51573.1| peptidase M23B [Desulfotomaculum reducens MI-1]
          Length = 374

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   G  ++I H   +V++Y H+    V KGQ V++G TI   G +G +  P 
Sbjct: 298 VIYSGT-MTGYGKVVMIDHGGDVVSLYGHLSAQLVSKGQVVTKGSTIAQVGSTGMSTGPH 356

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RKN  A+ P  +L
Sbjct: 357 LHFEVRKNGSAVSPHNYL 374


>gi|134301126|ref|YP_001114622.1| peptidase M23B [Desulfotomaculum reducens MI-1]
 gi|134053826|gb|ABO51797.1| peptidase M23B [Desulfotomaculum reducens MI-1]
          Length = 448

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      G  + I H + IVT Y+H+ T  V  GQ V RG +IG  G +G +  P 
Sbjct: 372 VIRAGW-YGAYGKCVDINHGNGIVTRYAHLSTINVSVGQNVERGQSIGNVGSTGRSTGPH 430

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+  N +  +P+ +L
Sbjct: 431 LHFEVIVNGVPKNPVGYL 448


>gi|220931329|ref|YP_002508237.1| peptidase M23B [Halothermothrix orenii H 168]
 gi|219992639|gb|ACL69242.1| peptidase M23B [Halothermothrix orenii H 168]
          Length = 419

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G      G TI+I H     T+Y+H      + G+ V+RG  I LSG +G +  P 
Sbjct: 342 VVYSGWA-RGYGLTIIIEHRKGFRTLYAHNSKLLARSGEWVNRGEVIALSGNTGRSTGPH 400

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE++ N   ++P+ +L+
Sbjct: 401 LHFEVQVNGRPVNPLNYLK 419


>gi|260655310|ref|ZP_05860798.1| peptidase, M23/M37 family [Jonquetella anthropi E3_33 E1]
 gi|260629758|gb|EEX47952.1| peptidase, M23/M37 family [Jonquetella anthropi E3_33 E1]
          Length = 392

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  +   G  +++ H + + TVY+H+    VQ+G KVS G T+G  G SG A   
Sbjct: 313 VVLYAGW-IRGYGQIVILDHGNQMSTVYAHLSAITVQEGAKVSAGSTVGRVGSSGVATAT 371

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +HFE+R    A +P+ +L +
Sbjct: 372 HLHFEVRIGGTAKNPVDYLPK 392


>gi|224368261|ref|YP_002602424.1| putative metallopeptidase [Desulfobacterium autotrophicum HRM2]
 gi|223690977|gb|ACN14260.1| putative metallopeptidase [Desulfobacterium autotrophicum HRM2]
          Length = 395

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 50/80 (62%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY    L   GN ++I H D+  T+Y+H++  + +KG++V     I L+G +G+ +   
Sbjct: 315 VIYAEW-LKGYGNLMIINHGDNFYTLYAHVEEFFKKKGERVDTDEVIALAGDTGSIKGTC 373

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R +   +DP+K+L++
Sbjct: 374 LHFEVRHHGRPVDPMKWLKK 393


>gi|167619811|ref|ZP_02388442.1| lipoprotein NlpD, putative [Burkholderia thailandensis Bt4]
 gi|257138957|ref|ZP_05587219.1| lipoprotein NlpD, putative [Burkholderia thailandensis E264]
          Length = 296

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 217 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 275

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 276 LHFEVRRQGKPVDPLKYLP 294


>gi|158338472|ref|YP_001519649.1| peptidase M23 domain-containing protein [Acaryochloris marina
           MBIC11017]
 gi|158308713|gb|ABW30330.1| peptidase M23 domain protein [Acaryochloris marina MBIC11017]
          Length = 411

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI         GN ++I H + + T+Y H    YV  GQ V RG TI   G +G +  P 
Sbjct: 335 VIVAEW-YGGYGNAVIIDHGNGLTTLYGHCSELYVTVGQGVQRGQTIAAVGSTGLSTGPH 393

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R      +P+ +L
Sbjct: 394 LHFEVRVQGEPTEPLAYL 411


>gi|83308757|emb|CAJ01667.1| probable lipoprotein [Methylocapsa acidiphila]
          Length = 430

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 51/79 (64%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN ILIRH +  VT Y++     V++G  V RG TI  SG+SGN   P
Sbjct: 349 VVAYAGNELKGYGNLILIRHPNGFVTAYANNGDIEVKRGDTVKRGQTIAKSGQSGNVASP 408

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFELRK A  +DP ++L
Sbjct: 409 QLHFELRKGATPVDPTQYL 427


>gi|90419389|ref|ZP_01227299.1| putative peptidoglycan-binding peptidase, M23/M37 family
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90336326|gb|EAS50067.1| putative peptidoglycan-binding peptidase, M23/M37 family
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 439

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 56/80 (70%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E GNT+L++HD+ +VTVY H D   V++G KV RG  I  SG SG+   P
Sbjct: 360 VVIYAGDGLKEFGNTVLVKHDNGLVTVYGHADQIDVERGAKVKRGQQIAKSGMSGDTDVP 419

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+RK++  +DP K+L+
Sbjct: 420 LLHFEVRKDSAPVDPTKYLQ 439


>gi|312888567|ref|ZP_07748136.1| Peptidase M23 [Mucilaginibacter paludis DSM 18603]
 gi|311298881|gb|EFQ75981.1| Peptidase M23 [Mucilaginibacter paludis DSM 18603]
          Length = 286

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      GN + + H +++ T+Y H+    V+ GQ+V+ G  +G  G +G++    
Sbjct: 206 VVFAGW-YGGYGNCVRVAHGNNLETLYGHLSRIIVKVGQQVAVGEKVGEVGSTGHSTGTH 264

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+RKN   ++P+ FL
Sbjct: 265 LHYEVRKNGRPVNPVNFL 282


>gi|152987866|ref|YP_001346900.1| hypothetical protein PSPA7_1516 [Pseudomonas aeruginosa PA7]
 gi|150963024|gb|ABR85049.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 307

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H+++ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 228 VVYAGSGLRGYGELVIIKHNETYVSAYGHNRRLLVREGQQVKVGQSIAEMGSTG-TDRVK 286

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 287 LHFEIRRQGKPVDPLQYLPRR 307


>gi|154253710|ref|YP_001414534.1| peptidase M23B [Parvibaculum lavamentivorans DS-1]
 gi|154157660|gb|ABS64877.1| peptidase M23B [Parvibaculum lavamentivorans DS-1]
          Length = 459

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G      G  I I H +   T Y H+    V+ GQK++    IG  G SG +  P 
Sbjct: 372 VSYAGWK-GGYGRVIEIDHGNGFRTRYGHLGKIDVKAGQKIAFREVIGKVGSSGRSSGPH 430

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+  + I  +P KF+E
Sbjct: 431 LHYEVWFDGIVRNPSKFIE 449


>gi|145222454|ref|YP_001133132.1| peptidase M23B [Mycobacterium gilvum PYR-GCK]
 gi|145214940|gb|ABP44344.1| peptidase M23B [Mycobacterium gilvum PYR-GCK]
          Length = 351

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G      GN + +RH D  VT+Y H  +  V  G++V  G  I   G +GN+  P
Sbjct: 261 IVIASG-AEGGYGNAVKLRHADGTVTLYGHNSSLLVSVGERVMAGDQIAKMGNTGNSTGP 319

Query: 61  QVHFELRKNAI-AMDPIKFLEEK 82
            +HFE+  N    +DP  +L ++
Sbjct: 320 HLHFEVHLNGTDRVDPTGWLAKR 342


>gi|330959228|gb|EGH59488.1| lipoprotein [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 288

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 268 LHFEIRRQGKPVDPLEFLPRR 288


>gi|255994781|ref|ZP_05427916.1| peptidase, M23B family [Eubacterium saphenum ATCC 49989]
 gi|255993494|gb|EEU03583.1| peptidase, M23B family [Eubacterium saphenum ATCC 49989]
          Length = 385

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G  +   GN +++ H   + T Y+H  +  V+ GQ VS+G  + LSG +G A  P 
Sbjct: 308 VISAGY-MGSYGNLVVVDHGGGMATAYAHNSSIKVRVGQMVSKGQVLALSGMTGAATGPH 366

Query: 62  VHFELRKNAIAMDPIKFLE 80
            HFE+RKN  A++P+ +L 
Sbjct: 367 CHFEVRKNGTAVNPMSYLR 385


>gi|76810726|ref|YP_333761.1| peptidase [Burkholderia pseudomallei 1710b]
 gi|76580179|gb|ABA49654.1| similar to NlpD of Escherichia coli [Burkholderia pseudomallei
           1710b]
          Length = 292

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 213 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 271

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 272 LHFEVRRQGKPVDPLKYLP 290


>gi|71734830|ref|YP_275948.1| lipoprotein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257487050|ref|ZP_05641091.1| lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289626004|ref|ZP_06458958.1| lipoprotein [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289651480|ref|ZP_06482823.1| lipoprotein [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298488361|ref|ZP_07006393.1| Lipoprotein nlpD precursor [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|71555383|gb|AAZ34594.1| lipoprotein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298157183|gb|EFH98271.1| Lipoprotein nlpD precursor [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320323090|gb|EFW79179.1| lipoprotein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320329638|gb|EFW85627.1| lipoprotein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330868572|gb|EGH03281.1| lipoprotein [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330894624|gb|EGH27285.1| lipoprotein [Pseudomonas syringae pv. mori str. 301020]
 gi|331009311|gb|EGH89367.1| lipoprotein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 288

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|310778732|ref|YP_003967065.1| Peptidase M23 [Ilyobacter polytropus DSM 2926]
 gi|309748055|gb|ADO82717.1| Peptidase M23 [Ilyobacter polytropus DSM 2926]
          Length = 273

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  +   G  ++I H +   T Y+H++   V+KGQK+S+G  I  +G +G +  P 
Sbjct: 197 VTYSGW-MRGYGKVVIINHGNGYETRYAHLNRWLVKKGQKISKGQVIAKTGNTGLSTGPH 255

Query: 62  VHFELRKNAIAMDP 75
           +H+E+RKN+  +DP
Sbjct: 256 LHYEIRKNSKPVDP 269


>gi|208701898|ref|YP_002267177.1| peptidase M23B [Bacillus cereus H3081.97]
 gi|208658190|gb|ACI30556.1| peptidase M23B [Bacillus cereus H3081.97]
          Length = 305

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G  +   GN +++ H +   T Y+H+++  V K  KV  G  IG  G +G++    
Sbjct: 226 VTFAGT-MGGYGNLVILDHGNGFETRYAHLNSITVSKDAKVIAGQIIGHVGSTGDSTGAH 284

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +H E R N   ++P+ F  +
Sbjct: 285 LHLETRMNGQVLNPLSFFNK 304


>gi|313676998|ref|YP_004054994.1| peptidase m23 [Marivirga tractuosa DSM 4126]
 gi|312943696|gb|ADR22886.1| Peptidase M23 [Marivirga tractuosa DSM 4126]
          Length = 325

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 43/78 (55%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI V +     G  ++I H    +T Y+H+ +  V++G KV RG  IG  G +G +  P 
Sbjct: 224 VIRVSSTFGGFGKLVIIDHGYGFITKYAHMSSFNVKRGDKVKRGDCIGFVGTTGTSTAPH 283

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+ K+   ++P+ + 
Sbjct: 284 LHYEIHKDGKPINPVHYF 301


>gi|167567685|ref|ZP_02360601.1| lipoprotein NlpD, putative [Burkholderia oklahomensis EO147]
          Length = 186

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN L   GN ++I+HDD  +T Y+H     V++G KV++G  I   G S +A   
Sbjct: 106 VVAYAGNSLRGYGNFVIIKHDDVYLTAYAHNRALMVKEGDKVAKGRKIAEMGSS-DADRV 164

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R+  + +DP+K+L  +
Sbjct: 165 MLHFEIRRKGVPVDPLKYLPAQ 186


>gi|148469867|gb|ABQ65862.1| lipoprotein [Pseudomonas fluorescens]
          Length = 281

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 202 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKVGQTIAEMGSTG-TDRVK 260

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 261 LHFEIRRQGKPVDPLQFLPRR 281


>gi|330985140|gb|EGH83243.1| lipoprotein [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 288

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|289675303|ref|ZP_06496193.1| peptidoglycan-binding LysM:peptidase M23B [Pseudomonas syringae pv.
           syringae FF5]
 gi|330975367|gb|EGH75433.1| peptidoglycan-binding LysM:peptidase M23B [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 288

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|330878043|gb|EGH12192.1| lipoprotein [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 217

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 138 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 196

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 197 LHFEIRRQGKPVDPLGFLPRR 217


>gi|167719256|ref|ZP_02402492.1| lipoprotein NlpD, putative [Burkholderia pseudomallei DM98]
          Length = 135

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 56  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 114

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 115 LHFEVRRQGKPVDPLKYLP 133


>gi|241764487|ref|ZP_04762508.1| Peptidase M23 [Acidovorax delafieldii 2AN]
 gi|241366071|gb|EER60668.1| Peptidase M23 [Acidovorax delafieldii 2AN]
          Length = 303

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN ++++H+++ +T Y+H  T  V++ Q V RG  I   G + ++   +
Sbjct: 224 VVYAGAGLRGYGNLVILKHNNTFLTAYAHNQTLLVKEDQSVRRGQKIAEMGST-DSDRVK 282

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 283 LHFEIRRQGKPVDPVRYLPAR 303


>gi|307253623|ref|ZP_07535490.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306858859|gb|EFM90905.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
          Length = 412

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G     +
Sbjct: 333 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNS-NK 391

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 392 LHFEIRYKGKSVDPTRYLPRK 412


>gi|307251204|ref|ZP_07533125.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306856720|gb|EFM88855.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 4 str. M62]
          Length = 412

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G     +
Sbjct: 333 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNS-NK 391

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 392 LHFEIRYKGKSVDPTRYLPRK 412


>gi|307249007|ref|ZP_07531015.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
 gi|307258036|ref|ZP_07539788.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|306854465|gb|EFM86660.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
 gi|306863399|gb|EFM95330.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
          Length = 412

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G     +
Sbjct: 333 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNS-NK 391

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 392 LHFEIRYKGKSVDPTRYLPRK 412


>gi|307246869|ref|ZP_07528934.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|307255851|ref|ZP_07537652.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307260304|ref|ZP_07542011.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 11 str.
           56153]
 gi|306852154|gb|EFM84394.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|306861119|gb|EFM93112.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306865555|gb|EFM97436.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 11 str.
           56153]
          Length = 412

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G     +
Sbjct: 333 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNS-NK 391

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 392 LHFEIRYKGKSVDPTRYLPRK 412


>gi|190151289|ref|YP_001969814.1| outer membrane antigenic lipoprotein B precursor [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307264642|ref|ZP_07546222.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
 gi|189916420|gb|ACE62672.1| Outer membrane antigenic lipoprotein B precursor [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306869954|gb|EFN01718.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
          Length = 412

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G     +
Sbjct: 333 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNS-NK 391

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 392 LHFEIRYKGKSVDPTRYLPRK 412


>gi|165977377|ref|YP_001652970.1| outer membrane antigenic lipoprotein B [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|165877478|gb|ABY70526.1| outer membrane antigenic lipoprotein B [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
          Length = 398

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G     +
Sbjct: 319 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNS-NK 377

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 378 LHFEIRYKGKSVDPTRYLPRK 398


>gi|53729042|ref|ZP_00134335.2| COG0739: Membrane proteins related to metalloendopeptidases
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126209390|ref|YP_001054615.1| Outer membrane antigenic lipoprotein B precursor [Actinobacillus
           pleuropneumoniae L20]
 gi|126098182|gb|ABN75010.1| Outer membrane antigenic lipoprotein B precursor [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
          Length = 412

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G     +
Sbjct: 333 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNS-NK 391

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 392 LHFEIRYKGKSVDPTRYLPRK 412


>gi|170723214|ref|YP_001750902.1| peptidase M23B [Pseudomonas putida W619]
 gi|169761217|gb|ACA74533.1| peptidase M23B [Pseudomonas putida W619]
          Length = 285

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 206 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 264

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 265 LHFEIRRQGKPVDPLQFLPRR 285


>gi|330936785|gb|EGH40945.1| peptidoglycan-binding LysM:peptidase M23B [Pseudomonas syringae pv.
           pisi str. 1704B]
          Length = 288

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|330504212|ref|YP_004381081.1| peptidase M23B [Pseudomonas mendocina NK-01]
 gi|328918498|gb|AEB59329.1| peptidase M23B [Pseudomonas mendocina NK-01]
          Length = 253

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G A   +
Sbjct: 174 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-ADRVK 232

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 233 LHFEIRRQGKPVDPLQYLPRR 253


>gi|68249280|ref|YP_248392.1| lipoprotein [Haemophilus influenzae 86-028NP]
 gi|68057479|gb|AAX87732.1| outer membrane antigenic lipoprotein B [Haemophilus influenzae
           86-028NP]
          Length = 405

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSGTNT-VK 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L ++
Sbjct: 385 LHFEIRYKGKSVDPVRYLPKR 405


>gi|322513813|ref|ZP_08066899.1| outer membrane antigenic lipoprotein B [Actinobacillus ureae ATCC
           25976]
 gi|322120381|gb|EFX92311.1| outer membrane antigenic lipoprotein B [Actinobacillus ureae ATCC
           25976]
          Length = 412

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H D  ++ Y+H D+  V +   V+ G TI   G +G     +
Sbjct: 333 VVYAGNALEGYGNLIIIKHSDDFLSAYAHNDSIKVDEQDTVNAGETIAKMGSTGTNS-NK 391

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L ++
Sbjct: 392 LHFEIRYKGKSVDPTRYLPKR 412


>gi|312959423|ref|ZP_07773940.1| lipoprotein NlpD [Pseudomonas fluorescens WH6]
 gi|311286140|gb|EFQ64704.1| lipoprotein NlpD [Pseudomonas fluorescens WH6]
          Length = 278

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 199 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKVGQTIAEMGSTG-TDRVK 257

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 258 LHFEIRRQGKPVDPLQFLPRR 278


>gi|27379854|ref|NP_771383.1| lipoprotein [Bradyrhizobium japonicum USDA 110]
 gi|27353007|dbj|BAC50008.1| bll4743 [Bradyrhizobium japonicum USDA 110]
          Length = 461

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 50/80 (62%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y GN+L   GN +L+RH +  VT Y+H     V++G  + RG  I  SG+SG    P
Sbjct: 380 VVAYSGNELKGYGNLVLVRHSNGYVTAYAHASELLVKRGDTIKRGQVIAKSGQSGEVASP 439

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK +  +DP++FL 
Sbjct: 440 QLHFEIRKGSSPVDPLQFLN 459


>gi|146297340|ref|YP_001181111.1| peptidase M23B [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145410916|gb|ABP67920.1| peptidase M23B [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 378

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G  +   G TI++ +   I T+Y+H+ +  V  GQKV +G  IG  G +G +  P 
Sbjct: 301 VILAGW-VSGYGKTIILDNGSGISTLYAHLSSINVSVGQKVKKGECIGNVGSTGYSTGPN 359

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N   +DP+ +L+
Sbjct: 360 LHFEVRINGDVVDPLNYLK 378


>gi|269101862|ref|ZP_06154559.1| hypothetical lipoprotein NlpD [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268161760|gb|EEZ40256.1| hypothetical lipoprotein NlpD [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 278

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+D  ++ Y+H D   V++ Q+V+ G  I L G +G A   +
Sbjct: 199 VVYAGNALRGYGNLVIIKHNDDYLSAYAHNDKLLVKEQQQVTAGQKIALMGDTG-ADSVK 257

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L  +
Sbjct: 258 LHFEIRYKGKSVDPLRYLPRQ 278


>gi|219668778|ref|YP_002459213.1| peptidase M23 [Desulfitobacterium hafniense DCB-2]
 gi|219539038|gb|ACL20777.1| Peptidase M23 [Desulfitobacterium hafniense DCB-2]
          Length = 482

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V  VG      GN ILI H + + T Y+H     V  GQ++S+G +IGL G +G +  P 
Sbjct: 405 VSSVGWS-GGYGNMILIDHGNGVATRYAHASKVSVSNGQQISKGESIGLVGSTGRSTGPH 463

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+  N   ++P+ +L 
Sbjct: 464 LHFEVIINGDTVNPLNYLP 482


>gi|89894351|ref|YP_517838.1| hypothetical protein DSY1605 [Desulfitobacterium hafniense Y51]
 gi|89333799|dbj|BAE83394.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 440

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V  VG      GN ILI H + + T Y+H     V  GQ++S+G +IGL G +G +  P 
Sbjct: 363 VSSVGWS-GGYGNMILIDHGNGVATRYAHASKVSVSNGQQISKGESIGLVGSTGRSTGPH 421

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+  N   ++P+ +L 
Sbjct: 422 LHFEVIINGDTVNPLNYLP 440


>gi|332142417|ref|YP_004428155.1| peptidase, M23/M37 family protein [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327552439|gb|AEA99157.1| peptidase, M23/M37 family protein [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 292

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G +    G  + I H D  VT Y H D+  V  G  V++G  I   G +G +   
Sbjct: 212 IVTWAG-ERYGYGQLVEIDHGDGFVTRYGHNDSLTVSIGDVVTKGEAIAKMGNTGRSTGV 270

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VH+E+ +N   +DP+ F+ +K
Sbjct: 271 HVHYEVIRNGKQVDPLPFVYKK 292


>gi|90424346|ref|YP_532716.1| peptidase M23B [Rhodopseudomonas palustris BisB18]
 gi|90106360|gb|ABD88397.1| peptidase M23B [Rhodopseudomonas palustris BisB18]
          Length = 455

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G      G  I + H + + T Y H+    V+ G  +  G  IG  G +G +  P 
Sbjct: 369 VTSSGWA-GGYGRMIEVDHGNGLATRYGHLSEINVKVGDAIKIGQVIGEVGSTGRSTGPH 427

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R +  A+DP KFL 
Sbjct: 428 LHYETRIDGEAVDPQKFLR 446


>gi|46198659|ref|YP_004326.1| cell wall endopeptidase [Thermus thermophilus HB27]
 gi|46196282|gb|AAS80699.1| cell wall endopeptidase, family M23/M37 [Thermus thermophilus HB27]
          Length = 388

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 41/79 (51%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G   V  G  +++ H   + T+Y+H+    V+ GQ V  G  IG  G +G +  P 
Sbjct: 310 VEVAGWSSVGYGFHVVLDHGGGLETLYAHMSRIAVRAGQWVEAGQVIGYVGSTGWSTGPH 369

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N +  +P+ +L 
Sbjct: 370 LHFEVRVNGLVKNPLSYLP 388


>gi|83721288|ref|YP_442746.1| lipoprotein NlpD [Burkholderia thailandensis E264]
 gi|83655113|gb|ABC39176.1| lipoprotein NlpD, putative [Burkholderia thailandensis E264]
          Length = 292

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 213 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 271

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 272 LHFEVRRQGKPVDPLKYLP 290


>gi|213963797|ref|ZP_03392046.1| peptidase, family M23 [Capnocytophaga sputigena Capno]
 gi|213953573|gb|EEB64906.1| peptidase, family M23 [Capnocytophaga sputigena Capno]
          Length = 324

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 43/78 (55%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+   ++    GN I I H    VT+Y H+    V+ GQ V RG  IG  G +G ++ P
Sbjct: 222 VVVRADSNASGYGNHIRIDHGYGYVTLYGHLSAYNVRAGQHVKRGDLIGKVGSTGRSEAP 281

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E+ KN   ++PI F
Sbjct: 282 HLHYEVIKNGEHINPIHF 299


>gi|56475839|ref|YP_157428.1| putative peptidase [Aromatoleum aromaticum EbN1]
 gi|56311882|emb|CAI06527.1| putative peptidase [Aromatoleum aromaticum EbN1]
          Length = 296

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+HD + +T Y+H     V++G+ V++G  I   G + +A  P+
Sbjct: 217 VVYSGSGLRGYGKLVIIKHDANYLTAYAHNQQLLVKEGESVTKGQRIAELGST-DADRPK 275

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK    +DP+K+L  +
Sbjct: 276 LHFEIRKQGRPVDPMKYLPAR 296


>gi|332654841|ref|ZP_08420583.1| peptidase, M23B family [Ruminococcaceae bacterium D16]
 gi|332516184|gb|EGJ45792.1| peptidase, M23B family [Ruminococcaceae bacterium D16]
          Length = 504

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G      GN ++I HD+   T Y+H  +  V  G KV +G  I  +G +G +    
Sbjct: 427 VTYAGYK-GSYGNLVIITHDNGTQTYYAHNSSLLVSVGDKVYKGQQIAKAGSTGRSTGVH 485

Query: 62  VHFELRKNAIAMDPIKFLE 80
            HFE+R N  A++P+ +L 
Sbjct: 486 CHFEVRVNGTAVNPLSYLP 504


>gi|254448973|ref|ZP_05062427.1| Fe-S type hydro-lyases tartrate/fumarate alpha region [gamma
           proteobacterium HTCC5015]
 gi|198261367|gb|EDY85658.1| Fe-S type hydro-lyases tartrate/fumarate alpha region [gamma
           proteobacterium HTCC5015]
          Length = 304

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 3   IYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQV 62
            + G+     GN + I H +  VT Y H  +  V +GQ V +G  I   G +G +  P V
Sbjct: 226 TWAGSR-YGYGNLVEISHGNGYVTRYGHNKSVLVTEGQAVKKGEVISKMGSTGRSTGPHV 284

Query: 63  HFELRKNAIAMDPIKFLEEK 82
           HFE+ +N   +DP+K++ ++
Sbjct: 285 HFEVIQNGRKIDPVKYISQR 304


>gi|197105300|ref|YP_002130677.1| peptidase, M23/M37 family [Phenylobacterium zucineum HLK1]
 gi|196478720|gb|ACG78248.1| peptidase, M23/M37 family [Phenylobacterium zucineum HLK1]
          Length = 384

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GNTI I H   + T Y+H+    V+ GQ+++ G  IG  G +G +   
Sbjct: 297 VVAFTG-VRSGYGNTIEIDHGRGLKTRYAHLSAIAVRPGQRIAIGQRIGAMGSTGRSTGT 355

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+  N  A +P +FL+
Sbjct: 356 HLHYEVWVNGRAQNPGRFLK 375


>gi|171058603|ref|YP_001790952.1| peptidase M23B [Leptothrix cholodnii SP-6]
 gi|170776048|gb|ACB34187.1| peptidase M23B [Leptothrix cholodnii SP-6]
          Length = 315

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+++ +T Y+H     V++ Q V RG  I   G + +A+  Q
Sbjct: 236 VVYAGSGLRGYGNLVIIKHNETYLTAYAHNQALLVREDQPVRRGQKIAEMGST-DAERVQ 294

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP + L  +
Sbjct: 295 LHFEIRRRGKPIDPARLLPAR 315


>gi|227824550|ref|ZP_03989382.1| peptidase M23B [Acidaminococcus sp. D21]
 gi|226905049|gb|EEH90967.1| peptidase M23B [Acidaminococcus sp. D21]
          Length = 377

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   GN ++I H   +VT+Y H  +  V  G+ VS+G TI L+G +GN+  P 
Sbjct: 300 VIYAGW-MGGYGNAVMIDHGGGLVTLYGHNSSLTVGVGENVSKGQTIALAGSTGNSTGPH 358

Query: 62  VHFELRKNAIAMDPIKFLE 80
            HFE+R +     P+ +L 
Sbjct: 359 CHFEVRIHGEVTSPLNYLP 377


>gi|226315499|ref|YP_002775395.1| hypothetical protein BBR47_59140 [Brevibacillus brevis NBRC 100599]
 gi|226098449|dbj|BAH46891.1| hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 498

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G +  + G +++I H + + T+Y H+    V+ G  VS+G  IG+ G +G +    
Sbjct: 421 VTFAGWN-GDYGKSVIIDHGNGMKTLYGHMSVINVKAGDVVSQGKKIGVKGSTGQSTGVH 479

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+ +N    +PI++L+
Sbjct: 480 LHFEVLQNGRNQNPIRYLK 498


>gi|85712120|ref|ZP_01043173.1| Lipoprotein NlpD [Idiomarina baltica OS145]
 gi|85694110|gb|EAQ32055.1| Lipoprotein NlpD [Idiomarina baltica OS145]
          Length = 297

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVG+ L   GN I+++H+D  +T Y+H +   V + Q V  G  I   G SG      
Sbjct: 219 VVYVGSGLRGYGNLIILKHNDDFITAYAHNEKILVTEQQWVDVGQPIAEMGDSG-TTRVM 277

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    +++P  +L 
Sbjct: 278 LHFEVRYRGKSVNPRHYLP 296


>gi|302383298|ref|YP_003819121.1| peptidase M23 [Brevundimonas subvibrioides ATCC 15264]
 gi|302193926|gb|ADL01498.1| Peptidase M23 [Brevundimonas subvibrioides ATCC 15264]
          Length = 381

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GNTI I H     T ++H+++  VQ GQ+++ G  IG  G +G +   
Sbjct: 296 IVSFAG-VRSGYGNTIEIDHGHGFKTRFAHLNSMAVQPGQRIALGQRIGAMGTTGRSTGV 354

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+  +    +P +F  
Sbjct: 355 HLHYEVWMDGRPQNPARFFR 374


>gi|253575402|ref|ZP_04852740.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251845399|gb|EES73409.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 397

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 3/82 (3%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSH--IDTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +VI         GNT+++ H D++ T+Y+H   +   V KG KV RG  I   G +G A 
Sbjct: 317 VVIVAEWW-SGYGNTVIVDHGDNVWTLYAHIRNNGIKVTKGDKVKRGQKIAEVGSTGTAT 375

Query: 59  HPQVHFELRKNAIAMDPIKFLE 80
              +HFE+R +   +DP+ +L+
Sbjct: 376 GNNLHFEVRIDGKPVDPLPYLK 397


>gi|154496169|ref|ZP_02034865.1| hypothetical protein BACCAP_00453 [Bacteroides capillosus ATCC
           29799]
 gi|150274724|gb|EDN01788.1| hypothetical protein BACCAP_00453 [Bacteroides capillosus ATCC
           29799]
          Length = 508

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 3/82 (3%)

Query: 2   VIYVGNDLVE---LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           VI+ G         G  ++I H +   T Y+H  +  V  G KV +G TI   G +G + 
Sbjct: 427 VIWAGTGTGSNWSYGKYVIIDHGNGYQTYYAHCSSLLVSVGDKVYQGQTIAKVGSTGRST 486

Query: 59  HPQVHFELRKNAIAMDPIKFLE 80
               HF+++ N   ++P+ +L 
Sbjct: 487 GNHCHFQVKINGTTVNPLSYLP 508


>gi|114707232|ref|ZP_01440130.1| lipoprotein [Fulvimarina pelagi HTCC2506]
 gi|114537428|gb|EAU40554.1| lipoprotein [Fulvimarina pelagi HTCC2506]
          Length = 435

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 57/80 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E GNT+L++HDD +VTVY + D+  V++G  V RG  I  SG SG+A  P
Sbjct: 356 VVIYAGDGLKEFGNTVLVKHDDGLVTVYGNADSLNVKRGDTVKRGQQIASSGMSGDATVP 415

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           Q+HFE+RK++  +DP  +L+
Sbjct: 416 QLHFEVRKDSAPIDPSGYLQ 435


>gi|91976919|ref|YP_569578.1| peptidase M23B [Rhodopseudomonas palustris BisB5]
 gi|91683375|gb|ABE39677.1| peptidase M23B [Rhodopseudomonas palustris BisB5]
          Length = 459

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  + I H + + T Y H+     + GQ +  G  IG  G +G +  P 
Sbjct: 373 VVNAGWQ-GGYGQMVEIDHGNGLSTRYGHLSKIIAKVGQSIQIGQVIGEVGSTGRSTGPH 431

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R    A+DP KFL 
Sbjct: 432 LHYETRIEGEAVDPQKFLR 450


>gi|332878869|ref|ZP_08446584.1| peptidase, M23 family [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332683220|gb|EGJ56102.1| peptidase, M23 family [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 324

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 42/78 (53%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI   +     GN I I H    VT+Y H+    V+ GQ V RG  IG  G +G ++ P
Sbjct: 222 VVIRADDGSSGYGNHIRIDHGYGYVTLYGHLSAYNVRAGQHVKRGDLIGKVGSTGRSEAP 281

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E+ KN   ++PI F
Sbjct: 282 HLHYEVIKNGEHINPIHF 299


>gi|83717650|ref|YP_439848.1| lipoprotein NlpD [Burkholderia thailandensis E264]
 gi|83651475|gb|ABC35539.1| lipoprotein NlpD, putative [Burkholderia thailandensis E264]
          Length = 186

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G+ L   GN ++I+HDD+ ++ Y+H     V++G  V++G  I   G S +A   
Sbjct: 106 VVAYAGDSLRGYGNFVIIKHDDTYLSAYAHNRKLLVKEGDPVAKGQVIAEMGDS-DADRV 164

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R+  +A+DP+K+L  +
Sbjct: 165 MLHFEIRRKGVAVDPLKYLPAR 186


>gi|226945911|ref|YP_002800984.1| lipoprotein NlpD [Azotobacter vinelandii DJ]
 gi|226720838|gb|ACO80009.1| lipoprotein NlpD [Azotobacter vinelandii DJ]
          Length = 284

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   G  I+I+H D  V+ Y H     V++GQ+V  G  I   G +G     +
Sbjct: 205 VVYAGGGLRGYGELIIIKHSDVYVSAYGHNRRLLVREGQQVKAGQVIAEMGSTG-TDRVK 263

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 264 LHFEIRRQGKPVDPLQYLPSR 284


>gi|119774180|ref|YP_926920.1| lipoprotein NlpD [Shewanella amazonensis SB2B]
 gi|119766680|gb|ABL99250.1| lipoprotein NlpD [Shewanella amazonensis SB2B]
          Length = 296

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 54/81 (66%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H +  ++ Y+H+D   V + Q+VS G T+   G + +A+H  
Sbjct: 217 VVYSGNALRGYGNLVIIKHSEDFLSAYAHLDKILVTEKQRVSAGQTVATMGNT-DAEHVM 275

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R + ++++P+K+L +K
Sbjct: 276 LHFEIRDHGVSVNPLKYLPKK 296


>gi|317969844|ref|ZP_07971234.1| zinc metallopeptidase [Synechococcus sp. CB0205]
          Length = 349

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  + +RH D  +T Y H     V+ GQ V +G  I L G +G +  P 
Sbjct: 267 VVSAGWHGGGYGYLVELRHADGTLTRYGHNSRILVRAGQFVPQGKVISLMGSTGRSTGPH 326

Query: 62  VHFELRKNAI-AMDPIKFLEEK 82
           +HFE+      A++P++ L  +
Sbjct: 327 LHFEIIPAGRGAVNPLQMLPPR 348


>gi|209885119|ref|YP_002288976.1| peptidase M23/M37 [Oligotropha carboxidovorans OM5]
 gi|209873315|gb|ACI93111.1| peptidase M23/M37 [Oligotropha carboxidovorans OM5]
          Length = 428

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI         G  + I H + + T Y H+    V+ G+ V  G  +G  G +G +  P 
Sbjct: 343 VINASWS-GGYGRMVEIDHGNGLSTRYGHLSAIKVKVGETVRIGDVVGEVGSTGRSTGPH 401

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R +  A+DP +FL 
Sbjct: 402 LHYETRIDGEAVDPQRFLR 420


>gi|163749991|ref|ZP_02157235.1| lipoprotein NlpD [Shewanella benthica KT99]
 gi|161330265|gb|EDQ01246.1| lipoprotein NlpD [Shewanella benthica KT99]
          Length = 274

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q VS G T+   G +G      
Sbjct: 184 VVYAGSALRGYGNLVIIKHSDDFLSAYAHADKILVKEKQFVSMGQTLATMGNTG-TDRVM 242

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R +  +++P+K+L +
Sbjct: 243 LHFEIRYHGKSVNPLKYLPK 262


>gi|304410160|ref|ZP_07391779.1| Peptidase M23 [Shewanella baltica OS183]
 gi|307302129|ref|ZP_07581887.1| Peptidase M23 [Shewanella baltica BA175]
 gi|304351569|gb|EFM15968.1| Peptidase M23 [Shewanella baltica OS183]
 gi|306914167|gb|EFN44588.1| Peptidase M23 [Shewanella baltica BA175]
          Length = 298

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q V  G T+   G +G A    
Sbjct: 219 VVYAGSALRGYGNLVIIKHSDDYLSAYAHTDKILVKEKQHVLAGQTVAKMGSTG-ANRVM 277

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+ +L ++
Sbjct: 278 LHFEIRYHGQSVNPLTYLPKQ 298


>gi|167893936|ref|ZP_02481338.1| lipoprotein NlpD, putative [Burkholderia pseudomallei 7894]
          Length = 134

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 55  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 113

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 114 LHFEVRRQGKPVDPLKYLP 132


>gi|225850015|ref|YP_002730249.1| NlpD fragment [Persephonella marina EX-H1]
 gi|225646338|gb|ACO04524.1| NlpD fragment [Persephonella marina EX-H1]
          Length = 261

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  ++I+H     T Y H+    V+KGQ+V  G  IG +G +G +   
Sbjct: 176 IVKFAGWS-GGYGKLVIIKHKYGYETYYGHLFKIRVKKGQRVKAGTVIGYAGSTGRSTGV 234

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R+    ++P+K+L
Sbjct: 235 HLHYEIRRYGRLLNPLKYL 253


>gi|170727681|ref|YP_001761707.1| peptidase M23B [Shewanella woodyi ATCC 51908]
 gi|169813028|gb|ACA87612.1| peptidase M23B [Shewanella woodyi ATCC 51908]
          Length = 298

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++++H D  ++ Y+H D+  V++ Q V+ G T+   G +G      
Sbjct: 219 VVYAGSALRGYGNLVIVKHSDDYLSAYAHADSILVKEKQFVTIGQTLAKMGNTG-TDRVM 277

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+K+L ++
Sbjct: 278 LHFEIRHHGKSVNPLKYLPKQ 298


>gi|307294593|ref|ZP_07574435.1| Peptidase M23 [Sphingobium chlorophenolicum L-1]
 gi|306879067|gb|EFN10285.1| Peptidase M23 [Sphingobium chlorophenolicum L-1]
          Length = 240

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      GN + I H   + T Y H+    V     V RG  IGL G +G +   
Sbjct: 134 IVSRAGWA-SGYGNLVQIAHGGGMETRYGHMSKLLVAPNSYVHRGQLIGLMGSTGRSTGS 192

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R +  A++PI F+
Sbjct: 193 HLHYEVRVDGQAINPIPFV 211


>gi|15889135|ref|NP_354816.1| membrane protein associated metalloendopeptidase [Agrobacterium
           tumefaciens str. C58]
 gi|15156945|gb|AAK87601.1| membrane protein associated metalloendopeptidase [Agrobacterium
           tumefaciens str. C58]
          Length = 432

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 42/77 (54%)

Query: 3   IYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQV 62
           + V  +    GN + I H   + T + H+    V+ G +V  G  IG +G +G +  P V
Sbjct: 345 VTVAENSGGYGNMVEIDHGQGVSTRFGHLSAILVRAGDRVEAGDVIGRAGSTGRSTGPHV 404

Query: 63  HFELRKNAIAMDPIKFL 79
           H+E+R+N   +DP+++L
Sbjct: 405 HYEVRRNDTPVDPMRYL 421


>gi|310658192|ref|YP_003935913.1| peptidase m23b [Clostridium sticklandii DSM 519]
 gi|308824970|emb|CBH21008.1| putative Peptidase M23B [Clostridium sticklandii]
          Length = 303

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++   +    G  IL+ H +   TVY+H+    V+ G +V +G  IG  G +G +  P
Sbjct: 224 IVLFSEIN-GTYGKMILVSHGNGYSTVYAHLSKQLVKAGDQVKKGDLIGKMGSTGRSTGP 282

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R+N   +DP K L
Sbjct: 283 HLHFEIRENGTPIDPQKIL 301


>gi|303251708|ref|ZP_07337879.1| outer membrane antigenic lipoprotein B [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302649138|gb|EFL79323.1| outer membrane antigenic lipoprotein B [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
          Length = 373

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G     +
Sbjct: 294 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNS-NK 352

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 353 LHFEIRYKGKSVDPTRYLPRK 373


>gi|83644703|ref|YP_433138.1| metalloendopeptidase-like membrane protein [Hahella chejuensis KCTC
           2396]
 gi|83632746|gb|ABC28713.1| Membrane protein related to metalloendopeptidase [Hahella
           chejuensis KCTC 2396]
          Length = 287

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L+  G  +++ H D  ++ Y+H     V++G  + RG  I   G++G    P 
Sbjct: 208 VVYAGNGLLGYGKLVILSHGDEYISAYAHNSKILVKEGDLIKRGQKIAEIGETG-TNRPM 266

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN   +DP+K+L ++
Sbjct: 267 LHFEIRKNGNPVDPLKYLPKR 287


>gi|166712466|ref|ZP_02243673.1| lipoprotein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 252

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 172 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 230

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 231 MLHFEIRYNGKPVDPLLYLPKK 252


>gi|119944448|ref|YP_942128.1| peptidase M23B [Psychromonas ingrahamii 37]
 gi|119863052|gb|ABM02529.1| peptidase M23B [Psychromonas ingrahamii 37]
          Length = 285

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN I+I+H+D  ++ Y+H +   + + Q+V  G  I   G SG     +
Sbjct: 206 VVYAGAGLRGFGNLIIIKHNDDYLSAYAHNEQLLISEKQQVKAGQKIATMGDSG-TDSVK 264

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L ++
Sbjct: 265 LHFEIRYQGKSIDPMRYLPKR 285


>gi|16126115|ref|NP_420679.1| M24/M37 family peptidase [Caulobacter crescentus CB15]
 gi|221234885|ref|YP_002517321.1| M23 family peptidoglycan-specific endopeptidase [Caulobacter
           crescentus NA1000]
 gi|13423317|gb|AAK23847.1| peptidase, M23/M37 family [Caulobacter crescentus CB15]
 gi|220964057|gb|ACL95413.1| peptidoglycan-specific endopeptidase, M23 family [Caulobacter
           crescentus NA1000]
          Length = 383

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           ++ + G      G T+ I H     T Y+H+    V+ GQ+V+ G  +G  G +G +  P
Sbjct: 296 VISFTG-VRSGYGKTVEIDHGGGFKTRYAHLAAISVRVGQRVAIGSRVGGMGSTGRSTGP 354

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+  N  A +P +FL+
Sbjct: 355 HLHYEVWVNGKAQNPNRFLK 374


>gi|312793086|ref|YP_004026009.1| peptidase M23 [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312180226|gb|ADQ40396.1| Peptidase M23 [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 379

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G  +   G T++I +   I T+Y+H+ +  V  GQKV +G +IG  G +G A  P 
Sbjct: 302 VILAGW-VSGYGKTVIIDNGSGISTLYAHLSSINVSVGQKVKKGESIGNVGATGYATGPH 360

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N    DP+ FL 
Sbjct: 361 LHFEVRINGDVTDPLNFLR 379


>gi|304316222|ref|YP_003851367.1| peptidase M23 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302777724|gb|ADL68283.1| Peptidase M23 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 381

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G  +   GN+++I H   I T+Y+H  +  V KG+ V +G  +   G +G      
Sbjct: 304 VIYTGW-ISGYGNSVIIDHGGGISTLYAHNSSILVSKGKSVKKGEPVVKLGSTGLVTGVN 362

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N   +DP  ++ 
Sbjct: 363 LHFEVRINGTPVDPEPYVR 381


>gi|229588833|ref|YP_002870952.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
 gi|229360699|emb|CAY47557.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
          Length = 278

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 199 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKVGQTIAEMGSTG-TDRVK 257

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 258 LHFEIRRQGKPVDPLQFLPRR 278


>gi|257143000|ref|ZP_05591262.1| lipoprotein NlpD, putative [Burkholderia thailandensis E264]
          Length = 190

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G+ L   GN ++I+HDD+ ++ Y+H     V++G  V++G  I   G S +A   
Sbjct: 110 VVAYAGDSLRGYGNFVIIKHDDTYLSAYAHNRKLLVKEGDPVAKGQVIAEMGDS-DADRV 168

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R+  +A+DP+K+L  +
Sbjct: 169 MLHFEIRRKGVAVDPLKYLPAR 190


>gi|66044621|ref|YP_234462.1| peptidoglycan-binding LysM:peptidase M23B [Pseudomonas syringae pv.
           syringae B728a]
 gi|63255328|gb|AAY36424.1| Peptidoglycan-binding LysM:Peptidase M23B [Pseudomonas syringae pv.
           syringae B728a]
 gi|330968928|gb|EGH68994.1| peptidoglycan-binding LysM:peptidase M23B [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 288

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|114332282|ref|YP_748504.1| peptidase M23B [Nitrosomonas eutropha C91]
 gi|114309296|gb|ABI60539.1| peptidase M23B [Nitrosomonas eutropha C91]
          Length = 328

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+DS ++ Y H    +V +G+ VS+G  I   G +      +
Sbjct: 249 VVYSGNGLRGYGNLIIIKHNDSYLSAYGHNSKIFVHEGENVSKGQKIAEMGNTDG-GVVK 307

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ +L  +
Sbjct: 308 LHFEIREKGKPVDPLGYLPVR 328


>gi|294677087|ref|YP_003577702.1| M23 family peptidase [Rhodobacter capsulatus SB 1003]
 gi|294475907|gb|ADE85295.1| peptidase, M23B subfamily [Rhodobacter capsulatus SB 1003]
          Length = 436

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    G  I +RH   + TVY H+    V+ GQKVSRG  IG +G +G +  P
Sbjct: 352 VVTDAGWEN-GYGQVIKLRHKFGVSTVYGHLSKIRVKVGQKVSRGEIIGDTGNTGRSTGP 410

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R     ++P+ F++
Sbjct: 411 HLHYEIRVGGAPINPMTFIK 430


>gi|188583936|ref|YP_001927381.1| peptidase M23 [Methylobacterium populi BJ001]
 gi|179347434|gb|ACB82846.1| Peptidase M23 [Methylobacterium populi BJ001]
          Length = 446

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 49/78 (62%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH++  V+ Y+H     V+ G+KV RG TI  SG +GN   PQ
Sbjct: 367 VAYAGSDVKGYGKLVLVRHNNGYVSAYAHNGELDVRPGEKVKRGQTIAKSGATGNVTSPQ 426

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RK A  +DP+  L
Sbjct: 427 LHFEIRKGATPVDPMPHL 444


>gi|182679614|ref|YP_001833760.1| peptidase M23 [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635497|gb|ACB96271.1| Peptidase M23 [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 500

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 52/79 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G++L   GN +LIRH +  V+ Y++     V++G+ V RG TI  SG+SGN   P
Sbjct: 419 VVAYAGSELKGYGNLVLIRHPNGFVSAYANNGDLEVKRGETVKRGQTIAKSGQSGNVNSP 478

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFELRK A  +DP ++L
Sbjct: 479 QLHFELRKGATPVDPTQYL 497


>gi|160876378|ref|YP_001555694.1| peptidase M23B [Shewanella baltica OS195]
 gi|160861900|gb|ABX50434.1| peptidase M23B [Shewanella baltica OS195]
 gi|315268568|gb|ADT95421.1| Peptidase M23 [Shewanella baltica OS678]
          Length = 298

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q V  G T+   G +G A    
Sbjct: 219 VVYAGSALRGYGNLVIIKHSDDYLSAYAHTDKILVKEKQHVLAGQTVAKMGSTG-ANRVM 277

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+ +L ++
Sbjct: 278 LHFEIRYHGQSVNPLTYLPKQ 298


>gi|294141939|ref|YP_003557917.1| lipoprotein NlpD [Shewanella violacea DSS12]
 gi|293328408|dbj|BAJ03139.1| lipoprotein NlpD [Shewanella violacea DSS12]
          Length = 327

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D+ ++ Y+H D   V++ Q VS G T+   G +G      
Sbjct: 248 VVYAGSALRGYGNLVIIKHSDNFLSAYAHADKILVKEKQFVSVGQTLATMGNTG-TDRVM 306

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  ++DP+K+L ++
Sbjct: 307 LHFEIRYHGKSVDPLKYLPKQ 327


>gi|218245506|ref|YP_002370877.1| peptidase M23 [Cyanothece sp. PCC 8801]
 gi|218165984|gb|ACK64721.1| Peptidase M23 [Cyanothece sp. PCC 8801]
          Length = 198

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G      G  I +RH D  +T Y H +   V++GQ+V +G  I   G +GN+  P
Sbjct: 96  VVIYAGWSPEGYGQLIKLRHPDGSLTFYGHNNRLLVRRGQQVEQGQQISEMGSTGNSTGP 155

Query: 61  QVHFELRKNA-IAMDPIKFLEE 81
            +HFE+      A++PI FL E
Sbjct: 156 HLHFEIHPQGIQAVNPIAFLPE 177


>gi|206560256|ref|YP_002231020.1| family M23 peptidase [Burkholderia cenocepacia J2315]
 gi|198036297|emb|CAR52193.1| family M23 peptidase [Burkholderia cenocepacia J2315]
          Length = 299

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 220 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 278

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 279 LHFEVRRQGKPVDPLKYLP 297


>gi|171321355|ref|ZP_02910312.1| protein-L-isoaspartate O-methyltransferase [Burkholderia ambifaria
           MEX-5]
 gi|171093373|gb|EDT38563.1| protein-L-isoaspartate O-methyltransferase [Burkholderia ambifaria
           MEX-5]
          Length = 527

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 448 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 506

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 507 LHFEVRRQGKPVDPLKYLP 525


>gi|170733181|ref|YP_001765128.1| peptidase M23B [Burkholderia cenocepacia MC0-3]
 gi|169816423|gb|ACA91006.1| peptidase M23B [Burkholderia cenocepacia MC0-3]
          Length = 296

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 217 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 275

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 276 LHFEVRRQGKPVDPLKYLP 294


>gi|172060781|ref|YP_001808433.1| peptidase M23 [Burkholderia ambifaria MC40-6]
 gi|171993298|gb|ACB64217.1| Peptidase M23 [Burkholderia ambifaria MC40-6]
          Length = 295

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 216 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 274

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 275 LHFEVRRQGKPVDPLKYLP 293


>gi|107029000|ref|YP_626095.1| peptidase M23B [Burkholderia cenocepacia AU 1054]
 gi|116689842|ref|YP_835465.1| peptidase M23B [Burkholderia cenocepacia HI2424]
 gi|254248063|ref|ZP_04941384.1| Peptidoglycan-binding LysM [Burkholderia cenocepacia PC184]
 gi|105898164|gb|ABF81122.1| peptidase M23B [Burkholderia cenocepacia AU 1054]
 gi|116647931|gb|ABK08572.1| peptidase M23B [Burkholderia cenocepacia HI2424]
 gi|124872839|gb|EAY64555.1| Peptidoglycan-binding LysM [Burkholderia cenocepacia PC184]
          Length = 296

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 217 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 275

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 276 LHFEVRRQGKPVDPLKYLP 294


>gi|6175877|gb|AAF05318.1|AF178851_1 lipoprotein [Pseudomonas putida]
          Length = 97

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2  VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
          V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 18 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 76

Query: 62 VHFELRKNAIAMDPIKFLEEK 82
          +HFE+R+    +DP++FL  +
Sbjct: 77 LHFEIRRQGKPVDPLQFLPRR 97


>gi|115351810|ref|YP_773649.1| peptidase M23B [Burkholderia ambifaria AMMD]
 gi|115281798|gb|ABI87315.1| peptidase M23B [Burkholderia ambifaria AMMD]
          Length = 295

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 216 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 274

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 275 LHFEVRRQGKPVDPLKYLP 293


>gi|134295852|ref|YP_001119587.1| peptidase M23B [Burkholderia vietnamiensis G4]
 gi|134139009|gb|ABO54752.1| peptidase M23B [Burkholderia vietnamiensis G4]
          Length = 293

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 214 VVYSGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 272

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 273 LHFEVRRQGKPVDPLKYLP 291


>gi|257058542|ref|YP_003136430.1| peptidase M23 [Cyanothece sp. PCC 8802]
 gi|256588708|gb|ACU99594.1| Peptidase M23 [Cyanothece sp. PCC 8802]
          Length = 198

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G      G  I +RH D  +T Y H     V++GQ+V +G  I   G +GN+  P
Sbjct: 96  VVIYAGWSPEGYGQLIKLRHPDGSLTFYGHNSRLLVRRGQQVEQGQQISEMGSTGNSTGP 155

Query: 61  QVHFELRKNA-IAMDPIKFLEE 81
            +HFE+      A++PI FL E
Sbjct: 156 HLHFEIHPQGIQAVNPIAFLPE 177


>gi|190572809|ref|YP_001970654.1| putative exported peptidase [Stenotrophomonas maltophilia K279a]
 gi|190010731|emb|CAQ44340.1| putative exported peptidase [Stenotrophomonas maltophilia K279a]
          Length = 318

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + + H +  VT Y+H     V+ G  V  G  +  +G +G +   
Sbjct: 227 VVSFAG-VKGGYGNVVDVDHGNGYVTRYAHNSRLVVKAGDLVRAGQEVAKAGSTGRSTGA 285

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+ +N   ++P KFL
Sbjct: 286 HVHFEVWENGNVVNPRKFL 304


>gi|221066025|ref|ZP_03542130.1| Peptidase M23 [Comamonas testosteroni KF-1]
 gi|220711048|gb|EED66416.1| Peptidase M23 [Comamonas testosteroni KF-1]
          Length = 288

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN I+++H+++ +T Y+H  +  V++ Q V +G  I   G + +A   +
Sbjct: 209 VVYAGAGLRGYGNLIILKHNNTYLTAYAHNQSLLVKEDQAVKKGQKIAEMGST-DADRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 268 LHFEVRRQGKPVDPSRYLPSR 288


>gi|328950744|ref|YP_004368079.1| Peptidase M23 [Marinithermus hydrothermalis DSM 14884]
 gi|328451068|gb|AEB11969.1| Peptidase M23 [Marinithermus hydrothermalis DSM 14884]
          Length = 387

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 39/79 (49%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G   V  G  + I H   + T+Y H+    V+ GQ+V +G  IG  G +G +  P 
Sbjct: 309 VRVAGWSRVGYGLHVRIDHGGGVETLYGHMSRIVVKPGQQVQQGQLIGYVGSTGWSTGPH 368

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H E+R N    +P+ +L 
Sbjct: 369 LHLEIRINGRTKNPMAYLP 387


>gi|1352504|sp|P47764|NLPD_YEREN RecName: Full=Lipoprotein nlpD
 gi|687582|gb|AAC43390.1| NlpD [Yersinia enterocolitica]
          Length = 97

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2  VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
          V+Y GN L   GN I+I+H+D  ++ Y H DT  V++ ++V  G  I   G +G +   +
Sbjct: 18 VVYAGNALGGYGNLIIIKHNDDYLSAYVHNDTMLVREQEEVKAGQKIATMGSTGTSS-VR 76

Query: 62 VHFELRKNAIAMDPIKFLEEK 82
          +HFE+R    +++P+++L ++
Sbjct: 77 LHFEIRYKGKSVNPLRYLPQR 97


>gi|118590062|ref|ZP_01547466.1| hypothetical protein SIAM614_15395 [Stappia aggregata IAM 12614]
 gi|118437559|gb|EAV44196.1| hypothetical protein SIAM614_15395 [Stappia aggregata IAM 12614]
          Length = 450

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      G  + IRH +  +T Y+H+    V +G  V  G  +G  G +G +  P 
Sbjct: 363 VISAGRH-GGYGKMVEIRHANGFITRYAHMSRIQVSEGDHVLAGDLVGNVGSTGRSTGPH 421

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R+N    +P  FL
Sbjct: 422 LHYEIRRNDKPSNPAAFL 439


>gi|21242477|ref|NP_642059.1| lipoprotein [Xanthomonas axonopodis pv. citri str. 306]
 gi|21107924|gb|AAM36595.1| lipoprotein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 259

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 179 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 237

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 238 MLHFEIRYNGKPVDPLLYLPKK 259


>gi|254520733|ref|ZP_05132789.1| peptidase [Clostridium sp. 7_2_43FAA]
 gi|226914482|gb|EEH99683.1| peptidase [Clostridium sp. 7_2_43FAA]
          Length = 346

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 47/78 (60%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY   +    GN I+++H+D++VT Y H+   YV+ G KV +G  IG  G +G +  P 
Sbjct: 267 VIYAQYNDGGYGNLIIVKHEDNMVTYYGHLSDFYVKVGDKVKKGDIIGAIGSTGFSTGPH 326

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELR +   +DP  ++
Sbjct: 327 LHFELRVDNEPVDPTNYI 344


>gi|167836383|ref|ZP_02463266.1| lipoprotein NlpD, putative [Burkholderia thailandensis MSMB43]
          Length = 163

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 84  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 142

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 143 LHFEVRRQGKPVDPLKYLP 161


>gi|103488215|ref|YP_617776.1| peptidase M23B [Sphingopyxis alaskensis RB2256]
 gi|98978292|gb|ABF54443.1| peptidase M23B [Sphingopyxis alaskensis RB2256]
          Length = 524

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    GN + + H + + T Y H+    V+ GQ+VSRG  IG  G +G +  P
Sbjct: 388 VVALAGRN-GGYGNYVRLNHGNGLGTGYGHMSRIAVRPGQRVSRGQVIGYIGSTGLSTGP 446

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+EL +N  A++P   
Sbjct: 447 HLHYELYRNGRAVNPSSV 464


>gi|303250315|ref|ZP_07336514.1| outer membrane antigenic lipoprotein B [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302650785|gb|EFL80942.1| outer membrane antigenic lipoprotein B [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 373

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G     +
Sbjct: 294 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNS-NK 352

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 353 LHFEIRYKGKSVDPTRYLPRK 373


>gi|284009101|emb|CBA76091.1| lipoprotein [Arsenophonus nasoniae]
          Length = 347

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V+  Q+V  G  I   G SG +   +
Sbjct: 268 VVYSGNALRGYGNLIIIKHNDDYLSAYAHNDTILVRDQQEVQAGQKIATMGSSGTSS-VR 326

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 327 LHFEIRYKGKSVNPLRYLSQR 347


>gi|171463397|ref|YP_001797510.1| Peptidase M23 [Polynucleobacter necessarius subsp. necessarius
           STIR1]
 gi|171192935|gb|ACB43896.1| Peptidase M23 [Polynucleobacter necessarius subsp. necessarius
           STIR1]
          Length = 252

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++HD++ +T Y+H     V++G  V +G  I   G + +A   +
Sbjct: 176 VVYAGNSLRGYGNLVIVKHDNTYLTAYAHNSKLLVKEGDAVRKGQKIAEMGDT-DANAAK 234

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELR N   ++P  +L
Sbjct: 235 LHFELRVNGKPVNPTPYL 252


>gi|83593203|ref|YP_426955.1| peptidase M23B [Rhodospirillum rubrum ATCC 11170]
 gi|83576117|gb|ABC22668.1| Peptidase M23B [Rhodospirillum rubrum ATCC 11170]
          Length = 460

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G      G  + I H   + T Y+H+ T  VQ GQ V RG  IG  G SG +  P 
Sbjct: 375 VVYAGWRGR-YGRVVEIDHGMGLSTRYAHLRTIKVQLGQSVGRGDVIGALGNSGRSTGPH 433

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R N    +P  FL+
Sbjct: 434 LHYEVRVNGNPRNPTVFLK 452


>gi|42522012|ref|NP_967392.1| cell wall-binding protein associated metalloendopeptidase
           [Bdellovibrio bacteriovorus HD100]
 gi|39574543|emb|CAE78385.1| cell wall-binding protein associated metalloendopeptidase
           [Bdellovibrio bacteriovorus HD100]
          Length = 334

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++   D    G  I I +   + T + H+   YVQ GQ+V++   +G  G +G +  P
Sbjct: 254 VVVFASYDES-YGKLITIDYGYGVTTRFGHLSQIYVQVGQRVNKWDVVGAVGNTGRSTGP 312

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R N  A+DPI ++
Sbjct: 313 HLHYEVRINGTAVDPINYI 331


>gi|91788919|ref|YP_549871.1| peptidase M23B [Polaromonas sp. JS666]
 gi|91698144|gb|ABE44973.1| peptidase M23B [Polaromonas sp. JS666]
          Length = 318

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN ++++H+++ +T Y+H  T  V++ Q V +G  I   G + +A   +
Sbjct: 239 VVYAGAGLRGYGNLVILKHNNTFLTAYAHNQTLLVKEDQTVKKGQKIAEMGNT-DADRVK 297

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP K+L  K
Sbjct: 298 LHFEIRRQGKPVDPAKYLPPK 318


>gi|167569998|ref|ZP_02362872.1| Peptidase family M23/M37 [Burkholderia oklahomensis C6786]
          Length = 457

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V + G D    G  ++I H D   T Y+H+      ++ G  V++G  IG  G +G A 
Sbjct: 312 VVSFAGYDPGGYGKYVVIDHPDRTSTYYAHLSAFAPGLEAGMTVAQGQRIGAVGSTGAAT 371

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   ++P+
Sbjct: 372 GPHLHFEVRVDDQPVNPL 389


>gi|312879684|ref|ZP_07739484.1| Peptidase M23 [Aminomonas paucivorans DSM 12260]
 gi|310782975|gb|EFQ23373.1| Peptidase M23 [Aminomonas paucivorans DSM 12260]
          Length = 438

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  +   G T+++ H D   ++Y+H     V+ G++V +G  I   G +G +    
Sbjct: 361 VVYCGW-MSGYGKTVVLEHRDGSASLYAHCSRLDVRVGERVRQGEAIARVGNTGRSTGSH 419

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R     ++P+K L 
Sbjct: 420 LHFEIRIGGSPVNPLKLLR 438


>gi|167562817|ref|ZP_02355733.1| Peptidase family M23/M37 [Burkholderia oklahomensis EO147]
          Length = 457

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V + G D    G  ++I H D   T Y+H+      ++ G  V++G  IG  G +G A 
Sbjct: 312 VVSFAGYDPGGYGKYVVIDHPDRTSTYYAHLSAFAPGLEAGMTVAQGQRIGAVGSTGAAT 371

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 372 GPHLHFEVRVDDQPVDPL 389


>gi|124023170|ref|YP_001017477.1| M23/M37 familypeptidase [Prochlorococcus marinus str. MIT 9303]
 gi|123963456|gb|ABM78212.1| Peptidase family M23/M37 [Prochlorococcus marinus str. MIT 9303]
          Length = 333

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      G  + I H     T Y+H +   V+ GQ + +G TI   G +G +  P
Sbjct: 250 IVTYAGWR-GAYGYLVEIAHGGGSTTRYAHNNQILVRSGQFIPQGATISKMGSTGRSTGP 308

Query: 61  QVHFELR-KNAIAMDPIKFLEE 81
            +HFE+R K  +AM+P+  L  
Sbjct: 309 HLHFEIRKKGGLAMNPVTLLPS 330


>gi|82701631|ref|YP_411197.1| peptidase M23B [Nitrosospira multiformis ATCC 25196]
 gi|82409696|gb|ABB73805.1| peptidase M23B [Nitrosospira multiformis ATCC 25196]
          Length = 360

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   G  I+I+H D+ ++ Y+H     V++G+ V +G  I   G + +A   +
Sbjct: 279 VVYSGEGLRGYGKLIIIKHSDTYLSAYAHNSKLLVKEGETVIKGQKIAEMGST-DAGLVK 337

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+RKN   +DP+K+L 
Sbjct: 338 LHFEIRKNGKPVDPLKYLP 356


>gi|240948397|ref|ZP_04752775.1| Outer membrane antigenic lipoprotein B precursor [Actinobacillus
           minor NM305]
 gi|240297223|gb|EER47781.1| Outer membrane antigenic lipoprotein B precursor [Actinobacillus
           minor NM305]
          Length = 409

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V  G  I   G +G     +
Sbjct: 330 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDSVRAGEKIATMGSTG-TTSNK 388

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L ++
Sbjct: 389 LHFEIRYKGKSVDPTRYLPKQ 409


>gi|254179541|ref|ZP_04886140.1| peptidase, M23 family [Burkholderia pseudomallei 1655]
 gi|184210081|gb|EDU07124.1| peptidase, M23 family [Burkholderia pseudomallei 1655]
          Length = 296

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 217 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 275

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 276 LHFEVRRQGKPVDPLKYLP 294


>gi|319786260|ref|YP_004145735.1| peptidase M23 [Pseudoxanthomonas suwonensis 11-1]
 gi|317464772|gb|ADV26504.1| Peptidase M23 [Pseudoxanthomonas suwonensis 11-1]
          Length = 313

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V +  ++    G TI I H +  VT Y+H     V+ G  V  G  +  +G +G +   
Sbjct: 223 VVSFA-DNRSGYGKTIEIDHGNGYVTRYAHNSRLVVKSGDLVRAGQEVAKAGSTGRSTGA 281

Query: 61  QVHFELRKNAIAMDPIKFL-EEKIP 84
            VHFE+ +N   ++P KFL + + P
Sbjct: 282 HVHFEVWENGAVVNPRKFLGDNRAP 306


>gi|186686114|ref|YP_001869310.1| peptidase M23B [Nostoc punctiforme PCC 73102]
 gi|186468566|gb|ACC84367.1| peptidase M23B [Nostoc punctiforme PCC 73102]
          Length = 779

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 5   VGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHF 64
            G +    GN + IRH D   T Y+H     VQ GQ+V +G TI L G +G++  P  HF
Sbjct: 700 AGWNNGGYGNLVEIRHPDGSTTRYAHNSKILVQPGQQVHQGETIALMGSTGHSTGPHTHF 759

Query: 65  ELRKNAI-AMDPIKFLEEKI 83
           E+  +   A++PI  L ++I
Sbjct: 760 EIHPSGKGAVNPIAMLPDRI 779


>gi|167623163|ref|YP_001673457.1| peptidase M23B [Shewanella halifaxensis HAW-EB4]
 gi|167353185|gb|ABZ75798.1| peptidase M23B [Shewanella halifaxensis HAW-EB4]
          Length = 297

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q V+ G T+   G +G      
Sbjct: 218 VVYAGSALRGYGNLVIIKHSDDYLSAYAHADKILVKEKQAVNVGQTVATMGSTG-TNRVM 276

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+KFL ++
Sbjct: 277 LHFEIRYHGKSVNPVKFLPKQ 297


>gi|312621992|ref|YP_004023605.1| peptidase M23 [Caldicellulosiruptor kronotskyensis 2002]
 gi|312202459|gb|ADQ45786.1| Peptidase M23 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 379

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G  +   G TI+I +   I T+Y+H+ T  V  GQKV +G TIG  G +G A  P 
Sbjct: 302 VILAGW-VSGYGKTIIIDNGSGISTLYAHLSTIKVSIGQKVKKGETIGYVGATGYATGPH 360

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N    DP+ FL 
Sbjct: 361 LHFEVRINGDVTDPLNFLR 379


>gi|91792561|ref|YP_562212.1| peptidase M23B [Shewanella denitrificans OS217]
 gi|91714563|gb|ABE54489.1| peptidase M23B [Shewanella denitrificans OS217]
          Length = 311

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+D  ++ Y+H +T  V++ Q V+ G  +   G SG A    
Sbjct: 232 VVYAGDALRGYGNLVIIKHNDDFLSAYAHAETILVKEKQLVAAGQAVAKMGNSG-ANQVM 290

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+K+L ++
Sbjct: 291 LHFEIRYHGKSVNPLKYLPKQ 311


>gi|220917705|ref|YP_002493009.1| Peptidase M23 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955559|gb|ACL65943.1| Peptidase M23 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 238

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G      GN + + H   ++T+Y H     V+ GQ V+ G  + L G +G +  P
Sbjct: 146 VVVRAGPR-GGYGNAVEVDHGGGLLTLYGHAAEVRVRPGQVVAAGDELALVGSTGRSTGP 204

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R    A+DP + L+
Sbjct: 205 HLHFEVRMRGRAIDPARALK 224


>gi|197122913|ref|YP_002134864.1| peptidase M23 [Anaeromyxobacter sp. K]
 gi|196172762|gb|ACG73735.1| Peptidase M23 [Anaeromyxobacter sp. K]
          Length = 238

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G      GN + + H   ++T+Y H     V+ GQ V+ G  + L G +G +  P
Sbjct: 146 VVVRAGPR-GGYGNAVEVDHGGGLLTLYGHAAEVRVRPGQVVAAGDELALVGSTGRSTGP 204

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R    A+DP + L+
Sbjct: 205 HLHFEVRMRGRAIDPARALK 224


>gi|153006579|ref|YP_001380904.1| peptidase M23B [Anaeromyxobacter sp. Fw109-5]
 gi|152030152|gb|ABS27920.1| peptidase M23B [Anaeromyxobacter sp. Fw109-5]
          Length = 332

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G  +   G  + +RH+  ++T Y H+       G  V  G  +G+ G++G A  P 
Sbjct: 241 VVRAGW-MGGYGLMVEVRHEGGLITRYGHLAALLCGPGDAVEPGGPLGVVGRTGRATGPH 299

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+ +     DP+ +L
Sbjct: 300 LHFEVWRGGEPSDPLAWL 317


>gi|325277036|ref|ZP_08142697.1| peptidase M23B [Pseudomonas sp. TJI-51]
 gi|324097833|gb|EGB96018.1| peptidase M23B [Pseudomonas sp. TJI-51]
          Length = 138

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 59  VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 117

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 118 LHFEIRRQGKPVDPLQFLPRR 138


>gi|319763721|ref|YP_004127658.1| peptidase m23 [Alicycliphilus denitrificans BC]
 gi|330824016|ref|YP_004387319.1| peptidase M23 [Alicycliphilus denitrificans K601]
 gi|317118282|gb|ADV00771.1| Peptidase M23 [Alicycliphilus denitrificans BC]
 gi|329309388|gb|AEB83803.1| Peptidase M23 [Alicycliphilus denitrificans K601]
          Length = 300

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN ++++H+++ +T Y+H  T  V++ Q V RG  I   G + +A   +
Sbjct: 221 VVYAGAGLRGYGNLVILKHNNTFLTAYAHNQTLLVKEDQNVRRGQKIAEMGST-DADRVK 279

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 280 LHFEIRRQGKPVDPARYLPAR 300


>gi|305666369|ref|YP_003862656.1| putative peptidase [Maribacter sp. HTCC2170]
 gi|88708361|gb|EAR00598.1| putative peptidase [Maribacter sp. HTCC2170]
          Length = 325

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 44/77 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+   N+    G  I I H    +++Y+H+    V+KGQKV RG  IG  G +G ++ P 
Sbjct: 224 VVRADNNASGYGKHIRIDHGYGYLSLYAHMSNYNVKKGQKVKRGDLIGFVGNTGRSEAPH 283

Query: 62  VHFELRKNAIAMDPIKF 78
           +H+E+ K+   ++PI F
Sbjct: 284 LHYEVWKDKERINPINF 300


>gi|304319788|ref|YP_003853431.1| hypothetical protein PB2503_01047 [Parvularcula bermudensis
           HTCC2503]
 gi|303298691|gb|ADM08290.1| hypothetical protein PB2503_01047 [Parvularcula bermudensis
           HTCC2503]
          Length = 449

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      G T+ I H +   T ++H++   V+ G  V     +GL G +G +    
Sbjct: 364 VTFAGWR-SGFGRTVEIDHGNGFKTRFAHMNRIKVKAGDVVELHDVVGLMGSTGRSTGTH 422

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+      +DP+KF+E
Sbjct: 423 LHYEIHYRGRQVDPLKFIE 441


>gi|309389519|gb|ADO77399.1| Peptidase M23 [Halanaerobium praevalens DSM 2228]
          Length = 351

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G      G  ++I H   + T+Y+H     V+ G+ V++G  I  SG +GN+  P 
Sbjct: 273 VVYSGWAT-GYGYVVIIEHQKGLRTLYAHNSKLLVKTGESVAKGEVISRSGNTGNSTGPH 331

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +H E++ N    +P+ ++ +
Sbjct: 332 LHLEVQVNGRPENPLNYINK 351


>gi|86142095|ref|ZP_01060619.1| putative peptidase [Leeuwenhoekiella blandensis MED217]
 gi|85831658|gb|EAQ50114.1| putative peptidase [Leeuwenhoekiella blandensis MED217]
          Length = 325

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 45/78 (57%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V    N+    GN I I H    V++Y+H+    V++GQKV RG  IG  G +G ++ P
Sbjct: 223 VVERADNNATGYGNHIRIDHGYGYVSLYAHLYKYNVRRGQKVQRGDLIGFVGSTGRSEAP 282

Query: 61  QVHFELRKNAIAMDPIKF 78
            VH+E+ K+   ++PI F
Sbjct: 283 HVHYEIFKDGQRINPINF 300


>gi|309389082|gb|ADO76962.1| Peptidase M23 [Halanaerobium praevalens DSM 2228]
          Length = 434

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G  +   G T++I H   I T+Y H     V +G +V++G T+ LSG +G +  P 
Sbjct: 357 VVHSGW-MNGFGYTVIIDHGKGIETLYGHNSKVTVARGTEVNKGQTVALSGSTGLSTGPH 415

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H  + KN   ++P K+L 
Sbjct: 416 LHLGVLKNGEPINPRKYLP 434


>gi|284989282|ref|YP_003407836.1| peptidase M23 [Geodermatophilus obscurus DSM 43160]
 gi|284062527|gb|ADB73465.1| Peptidase M23 [Geodermatophilus obscurus DSM 43160]
          Length = 383

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 11/93 (11%)

Query: 1   MVIYV----------GN-DLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIG 49
           +V+            GN DL   GN + + H   + T Y H+    V  GQ V+ G  IG
Sbjct: 281 IVVRAECTSAYCNRDGNLDLGGYGNLVELDHGGGVTTRYGHLSAYTVTAGQTVTAGTLIG 340

Query: 50  LSGKSGNAQHPQVHFELRKNAIAMDPIKFLEEK 82
             G +GN+    +H E+R +   +DP+ +L ++
Sbjct: 341 FQGSTGNSTGVHLHLEVRIDGTPVDPVPWLADR 373


>gi|154499807|ref|ZP_02037845.1| hypothetical protein BACCAP_03464 [Bacteroides capillosus ATCC
           29799]
 gi|150271405|gb|EDM98662.1| hypothetical protein BACCAP_03464 [Bacteroides capillosus ATCC
           29799]
          Length = 426

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 2/84 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V          GN ++I H D   ++Y+H+ +  V  G  VS+G  IG  G +GN+   
Sbjct: 338 VVTISEYG-SSYGNYVVISHGDGTTSLYAHMSSRAVSAGDVVSQGDVIGYVGSTGNSTGN 396

Query: 61  QVHFELRKNAIAMDPIKFLEEKIP 84
            +H E+R N   +DP ++  + +P
Sbjct: 397 HLHLEIRVNGTRVDPEQYWPD-LP 419


>gi|82703601|ref|YP_413167.1| peptidase M23B [Nitrosospira multiformis ATCC 25196]
 gi|82411666|gb|ABB75775.1| Peptidase M23B [Nitrosospira multiformis ATCC 25196]
          Length = 305

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y      E GN I + H +  V+ Y+H     V+ GQ V RG  I   G +G +  P
Sbjct: 224 VVVYSDYHP-EYGNMIDVDHGNDFVSRYAHASKRLVKVGQVVVRGQKIAEVGSTGRSTGP 282

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R      +P +FL+
Sbjct: 283 HLHFEVRHRGSPQNPSRFLK 302


>gi|126175321|ref|YP_001051470.1| peptidase M23B [Shewanella baltica OS155]
 gi|125998526|gb|ABN62601.1| peptidase M23B [Shewanella baltica OS155]
          Length = 298

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q V  G T+   G +G A    
Sbjct: 219 VVYAGSALRGYGNLVIIKHSDDYLSAYAHTDKILVKEKQHVLAGQTVAKMGSTG-ANRVM 277

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+ +L ++
Sbjct: 278 LHFEIRYHGQSVNPLTYLPKQ 298


>gi|222110295|ref|YP_002552559.1| peptidase m23 [Acidovorax ebreus TPSY]
 gi|221729739|gb|ACM32559.1| Peptidase M23 [Acidovorax ebreus TPSY]
          Length = 303

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN ++++H+++ +T Y+H  T  V++ Q V RG  I   G + +A   +
Sbjct: 224 VVYAGAGLRGYGNLVILKHNNTYLTAYAHNQTLLVKEDQNVRRGQKIAEMGST-DADRVK 282

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 283 LHFEIRRQGKPVDPARYLPSR 303


>gi|220911687|ref|YP_002486996.1| peptidase M23 [Arthrobacter chlorophenolicus A6]
 gi|219858565|gb|ACL38907.1| Peptidase M23 [Arthrobacter chlorophenolicus A6]
          Length = 276

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 45/78 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VG      GN +++ H + + T Y+H+ +  V +GQ VSRG  I LSG +G +    
Sbjct: 199 VTFVGWHQYGGGNRVVVDHGNGLETTYNHLSSFNVTEGQTVSRGDVIALSGTTGASTGCH 258

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE++ N   +DP  +L
Sbjct: 259 LHFEVQVNGEVVDPTGWL 276


>gi|206900677|ref|YP_002251556.1| peptidase, M23/M37 family [Dictyoglomus thermophilum H-6-12]
 gi|206739780|gb|ACI18838.1| peptidase, M23/M37 family [Dictyoglomus thermophilum H-6-12]
          Length = 305

 Score = 94.8 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V YVG +    G  I I H   IVT Y+H+ +  V  GQ V +G  IG  G +G +  P
Sbjct: 217 IVSYVGWE-SGYGKVIKINHGRGIVTYYAHLSSYAVSVGQFVKKGQFIGRVGSTGTSIGP 275

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R+    ++P  +L
Sbjct: 276 HLHYEVRRGGNPVNPATYL 294


>gi|326386207|ref|ZP_08207831.1| peptidase M23B [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209432|gb|EGD60225.1| peptidase M23B [Novosphingobium nitrogenifigens DSM 19370]
          Length = 563

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H   I T Y H+    V  G  VSRG  IG  G +G +  P
Sbjct: 436 VVTYAGWH-GGHGNYVRLEHGGGIDTGYGHMSRIAVAPGSHVSRGQVIGYVGSTGLSTGP 494

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+EL +    ++P+  
Sbjct: 495 HLHYELYRGGQPVNPMSV 512


>gi|167562538|ref|ZP_02355454.1| lipoprotein NlpD, putative [Burkholderia oklahomensis EO147]
          Length = 143

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 64  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 122

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 123 LHFEVRRQGKPVDPLKYLP 141


>gi|153001642|ref|YP_001367323.1| peptidase M23B [Shewanella baltica OS185]
 gi|151366260|gb|ABS09260.1| peptidase M23B [Shewanella baltica OS185]
          Length = 298

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q V  G T+   G +G A    
Sbjct: 219 VVYAGSALRGYGNLVIIKHSDDYLSAYAHTDKILVKEKQHVLAGQTVAKMGSTG-ANRVM 277

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+ +L ++
Sbjct: 278 LHFEIRYHGQSVNPLTYLPKQ 298


>gi|55980672|ref|YP_143969.1| cell wall endopeptidase [Thermus thermophilus HB8]
 gi|55772085|dbj|BAD70526.1| cell wall endopeptidase, family M23/M37 [Thermus thermophilus HB8]
          Length = 371

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 41/79 (51%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G   V  G  +++ H   + T+Y+H+    V+ GQ V  G  IG  G +G +  P 
Sbjct: 293 VEVAGWSSVGYGFHVVLDHGGGLETLYAHMSRIAVRAGQWVEAGQVIGYVGSTGWSTGPH 352

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N +  +P+ +L 
Sbjct: 353 LHFEVRVNGLVKNPLSYLP 371


>gi|46849516|dbj|BAD17845.1| putative lipoprotein NlpD fragment [Hydrogenobacter thermophilus]
          Length = 214

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G    + G  ++IRH    +T+Y H+    V++GQK+  G  +G  G +G +  P
Sbjct: 134 VVEFAGR-YFDYGKAVIIRHPSGYITLYGHLSQIDVKEGQKIKAGDIVGRVGSTGRSTGP 192

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +H+E+ KN   ++P+ F+  +
Sbjct: 193 HLHYEVIKNNRPINPLDFIAWR 214


>gi|148556814|ref|YP_001264396.1| peptidase M23B [Sphingomonas wittichii RW1]
 gi|148502004|gb|ABQ70258.1| peptidase M23B [Sphingomonas wittichii RW1]
          Length = 229

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           MV          GN + I H   I T Y H+       GQ++ RG  IG  G +G +   
Sbjct: 129 MVDRAEW-FGGYGNMVEIEHGKGISTRYGHMSRIAAHPGQRIKRGDLIGYVGSTGRSTGN 187

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +H+E+R +  A++P+ FL+ 
Sbjct: 188 HLHYEVRIDGRAVNPVPFLQS 208


>gi|222529783|ref|YP_002573665.1| peptidase M23 [Caldicellulosiruptor bescii DSM 6725]
 gi|222456630|gb|ACM60892.1| Peptidase M23 [Caldicellulosiruptor bescii DSM 6725]
          Length = 379

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 33/79 (41%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G  +   G TI+I +   I T+Y+H+ +  V  GQKV RG +IG  G +G A  P 
Sbjct: 302 VILAGW-VSGYGKTIIIDNGSGISTLYAHLSSINVAVGQKVKRGESIGNVGATGYATGPH 360

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N    DP+ FL 
Sbjct: 361 LHFEVRINGDVTDPLNFLR 379


>gi|33598254|ref|NP_885897.1| M23/M37 family peptidase [Bordetella parapertussis 12822]
 gi|33566812|emb|CAE39027.1| putative peptidase family M23/M37 protein [Bordetella
           parapertussis]
          Length = 333

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 39/78 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ V       GN++ I H + ++T Y+H     V+ G  V RG  I   G SG +  P 
Sbjct: 232 VVLVAKYQSGYGNSVEIDHGNGLITRYAHASRLLVKPGDVVERGQEIARVGSSGRSTGPH 291

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R     +DP  FL
Sbjct: 292 LHFEVRLAGQPLDPRLFL 309


>gi|33593946|ref|NP_881590.1| M23/M37 family peptidase [Bordetella pertussis Tohama I]
 gi|33564020|emb|CAE43286.1| putative peptidase family M23/M37 protein [Bordetella pertussis
           Tohama I]
 gi|332383364|gb|AEE68211.1| M23/M37 family peptidase [Bordetella pertussis CS]
          Length = 309

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 39/78 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ V       GN++ I H + ++T Y+H     V+ G  V RG  I   G SG +  P 
Sbjct: 208 VVLVAKYQSGYGNSVEIDHGNGLITRYAHASRLLVKPGDVVERGQEIARVGSSGRSTGPH 267

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R     +DP  FL
Sbjct: 268 LHFEVRLAGQPLDPRLFL 285


>gi|33603165|ref|NP_890725.1| M23/M37 family peptidase [Bordetella bronchiseptica RB50]
 gi|33568796|emb|CAE34554.1| putative peptidase family M23/M37 protein [Bordetella
           bronchiseptica RB50]
          Length = 328

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 39/78 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ V       GN++ I H + ++T Y+H     V+ G  V RG  I   G SG +  P 
Sbjct: 227 VVLVAKYQSGYGNSVEIDHGNGLITRYAHASRLLVKPGDVVERGQEIARVGSSGRSTGPH 286

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R     +DP  FL
Sbjct: 287 LHFEVRLAGQPLDPRLFL 304


>gi|114320977|ref|YP_742660.1| peptidase M23B [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227371|gb|ABI57170.1| peptidase M23B [Alkalilimnicola ehrlichii MLHE-1]
          Length = 264

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 47/81 (58%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+HD   +T Y +     V +G++V RG  I   G    A HP 
Sbjct: 181 VVYSGSALRGYGNLVIIKHDSRYLTAYGYNRRLQVGEGEQVRRGQVIAEMGHGPGADHPG 240

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR++   +DP ++L EK
Sbjct: 241 LHFELRRDGEPVDPTRYLPEK 261


>gi|289662666|ref|ZP_06484247.1| lipoprotein [Xanthomonas campestris pv. vasculorum NCPPB702]
          Length = 257

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 177 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 235

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 236 MLHFEIRYNGKPVDPLLYLPKK 257


>gi|78066235|ref|YP_369004.1| peptidase M23B [Burkholderia sp. 383]
 gi|77966980|gb|ABB08360.1| Peptidase M23B [Burkholderia sp. 383]
          Length = 420

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYV--QKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  +++ H D   T Y+H+       + G+ V +G  IG  G +G A 
Sbjct: 275 VVSFVGTDPGGYGRYVIVDHADGYSTYYAHLSAFAHGLKTGETVKQGQRIGSVGMTGAAT 334

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 335 GPHLHFEVRVANNPVDPL 352


>gi|254490721|ref|ZP_05103905.1| M23 peptidase domain protein [Methylophaga thiooxidans DMS010]
 gi|224464076|gb|EEF80341.1| M23 peptidase domain protein [Methylophaga thiooxydans DMS010]
          Length = 301

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V +VGN     G  + + H +  VT Y+H  T  V KG +VS+G  + L G +G +  P
Sbjct: 223 IVSWVGNR-GGYGGLVEVDHGNGYVTRYAHNKTINVAKGDRVSKGEVLALMGSTGRSTGP 281

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            VHFE+ ++   ++P  F++
Sbjct: 282 HVHFEVLRDGQHVNPYNFIK 301


>gi|28868770|ref|NP_791389.1| lipoprotein NlpD [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213969148|ref|ZP_03397287.1| lipoprotein NlpD [Pseudomonas syringae pv. tomato T1]
 gi|301383957|ref|ZP_07232375.1| lipoprotein NlpD, putative [Pseudomonas syringae pv. tomato Max13]
 gi|302064157|ref|ZP_07255698.1| lipoprotein NlpD, putative [Pseudomonas syringae pv. tomato K40]
 gi|302134084|ref|ZP_07260074.1| lipoprotein NlpD, putative [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|28852009|gb|AAO55084.1| lipoprotein NlpD, putative [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213926146|gb|EEB59702.1| lipoprotein NlpD [Pseudomonas syringae pv. tomato T1]
 gi|331016397|gb|EGH96453.1| lipoprotein NlpD, putative [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 288

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|163856859|ref|YP_001631157.1| M23-family peptidase [Bordetella petrii DSM 12804]
 gi|163260587|emb|CAP42889.1| M23-family peptidase [Bordetella petrii]
          Length = 282

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +  LGN I+I H +  +T Y+H     V+ GQ V RG  I   G++ +   P+
Sbjct: 203 VMYSGNGVRGLGNLIIINHQNGFITAYAHNQKLLVKTGQTVKRGAKIAEVGQT-DTTSPR 261

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 262 LHFEIRRQGTPVDPLQYLPPR 282


>gi|217972426|ref|YP_002357177.1| peptidase M23 [Shewanella baltica OS223]
 gi|217497561|gb|ACK45754.1| Peptidase M23 [Shewanella baltica OS223]
          Length = 298

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q V  G T+   G +G A    
Sbjct: 219 VVYAGSALRGYGNLVIIKHSDDYLSAYAHTDKILVKEKQHVLAGQTVAKMGSTG-ANRVM 277

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+ +L ++
Sbjct: 278 LHFEIRYHGQSVNPLTYLPKQ 298


>gi|330950647|gb|EGH50907.1| peptidoglycan-binding LysM:peptidase M23B [Pseudomonas syringae Cit
           7]
          Length = 288

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|170748688|ref|YP_001754948.1| peptidase M23 [Methylobacterium radiotolerans JCM 2831]
 gi|170655210|gb|ACB24265.1| Peptidase M23 [Methylobacterium radiotolerans JCM 2831]
          Length = 494

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 45/76 (59%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH +  V+ Y+H     V+ G KV RG TI  SG SGN   PQ
Sbjct: 414 VAYAGSDVKGYGKLVLVRHANGYVSAYAHNGEIDVKPGDKVKRGQTIAKSGASGNVTSPQ 473

Query: 62  VHFELRKNAIAMDPIK 77
           +HFE+RK    +DP+ 
Sbjct: 474 LHFEIRKGGAPVDPMS 489


>gi|163855010|ref|YP_001629308.1| metallopeptidase [Bordetella petrii DSM 12804]
 gi|163258738|emb|CAP41037.1| metallopeptidase [Bordetella petrii]
          Length = 329

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+         GNT+ I H D ++T Y+H     V+ G  V RG  I   G +G +  P
Sbjct: 226 VVLEASYQT-GYGNTVEIDHGDGLITRYAHASKLLVKPGDLVGRGQEIARVGSTGRSTGP 284

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +HFE+R     +DP  FL+ 
Sbjct: 285 HLHFEVRLAGQPLDPRLFLQS 305


>gi|325962255|ref|YP_004240161.1| metalloendopeptidase-like membrane protein [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323468342|gb|ADX72027.1| metalloendopeptidase-like membrane protein [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 273

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VG      GN +++ H + + T Y+H+ +  V +GQ VSRG  + LSG +G +    
Sbjct: 196 VTFVGWHQYGGGNRVVVDHGNGLETTYNHLSSFNVTEGQTVSRGDVVALSGTTGASTGCH 255

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE++ N   +DP  +L
Sbjct: 256 LHFEVQVNGEVVDPTGWL 273


>gi|302872245|ref|YP_003840881.1| Peptidase M23 [Caldicellulosiruptor obsidiansis OB47]
 gi|302575104|gb|ADL42895.1| Peptidase M23 [Caldicellulosiruptor obsidiansis OB47]
          Length = 379

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G  +   G TI+I +   I T+Y+H+ +  V  GQKV +G +IG  G +G A  P 
Sbjct: 302 VILAGW-VSGYGKTIIIDNGSGISTLYAHLSSINVAVGQKVKKGESIGNVGATGYATGPH 360

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N    DP+ FL 
Sbjct: 361 LHFEVRINGDVTDPLNFLR 379


>gi|311032227|ref|ZP_07710317.1| metalloprotease yebA precursor [Bacillus sp. m3-13]
          Length = 498

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G D    GN ++I H + + T Y+H+D+  V  G+ VSRG  IG+ G +G +   
Sbjct: 419 VVESAGWD-GGYGNKVVINHQNGMKTTYAHLDSISVSVGETVSRGGKIGVMGTTGQSTGV 477

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+ ++    DP+++L 
Sbjct: 478 HLHFEVYQDGKLKDPMQYLN 497


>gi|163786079|ref|ZP_02180527.1| putative peptidase [Flavobacteriales bacterium ALC-1]
 gi|159877939|gb|EDP71995.1| putative peptidase [Flavobacteriales bacterium ALC-1]
          Length = 323

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           ++    N     GN I I H    +++Y+H+    V+  Q+V RG  IG  G +G ++ P
Sbjct: 221 VIKRADNGSTGYGNHIRIDHGYGYISLYAHLYKYNVKVNQRVKRGDLIGFVGSTGRSEAP 280

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E+ K+   ++PI F
Sbjct: 281 HLHYEVFKDGERINPINF 298


>gi|330872697|gb|EGH06846.1| lipoprotein NlpD [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 288

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|149369736|ref|ZP_01889588.1| putative peptidase [unidentified eubacterium SCB49]
 gi|149357163|gb|EDM45718.1| putative peptidase [unidentified eubacterium SCB49]
          Length = 325

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 43/77 (55%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V    N     GN I I H     ++Y+H+    V+KGQKV RG  IG  G +G ++ P 
Sbjct: 224 VTRADNGASGYGNHIRIDHGFGYQSLYAHLYKYNVRKGQKVQRGDLIGFVGSTGRSEAPH 283

Query: 62  VHFELRKNAIAMDPIKF 78
           +H+E+ K+ + ++PI F
Sbjct: 284 LHYEVFKDGVRINPINF 300


>gi|268608724|ref|ZP_06142451.1| peptidase M23B [Ruminococcus flavefaciens FD-1]
          Length = 645

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 40/78 (51%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G +    G  ++I H D   TVY+H+   Y   G  V RG  IG  G +G++  P 
Sbjct: 486 VVSAGWNPGGYGYFVMIDHLDGYQTVYAHMSQVYATTGTPVKRGQLIGAVGSTGDSTGPH 545

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R   I  DP KF+
Sbjct: 546 CHFEVRYMGICYDPAKFM 563


>gi|70728588|ref|YP_258337.1| peptidase M23/LysM domain-containing protein [Pseudomonas
           fluorescens Pf-5]
 gi|68342887|gb|AAY90493.1| peptidase M23/LysM domain protein [Pseudomonas fluorescens Pf-5]
          Length = 286

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H+++ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 207 VVYAGSGLRGYGELVIIKHNETYVSAYGHNRKLLVREGQQVKVGQTIAEMGSTG-TDRVK 265

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 266 LHFEIRRQGKPVDPLQFLPRR 286


>gi|302187928|ref|ZP_07264601.1| peptidoglycan-binding LysM:peptidase M23B [Pseudomonas syringae pv.
           syringae 642]
          Length = 288

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|170743912|ref|YP_001772567.1| peptidase M23B [Methylobacterium sp. 4-46]
 gi|168198186|gb|ACA20133.1| peptidase M23B [Methylobacterium sp. 4-46]
          Length = 415

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+         GN + I H   + T Y H+    V  GQ V  G  IG  G +G +  P 
Sbjct: 315 VVSAEYA-GGYGNMVEIDHGHGLATRYGHLSAFAVAPGQVVEPGQVIGRVGSTGRSTAPH 373

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R +   +DP +FL 
Sbjct: 374 LHYETRIDGEPVDPQRFLR 392


>gi|332289279|ref|YP_004420131.1| lipoprotein NlpD [Gallibacterium anatis UMN179]
 gi|330432175|gb|AEC17234.1| lipoprotein NlpD [Gallibacterium anatis UMN179]
          Length = 403

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H ++  V+  Q+V+ G  I   G SG     +
Sbjct: 324 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNESILVKDQQQVTAGQQIAKMGSSGTNS-VK 382

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    +++P  +L  
Sbjct: 383 LHFEIRYKGKSVNPTNYLPR 402


>gi|188575908|ref|YP_001912837.1| lipoprotein [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188520360|gb|ACD58305.1| lipoprotein [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 263

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 183 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 241

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 242 MLHFEIRYNGKPVDPLLYLPKK 263


>gi|87303672|ref|ZP_01086447.1| Peptidoglycan-binding LysM [Synechococcus sp. WH 5701]
 gi|87281777|gb|EAQ73742.1| Peptidoglycan-binding LysM [Synechococcus sp. WH 5701]
          Length = 363

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G      G  + I+H D   ++Y H     V+ GQ+VS+G  I   G +G +  P 
Sbjct: 281 VSYAGWHDGGYGYLVEIQHPDGSKSLYGHNSRVLVRVGQQVSQGAKISEMGSTGRSTGPH 340

Query: 62  VHFELRKNAI-AMDPIKFLEEK 82
           +HFE+      A +P++FL  +
Sbjct: 341 LHFEIHPPGRGAANPLQFLPGR 362


>gi|330964172|gb|EGH64432.1| lipoprotein NlpD [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 288

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 209 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ FL  +
Sbjct: 268 LHFEIRRQGKPVDPLGFLPRR 288


>gi|157961020|ref|YP_001501054.1| peptidase M23B [Shewanella pealeana ATCC 700345]
 gi|157846020|gb|ABV86519.1| peptidase M23B [Shewanella pealeana ATCC 700345]
          Length = 296

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q VS G T+   G +G      
Sbjct: 217 VVYAGSALRGYGNLVIIKHSDDYLSAYAHADKISVKEKQLVSVGQTVATMGSTG-TNRVM 275

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+KFL ++
Sbjct: 276 LHFEIRYHGKSVNPVKFLPKQ 296


>gi|87198087|ref|YP_495344.1| peptidase M23B [Novosphingobium aromaticivorans DSM 12444]
 gi|87133768|gb|ABD24510.1| peptidase M23B [Novosphingobium aromaticivorans DSM 12444]
          Length = 387

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VG      GN + + H + ++T Y+H+     + GQKV  G  IG  G +G +  P 
Sbjct: 292 VSFVG-VRQGYGNVVEVSHGNGLLTRYAHMSRTQARVGQKVDAGAEIGKIGNTGRSTGPH 350

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N   ++P  FLE
Sbjct: 351 LHFEVRINDRPVNPRPFLE 369


>gi|16226164|gb|AAL16090.1|AF421351_2 murein endopeptidase [Azotobacter vinelandii]
          Length = 217

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   G  I+I+H D  V+ Y H     V++GQ+V  G  I   G +G     +
Sbjct: 138 VVYAGGGLRGYGELIIIKHSDVYVSAYGHNRRLLVREGQQVKAGQVIAEMGSTG-TDRVK 196

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 197 LHFEIRRQGKPVDPLQYLPSR 217


>gi|331007273|ref|ZP_08330476.1| Membrane protein [gamma proteobacterium IMCC1989]
 gi|330418922|gb|EGG93385.1| Membrane protein [gamma proteobacterium IMCC1989]
          Length = 257

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G +    G  I I H +   T Y+H    + + G  V +G  I L G +G +  P
Sbjct: 175 VVIESG-ERNGYGGMIKINHGNGFQTRYAHNKKNFAKVGDVVKKGQVIALMGSTGRSTGP 233

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+ K    +DP  ++  
Sbjct: 234 HVHFEVYKYGRPVDPAAYINR 254


>gi|330501932|ref|YP_004378801.1| peptidase M23B [Pseudomonas mendocina NK-01]
 gi|328916218|gb|AEB57049.1| peptidase M23B [Pseudomonas mendocina NK-01]
          Length = 306

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GNT+ I H D  VT+Y+H  +  VQ G  V RG TI   G++G +   
Sbjct: 222 VVTFSGKK-SGYGNTVEISHADGYVTLYAHNQSNTVQIGDLVQRGQTIARVGRTGRSTGY 280

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+ K+   ++P  ++  
Sbjct: 281 HVHFEVSKDGRQVNPALYIAR 301


>gi|110833467|ref|YP_692326.1| M24/M37 family peptidase [Alcanivorax borkumensis SK2]
 gi|110646578|emb|CAL16054.1| peptidase, M23/M37 family [Alcanivorax borkumensis SK2]
          Length = 310

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G +    G  + I H + + T Y H     V+ G+ V  G  +G  G SG +  P
Sbjct: 228 VVTYSG-ERSGYGKMVEINHGNGLSTRYGHAMELLVEPGEIVRTGDVVGKVGSSGRSTGP 286

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VH+E+ KN   ++P  ++
Sbjct: 287 HVHYEVLKNGAQVNPQPYI 305


>gi|326385609|ref|ZP_08207243.1| Peptidase M23 [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209943|gb|EGD60726.1| Peptidase M23 [Novosphingobium nitrogenifigens DSM 19370]
          Length = 213

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      GN + I H D   T Y H+    V  G  V++G  I L G +G +  P 
Sbjct: 76  VDFAGWR-GGYGNLVEILHADGTRTRYGHLSRIVVGPGDTVAQGQEIALMGSTGRSTGPH 134

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R   IA++P+ F+
Sbjct: 135 LHFEVRSGGIAVNPLVFM 152


>gi|307262433|ref|ZP_07544078.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 12 str.
           1096]
 gi|306867810|gb|EFM99641.1| Peptidase M23B [Actinobacillus pleuropneumoniae serovar 12 str.
           1096]
          Length = 288

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V+ G TI   G +G     +
Sbjct: 209 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDTVNAGDTIARMGSTGTNS-NK 267

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 268 LHFEIRYKGKSVDPTRYLPRK 288


>gi|167587438|ref|ZP_02379826.1| peptidase M23B [Burkholderia ubonensis Bu]
          Length = 233

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y GN L   GN I+++H+   +T Y+H     V++GQ V++G TI   G + ++   
Sbjct: 153 VVVYAGNGLRGYGNLIILKHNADYLTAYAHNRALLVKEGQSVTQGQTIAEMGNT-DSDRV 211

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFELR    ++DP ++L  +
Sbjct: 212 ALHFELRYGGRSIDPSRYLPAR 233


>gi|312876760|ref|ZP_07736739.1| Peptidase M23 [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796491|gb|EFR12841.1| Peptidase M23 [Caldicellulosiruptor lactoaceticus 6A]
          Length = 379

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G  +   G TI+I +   I T+Y+H+ +  V  GQKV +G +IG  G +G A  P 
Sbjct: 302 VILAGW-VSGYGKTIIIDNGSGISTLYAHLSSINVSVGQKVKKGESIGSVGATGYATGPH 360

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N    DP+ FL 
Sbjct: 361 LHFEVRINGDVTDPLNFLR 379


>gi|291615164|ref|YP_003525321.1| peptidase M23 [Sideroxydans lithotrophicus ES-1]
 gi|291585276|gb|ADE12934.1| Peptidase M23 [Sideroxydans lithotrophicus ES-1]
          Length = 280

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           MV+Y  +   E GN + I H + +VT Y+H     V+ GQ V RG  I LSG +G +  P
Sbjct: 198 MVVYA-DAHPEYGNMVEIDHGNQVVTRYAHASKLLVKVGQMVKRGQEIALSGSTGRSTGP 256

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +HFE+R   IA +P++FLE+
Sbjct: 257 HLHFEVRYKGIAQNPVRFLEK 277


>gi|158319237|ref|YP_001511744.1| peptidase M23B [Alkaliphilus oremlandii OhILAs]
 gi|158139436|gb|ABW17748.1| peptidase M23B [Alkaliphilus oremlandii OhILAs]
          Length = 318

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G +    G  ++I H     ++Y+H     V  G +V +G  I   G +G +  P
Sbjct: 239 VVTFSGYN-GSYGRVVMISHGYGYTSIYAHNRKNLVSVGDRVEKGQPIAELGSTGRSTGP 297

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+R +   ++P+  +++
Sbjct: 298 HVHFEVRLHNEPVNPLTLVQQ 318


>gi|312127171|ref|YP_003992045.1| peptidase M23 [Caldicellulosiruptor hydrothermalis 108]
 gi|311777190|gb|ADQ06676.1| Peptidase M23 [Caldicellulosiruptor hydrothermalis 108]
          Length = 379

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 33/79 (41%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G  +   G TI+I +   I T+Y+H+ +  V  GQKV RG +IG  G +G A  P 
Sbjct: 302 VILAGW-VSGYGKTIIIDNGSGISTLYAHLSSINVAVGQKVKRGESIGSVGATGYATGPH 360

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N    DP+ FL 
Sbjct: 361 LHFEVRINGDVTDPLNFLR 379


>gi|254478267|ref|ZP_05091648.1| M23 peptidase domain protein [Carboxydibrachium pacificum DSM
           12653]
 gi|214035863|gb|EEB76556.1| M23 peptidase domain protein [Carboxydibrachium pacificum DSM
           12653]
          Length = 305

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 3   IYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQV 62
           +Y G +    G  + I H++++ T Y+H+ +  V++ Q V  G  IG  G +G +  P +
Sbjct: 229 VYAGWND-GYGLVVFIWHNNNLETRYAHLSSIAVKQRQVVRAGDVIGYVGSTGKSTGPHL 287

Query: 63  HFELRKNAIAMDPIKFLE 80
           HFE+R    A++P+ F +
Sbjct: 288 HFEVRVGGRAVNPLDFFK 305


>gi|121593574|ref|YP_985470.1| peptidase M23B [Acidovorax sp. JS42]
 gi|120605654|gb|ABM41394.1| peptidase M23B [Acidovorax sp. JS42]
          Length = 303

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN ++++H+++ +T Y+H  T  V++ Q V RG  I   G + +A   +
Sbjct: 224 VVYAGAGLRGYGNLVILKHNNTYLTAYAHNQTLLVKEDQNVRRGQKIAEMGST-DADRVK 282

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 283 LHFEIRRQGKPVDPARYLPSR 303


>gi|58582576|ref|YP_201592.1| lipoprotein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|58427170|gb|AAW76207.1| lipoprotein [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 266

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 186 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 244

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 245 MLHFEIRYNGKPVDPLLYLPKK 266


>gi|197286083|ref|YP_002151955.1| lipoprotein [Proteus mirabilis HI4320]
 gi|194683570|emb|CAR44442.1| lipoprotein [Proteus mirabilis HI4320]
          Length = 374

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+D  ++ Y+H DT  V++ Q V+ G  I   G +G +   +
Sbjct: 295 VVYAGSALRGYGNLVIIKHNDEYLSAYAHNDTILVREQQNVNAGQQIATMGSTGTSS-VR 353

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+ +L ++
Sbjct: 354 LHFEIRYKEKSLNPMSYLPKR 374


>gi|313207077|ref|YP_004046254.1| peptidase m23 [Riemerella anatipestifer DSM 15868]
 gi|312446393|gb|ADQ82748.1| Peptidase M23 [Riemerella anatipestifer DSM 15868]
 gi|315022527|gb|EFT35554.1| Peptidase M23B [Riemerella anatipestifer RA-YM]
 gi|325335486|gb|ADZ11760.1| peptidase M23B [Riemerella anatipestifer RA-GD]
          Length = 276

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 4   YVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVH 63
           + G +    G  ++I H + + T+Y H+    V+   K+  G TI  SG +G +  P +H
Sbjct: 200 FAG-EKSGYGKCVIISHGNGLATLYGHLSQVLVKANDKIKAGETIAKSGNTGRSTGPHLH 258

Query: 64  FELRKNAIAMDPIKFL 79
           +E+ KN   ++P  FL
Sbjct: 259 YEVHKNGTPVNPKLFL 274


>gi|291514085|emb|CBK63295.1| Membrane proteins related to metalloendopeptidases [Alistipes
           shahii WAL 8301]
          Length = 399

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 41/81 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V     +    GN ++IRHD+ + T Y H+    V+  Q V  G  IGL G +G +  P 
Sbjct: 227 VRISQYNRGGYGNLVIIRHDNGLETYYGHLSERLVEPDQWVEAGQIIGLGGSTGRSTGPH 286

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE R    + DP + ++ K
Sbjct: 287 LHFETRYYGQSFDPERLIDFK 307


>gi|192361463|ref|YP_001982682.1| lipoprotein NlpD [Cellvibrio japonicus Ueda107]
 gi|190687628|gb|ACE85306.1| lipoprotein NlpD [Cellvibrio japonicus Ueda107]
          Length = 281

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H+++ ++ Y+H D   VQ+G  V  G  I   G SG     +
Sbjct: 202 VVYAGSGLRGYGKLLIIKHNETFLSAYAHNDKLLVQEGDWVKVGQRIADMGSSG-TDRVK 260

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    ++P+ +L  +
Sbjct: 261 LHFEIRREGTPVNPLTYLPRR 281


>gi|307265036|ref|ZP_07546597.1| Peptidase M23 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306920021|gb|EFN50234.1| Peptidase M23 [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 303

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G +    G  + I H+ ++ T Y+H+ +  V++ Q V  G  IG  G +G +  P 
Sbjct: 226 VAYAGWND-GYGLVVFIWHNSNLETRYAHLSSIAVKQRQIVRAGDVIGYVGSTGKSTGPH 284

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    A++P+ F +
Sbjct: 285 LHFEVRIGGKAVNPLDFFK 303


>gi|325293234|ref|YP_004279098.1| membrane protein associated metalloendopeptidase [Agrobacterium sp.
           H13-3]
 gi|325061087|gb|ADY64778.1| membrane protein associated metalloendopeptidase [Agrobacterium sp.
           H13-3]
          Length = 438

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 43/77 (55%)

Query: 3   IYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQV 62
           + V  +    GN + I H   + T + H+ T  V+ G KV  G  +G +G +G +  P V
Sbjct: 351 VTVAENSGGYGNMVEIDHGQGVSTRFGHLSTILVKAGDKVEAGDIVGRAGSTGRSTGPHV 410

Query: 63  HFELRKNAIAMDPIKFL 79
           H+E+R+N   +DP++FL
Sbjct: 411 HYEVRRNDTPVDPMRFL 427


>gi|163793138|ref|ZP_02187114.1| Membrane protein [alpha proteobacterium BAL199]
 gi|159181784|gb|EDP66296.1| Membrane protein [alpha proteobacterium BAL199]
          Length = 396

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 49/75 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y GN+L   GN +LI+H D   T Y+H D   V++G +V+RG  I   G++GN   P
Sbjct: 299 VVVYAGNELRGFGNLLLIKHADGWTTAYAHADALLVRRGDRVARGQPIATVGETGNVDRP 358

Query: 61  QVHFELRKNAIAMDP 75
           Q+HFE+RK   A+DP
Sbjct: 359 QLHFEIRKGQRAVDP 373


>gi|294627732|ref|ZP_06706314.1| peptidase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122]
 gi|294666427|ref|ZP_06731671.1| peptidase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535]
 gi|292598084|gb|EFF42239.1| peptidase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122]
 gi|292603796|gb|EFF47203.1| peptidase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535]
          Length = 313

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  VT Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 224 VVSYAG-VRGGYGNVVEVDHGNGYVTRYAHNSRLVVKVGDLVRAGQQVARAGSSGRSTGA 282

Query: 61  QVHFELRKNAIAMDPIKFLEEKIP 84
            VHFE+  +   ++P KFL E  P
Sbjct: 283 HVHFEVWADGRVVNPRKFLGETTP 306


>gi|227356593|ref|ZP_03840980.1| lipoprotein [Proteus mirabilis ATCC 29906]
 gi|227163349|gb|EEI48276.1| lipoprotein [Proteus mirabilis ATCC 29906]
          Length = 374

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+D  ++ Y+H DT  V++ Q V+ G  I   G +G +   +
Sbjct: 295 VVYAGSALRGYGNLVIIKHNDEYLSAYAHNDTILVREQQNVNAGQQIATMGSTGTSS-VR 353

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+ +L ++
Sbjct: 354 LHFEIRYKEKSLNPMSYLPKR 374


>gi|222149907|ref|YP_002550864.1| hypothetical protein Avi_3949 [Agrobacterium vitis S4]
 gi|221736889|gb|ACM37852.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 648

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           V   G D    GN  +IRH +   + Y+H       V  G K+ +G  IG  G +G +  
Sbjct: 530 VEKAGWDSGGYGNQTIIRHPNGYESSYNHQSAIAKGVVAGAKIRQGQVIGWVGTTGESTG 589

Query: 60  PQVHFELRKNAIAMDPIKFLEEKIP 84
           P +H+E+  N   +DP+K    ++P
Sbjct: 590 PHLHYEIIVNGTKVDPMKV---RLP 611


>gi|84624462|ref|YP_451834.1| lipoprotein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|84368402|dbj|BAE69560.1| lipoprotein [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 257

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 177 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 235

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 236 MLHFEIRYNGKPVDPLLYLPKK 257


>gi|298492796|ref|YP_003722973.1| peptidase M23 ['Nostoc azollae' 0708]
 gi|298234714|gb|ADI65850.1| Peptidase M23 ['Nostoc azollae' 0708]
          Length = 788

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    GN + IRH D  +T Y H     VQ GQ+V +G TI   G +G +  P
Sbjct: 703 VVERAGWNNGGYGNVVDIRHPDGSMTRYGHNSRILVQVGQQVEQGQTIAAMGSTGFSTGP 762

Query: 61  QVHFELRKNAI-AMDPIKFLEEK 82
             HFE+      A++PI FL  +
Sbjct: 763 HSHFEVHPAGKGAVNPIAFLPSQ 785


>gi|300779254|ref|ZP_07089112.1| cell wall endopeptidase family protein [Chryseobacterium gleum ATCC
           35910]
 gi|300504764|gb|EFK35904.1| cell wall endopeptidase family protein [Chryseobacterium gleum ATCC
           35910]
          Length = 285

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 46/81 (56%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G DL   GN I IRH +S +T Y H+   Y + G+ V  G  I  SG +GN+   
Sbjct: 183 VVIASGWDLGGGGNYIKIRHSNSFITSYLHLSEMYYKAGEFVKAGFIIAKSGNTGNSTGA 242

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +HF + +N   ++PI+FL +
Sbjct: 243 HLHFSVTENGKYINPIRFLND 263


>gi|225181886|ref|ZP_03735321.1| Peptidase M23 [Dethiobacter alkaliphilus AHT 1]
 gi|225167400|gb|EEG76216.1| Peptidase M23 [Dethiobacter alkaliphilus AHT 1]
          Length = 291

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 10  VELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN 69
              GN ++I H  +  T Y+H+ +  VQ G +V +G  IG  G +G +  P +HFE+ KN
Sbjct: 216 GGYGNLVIIDHG-TYSTHYAHLRSFEVQAGDRVEKGQIIGQVGNTGYSTGPHLHFEIHKN 274

Query: 70  AIAMDPIKFLEEKIP 84
              +DP+K +E + P
Sbjct: 275 GSPIDPLKMIETEAP 289


>gi|325925520|ref|ZP_08186909.1| metalloendopeptidase-like membrane protein [Xanthomonas perforans
           91-118]
 gi|325544070|gb|EGD15464.1| metalloendopeptidase-like membrane protein [Xanthomonas perforans
           91-118]
          Length = 313

 Score = 94.4 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  VT Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 224 VVSYAG-VRGGYGNVVEVDHGNGYVTRYAHNSRLVVKVGDLVRAGQQVARAGSSGRSTGA 282

Query: 61  QVHFELRKNAIAMDPIKFLEEKIP 84
            VHFE+  +   ++P KFL E  P
Sbjct: 283 HVHFEVWADGRVVNPRKFLGEATP 306


>gi|332991947|gb|AEF02002.1| peptidase, M23/M37 family protein [Alteromonas sp. SN2]
          Length = 292

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G +    G+ + I H D  +T Y H +T  V  G  V++G  I   G +G +   
Sbjct: 212 IVTWAG-ERSGYGHLVEIEHGDGFITRYGHNETLTVSIGDVVTKGQAIAKMGNTGRSTGV 270

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VH+E+ +N   +DP+ ++ +K
Sbjct: 271 HVHYEVIRNGKQIDPLPYVYKK 292


>gi|92112181|ref|YP_572109.1| peptidase M23B [Chromohalobacter salexigens DSM 3043]
 gi|91795271|gb|ABE57410.1| peptidase M23B [Chromohalobacter salexigens DSM 3043]
          Length = 387

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++    +   GN ++I H D+I+T+Y+H+    V  G++V RG TI   G SG    P 
Sbjct: 308 VVFADW-MRGFGNLVIIDHGDNIMTLYAHLQRFAVGVGEQVERGATIAAVGDSGGRDTPA 366

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           ++FE+R+N   +DP  ++  +
Sbjct: 367 LYFEVRENGDPIDPGDWIARR 387


>gi|220931939|ref|YP_002508847.1| peptidase M23B [Halothermothrix orenii H 168]
 gi|219993249|gb|ACL69852.1| peptidase M23B [Halothermothrix orenii H 168]
          Length = 274

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G      GN ++I+H D+ +T Y+H     V+KG++V +G  I LSG SG++  P
Sbjct: 186 IVIYSGWKN-GYGNLVIIKHRDNKLTYYAHNLRLLVKKGERVKQGRIIALSGNSGDSTGP 244

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R     ++P+++L ++
Sbjct: 245 HLHFEIRVGNRVVNPLQYLNKR 266


>gi|300814504|ref|ZP_07094764.1| peptidase, M23 family [Peptoniphilus sp. oral taxon 836 str. F0141]
 gi|300511388|gb|EFK38628.1| peptidase, M23 family [Peptoniphilus sp. oral taxon 836 str. F0141]
          Length = 400

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI     +   GN +++ H D IVTVY+H     V  GQKV  G  +   G +G +  P 
Sbjct: 325 VIMA-RQMSGYGNVVMVDHGD-IVTVYAHNSRVNVSVGQKVKAGDVVSFIGSTGLSTGPH 382

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N   ++P+ ++
Sbjct: 383 LHFEVRVNGQPVNPLGYI 400


>gi|282882619|ref|ZP_06291236.1| peptidase M23B [Peptoniphilus lacrimalis 315-B]
 gi|281297530|gb|EFA90009.1| peptidase M23B [Peptoniphilus lacrimalis 315-B]
          Length = 400

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI     +   GN +++ H D IVTVY+H     V  GQKV  G  +   G +G +  P 
Sbjct: 325 VIMA-RQMSGYGNVVMVDHGD-IVTVYAHNSRVNVSVGQKVKAGDVVSFIGSTGLSTGPH 382

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N   ++P+ ++
Sbjct: 383 LHFEVRVNGQPVNPLGYI 400


>gi|237809474|ref|YP_002893914.1| Peptidase M23 [Tolumonas auensis DSM 9187]
 gi|237501735|gb|ACQ94328.1| Peptidase M23 [Tolumonas auensis DSM 9187]
          Length = 378

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H++  ++ Y+H D   V + Q V  G  I   G S ++   +
Sbjct: 299 VVYAGNALRGYGNLIIIKHNEDYLSAYAHNDALRVTEQQVVKAGQKIADMGSSESSD-VR 357

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 358 LHFEIRYRGQSVNPLRYLPKR 378


>gi|254563564|ref|YP_003070659.1| hypothetical protein METDI5234 [Methylobacterium extorquens DM4]
 gi|254270842|emb|CAX26847.1| putative protein precursor, N-terminal membrane lipoprotein lipid
           attachment site and C-terminal peptidase domain
           [Methylobacterium extorquens DM4]
          Length = 455

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 49/78 (62%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH++  V+ Y+H     V+ G+KV RG TI  SG +GN   PQ
Sbjct: 376 VAYAGSDVKGYGKLVLVRHNNGYVSAYAHNGELDVRPGEKVKRGQTIAKSGATGNVTSPQ 435

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELRK A  +DP+  L
Sbjct: 436 LHFELRKGATPVDPMPHL 453


>gi|240141050|ref|YP_002965530.1| putative protein precursor, N-terminal membrane lipoprotein lipid
           attachment site and C-terminal peptidase domain
           [Methylobacterium extorquens AM1]
 gi|240011027|gb|ACS42253.1| putative protein precursor, N-terminal membrane lipoprotein lipid
           attachment site and C-terminal peptidase domain
           [Methylobacterium extorquens AM1]
          Length = 446

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 49/78 (62%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH++  V+ Y+H     V+ G+KV RG TI  SG +GN   PQ
Sbjct: 367 VAYAGSDVKGYGKLVLVRHNNGYVSAYAHNGELDVRPGEKVKRGQTIAKSGATGNVTSPQ 426

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELRK A  +DP+  L
Sbjct: 427 LHFELRKGATPVDPMPHL 444


>gi|167815443|ref|ZP_02447123.1| lipoprotein NlpD, putative [Burkholderia pseudomallei 91]
          Length = 130

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 51  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 109

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 110 LHFEVRRQGKPVDPLKYLP 128


>gi|220925877|ref|YP_002501179.1| peptidase M23 [Methylobacterium nodulans ORS 2060]
 gi|219950484|gb|ACL60876.1| Peptidase M23 [Methylobacterium nodulans ORS 2060]
          Length = 382

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+         GN + I H   I T Y+H+    V  GQ V  G  IG  G +G +  P 
Sbjct: 296 VVSADYA-GGYGNMVEIDHGHGIATRYAHLSAFAVSPGQTVEAGQIIGRVGSTGRSTAPH 354

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R +   +DP +FL 
Sbjct: 355 LHYETRIDGEPVDPQRFLR 373


>gi|218532487|ref|YP_002423303.1| peptidase M23 [Methylobacterium chloromethanicum CM4]
 gi|218524790|gb|ACK85375.1| Peptidase M23 [Methylobacterium chloromethanicum CM4]
          Length = 455

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 49/78 (62%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH++  V+ Y+H     V+ G+KV RG TI  SG +GN   PQ
Sbjct: 376 VAYAGSDVKGYGKLVLVRHNNGYVSAYAHNGELDVRPGEKVKRGQTIAKSGATGNVTSPQ 435

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELRK A  +DP+  L
Sbjct: 436 LHFELRKGATPVDPMPHL 453


>gi|163853628|ref|YP_001641671.1| peptidase M23B [Methylobacterium extorquens PA1]
 gi|163665233|gb|ABY32600.1| peptidase M23B [Methylobacterium extorquens PA1]
          Length = 451

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 49/78 (62%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH++  V+ Y+H     V+ G+KV RG TI  SG +GN   PQ
Sbjct: 372 VAYAGSDVKGYGKLVLVRHNNGYVSAYAHNGELDVRPGEKVKRGQTIAKSGATGNVTSPQ 431

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELRK A  +DP+  L
Sbjct: 432 LHFELRKGATPVDPMPHL 449


>gi|20808489|ref|NP_623660.1| membrane proteins related to metalloendopeptidase
           [Thermoanaerobacter tengcongensis MB4]
 gi|20517109|gb|AAM25264.1| Membrane proteins related to metalloendopeptidases
           [Thermoanaerobacter tengcongensis MB4]
          Length = 571

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 50/79 (63%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    G  ++I+H D + TVY H+    V +G++V +G  IGLSG +G +   
Sbjct: 290 VVVLAG-EYGGYGKAVIIKHTDGLSTVYGHLSEIKVGEGKEVKQGEVIGLSGNTGRSTGS 348

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+RK++  +DP+++L
Sbjct: 349 HLHFEIRKDSQPVDPLQYL 367


>gi|325928788|ref|ZP_08189957.1| metalloendopeptidase-like membrane protein [Xanthomonas perforans
           91-118]
 gi|325540869|gb|EGD12442.1| metalloendopeptidase-like membrane protein [Xanthomonas perforans
           91-118]
          Length = 259

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 179 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 237

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 238 MLHFEIRYNGKPVDPLLYLPKK 259


>gi|254523228|ref|ZP_05135283.1| peptidase [Stenotrophomonas sp. SKA14]
 gi|219720819|gb|EED39344.1| peptidase [Stenotrophomonas sp. SKA14]
          Length = 296

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + + H +  VT Y+H     V+ G  V  G  +  +G +G +   
Sbjct: 205 VVSFAG-VKGGYGNVVDVDHGNGYVTRYAHNSRLVVKAGDLVRAGQEVAKAGSTGRSTGA 263

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+ +N   ++P KFL
Sbjct: 264 HVHFEVWENGNVVNPRKFL 282


>gi|90407886|ref|ZP_01216061.1| lipoprotein NlpD [Psychromonas sp. CNPT3]
 gi|90310977|gb|EAS39087.1| lipoprotein NlpD [Psychromonas sp. CNPT3]
          Length = 310

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+I+H    ++ Y+H +   V + + +  G  I   G SG  ++  
Sbjct: 231 VVYAGSGLRGYGNLIIIKHSYDYLSAYAHNERLLVHENESIKLGQKIATMGDSG-TKNVF 289

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L ++
Sbjct: 290 LHFEIRYRGKSVDPLRYLPKR 310


>gi|217977521|ref|YP_002361668.1| Peptidase M23 [Methylocella silvestris BL2]
 gi|217502897|gb|ACK50306.1| Peptidase M23 [Methylocella silvestris BL2]
          Length = 417

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 37/79 (46%), Positives = 52/79 (65%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G++L   GN ILIRH +  V+ Y++     V++G+ V RG TI  SG+SGN   P
Sbjct: 336 VVAYAGSELKGYGNLILIRHPNGFVSAYANNGDIEVKRGETVKRGQTIAKSGQSGNVASP 395

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFELRK A  +DP ++L
Sbjct: 396 QLHFELRKGATPVDPTQYL 414


>gi|220907305|ref|YP_002482616.1| peptidase M23 [Cyanothece sp. PCC 7425]
 gi|219863916|gb|ACL44255.1| Peptidase M23 [Cyanothece sp. PCC 7425]
          Length = 511

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    GN I IRH D  +T+Y+H +    + GQ+V +G  I   G +G +  P
Sbjct: 429 VVVTSGWNSGGFGNLIEIRHPDGSLTLYAHNNRLLARVGQQVEQGQQIAEMGTTGRSTGP 488

Query: 61  QVHFELRKNAI-AMDPIKFLEE 81
            VHFE+    + A++P+ FL  
Sbjct: 489 HVHFEIHPAGMGAVNPMLFLNR 510


>gi|163731366|ref|ZP_02138813.1| peptidase, M23/M37 family, putative [Roseobacter litoralis Och 149]
 gi|161394820|gb|EDQ19142.1| peptidase, M23/M37 family, putative [Roseobacter litoralis Och 149]
          Length = 444

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      G  I I+H+  I T Y+H+    V+ GQ+VSRG  IG  G SG     
Sbjct: 360 VVTEAGWS-SGYGRLIKIQHEFGIETRYAHLSKIRVKVGQRVSRGDHIGDMGASGRVTGV 418

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R    A++P+ F++
Sbjct: 419 HLHYEVRVGGKAVNPMIFIK 438


>gi|110680200|ref|YP_683207.1| M24/M37 family peptidase putative [Roseobacter denitrificans OCh
           114]
 gi|109456316|gb|ABG32521.1| peptidase, M23/M37 family, putative [Roseobacter denitrificans OCh
           114]
          Length = 444

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      G  I I+H+  I T Y+H+    V+ GQ+VSRG  IG  G SG     
Sbjct: 360 VVTEAGWS-SGYGRLIKIQHEFGIETRYAHLSKIRVKVGQRVSRGDHIGDMGASGRVTGV 418

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R    A++P+ F++
Sbjct: 419 HLHYEVRVGGKAVNPMIFIK 438


>gi|284929623|ref|YP_003422145.1| metalloendopeptidase-like membrane protein [cyanobacterium UCYN-A]
 gi|284810067|gb|ADB95764.1| metalloendopeptidase-like membrane protein [cyanobacterium UCYN-A]
          Length = 470

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN + IRH D  +++Y+H     V++GQKV++G  I   G +G +  P 
Sbjct: 388 VISAGWSSGGYGNLLRIRHPDGSISLYAHNSRILVRRGQKVNQGQKIAEMGSTGYSTGPH 447

Query: 62  VHFELRKNAI-AMDPIKFLEE 81
           +H+E+      A +P+ FL +
Sbjct: 448 LHYEIHLRGRGAQNPMAFLPK 468


>gi|255523971|ref|ZP_05390933.1| Peptidase M23 [Clostridium carboxidivorans P7]
 gi|255512258|gb|EET88536.1| Peptidase M23 [Clostridium carboxidivorans P7]
          Length = 254

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 38/70 (54%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
             GN I I H + + TVY+H        G+ V RG  IG  G +G +  P VHFE+R N 
Sbjct: 185 GYGNVIKIDHGNGMQTVYAHCSKICSNVGEYVKRGQKIGEVGSTGRSTGPHVHFEVRVNG 244

Query: 71  IAMDPIKFLE 80
              +P+K+L+
Sbjct: 245 KPENPLKYLQ 254


>gi|30248951|ref|NP_841021.1| LysM motif-containing protein [Nitrosomonas europaea ATCC 19718]
 gi|30138568|emb|CAD84859.1| LysM motif:Peptidase family M23/M37 [Nitrosomonas europaea ATCC
           19718]
          Length = 324

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+I+H+DS ++ Y H    +V +G  VS+G  I   G +      +
Sbjct: 245 VVYSGSGLRGYGNLIIIKHNDSYLSAYGHNSKIFVHEGDSVSKGQKIAEMGNTDG-GVVK 303

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+ +L  +
Sbjct: 304 LHFEIREKGKPVDPLGYLPTR 324


>gi|284047558|ref|YP_003397897.1| Peptidase M23 [Acidaminococcus fermentans DSM 20731]
 gi|283951779|gb|ADB46582.1| Peptidase M23 [Acidaminococcus fermentans DSM 20731]
          Length = 318

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 29/77 (37%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V     +    G  + I H + I T Y H+    VQ GQ V RG  IG +G SG +  P 
Sbjct: 238 VEEAQWN-GGYGRFVSIDHGNGITTCYGHMSAIAVQPGQTVRRGDVIGYAGSSGYSTGPH 296

Query: 62  VHFELRKNAIAMDPIKF 78
           VHFE+R+N   ++P+ F
Sbjct: 297 VHFEVRQNGSPVNPLNF 313


>gi|167918656|ref|ZP_02505747.1| lipoprotein NlpD, putative [Burkholderia pseudomallei BCC215]
          Length = 177

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 98  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 156

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 157 LHFEVRRQGKPVDPLKYLP 175


>gi|330817176|ref|YP_004360881.1| Peptidoglycan-binding LysM [Burkholderia gladioli BSR3]
 gi|327369569|gb|AEA60925.1| Peptidoglycan-binding LysM [Burkholderia gladioli BSR3]
          Length = 310

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 231 VVYAGNGLRGYGNLIIVKHDATYLTAYAHNRALMVKEGDSVTKGQKIAEMGNS-DSDRVM 289

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 290 LHFEVRRQGKPVDPLKYLP 308


>gi|253583335|ref|ZP_04860533.1| membrane protein [Fusobacterium varium ATCC 27725]
 gi|251833907|gb|EES62470.1| membrane protein [Fusobacterium varium ATCC 27725]
          Length = 359

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  +   G  I+I+H +   T Y+H+D   V+ GQ V++G  IG +G SG    P 
Sbjct: 280 VSYAGY-MNGYGKIIIIKHSNGYETRYAHLDKIGVKVGQNVNKGELIGKTGMSGRVTGPH 338

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN    +P+  L  K
Sbjct: 339 LHFEVRKNGKTENPMSHLTRK 359


>gi|78046394|ref|YP_362569.1| membrane-bound metalloendopeptidase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78034824|emb|CAJ22469.1| membrane-bound metalloendopeptidase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 313

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  VT Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 224 VVSYAG-VRGGYGNVVEVDHGNGYVTRYAHNSRLVVKVGDLVRAGQQVARAGSSGRSTGA 282

Query: 61  QVHFELRKNAIAMDPIKFLEEKIP 84
            VHFE+  +   ++P KFL E  P
Sbjct: 283 HVHFEVWADGRVVNPRKFLGEATP 306


>gi|187479341|ref|YP_787366.1| exported peptidase [Bordetella avium 197N]
 gi|115423928|emb|CAJ50480.1| putative exported peptidase [Bordetella avium 197N]
          Length = 327

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+         GN + I H + ++T Y+H     V+ G  V RG  +   G SG +  P
Sbjct: 225 VVLLA-KAQPGYGNMVEIDHGNGLITRYAHASRLLVKAGDVVERGQEVARVGSSGRSTGP 283

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R     +DP  FL
Sbjct: 284 HLHFEVRLAGQPLDPRLFL 302


>gi|308048569|ref|YP_003912135.1| peptidase M23 [Ferrimonas balearica DSM 9799]
 gi|307630759|gb|ADN75061.1| Peptidase M23 [Ferrimonas balearica DSM 9799]
          Length = 304

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+I+H D  ++ Y+H     V++ Q+VS G  I   G S +A  P 
Sbjct: 225 VVYAGSALRGYGQLIIIKHSDEYLSAYAHNSRILVKEKQRVSAGQKIAEVGSS-DADRPM 283

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  +
Sbjct: 284 LHFEIRYKGKSVDPQRYLPRQ 304


>gi|260459794|ref|ZP_05808048.1| Peptidase M23 [Mesorhizobium opportunistum WSM2075]
 gi|259034596|gb|EEW35853.1| Peptidase M23 [Mesorhizobium opportunistum WSM2075]
          Length = 490

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 57/80 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E GNT+L+RH++ +VTVY H  +  VQ+GQKV RG  I LSG SG    P
Sbjct: 411 VVIYAGDGLKEFGNTVLVRHENGLVTVYGHASSIEVQRGQKVKRGQEIALSGMSGTTDSP 470

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  +DP  +LE
Sbjct: 471 KLHFEVRKNSAPVDPSTYLE 490


>gi|225375826|ref|ZP_03753047.1| hypothetical protein ROSEINA2194_01458 [Roseburia inulinivorans DSM
           16841]
 gi|225212261|gb|EEG94615.1| hypothetical protein ROSEINA2194_01458 [Roseburia inulinivorans DSM
           16841]
          Length = 518

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      GN ++I H D  +T Y+H     V  GQ V +G +I LSG +G +  P 
Sbjct: 440 VVSAGYS-KGYGNNVVISHPDGRMTRYAHNSKLLVSAGQWVEQGQSIALSGSTGRSTGPH 498

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           VHFE+  N +A++P+ ++ +
Sbjct: 499 VHFEIYINGVAVNPLNYIGQ 518


>gi|289641102|ref|ZP_06473270.1| Peptidase M23 [Frankia symbiont of Datisca glomerata]
 gi|289509043|gb|EFD29974.1| Peptidase M23 [Frankia symbiont of Datisca glomerata]
          Length = 229

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 4/83 (4%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G +    GN + +RH +++VT Y+H+    V+ GQ+V+ G  +GL G +G +  P 
Sbjct: 143 VIYAGWE-SGYGNFVQVRHANNVVTCYAHLSRISVRVGQQVATGQQVGLEGSTGFSTGPH 201

Query: 62  VHFELR---KNAIAMDPIKFLEE 81
           +HFE+R   +N   +DP+ +L +
Sbjct: 202 LHFEVRLGGQNGTKVDPLAWLAK 224


>gi|289669629|ref|ZP_06490704.1| lipoprotein [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 257

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 177 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 235

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 236 MLHFEIRYNGKPVDPLLYLPKK 257


>gi|297543579|ref|YP_003675881.1| peptidase M23 [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
 gi|296841354|gb|ADH59870.1| Peptidase M23 [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
          Length = 310

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G +    G  + I H  S+ T Y+H+ +  V++ Q V  G  IG  G +G +  P 
Sbjct: 233 VVYAGWND-GYGLVVFIWHSSSLETRYAHLSSIVVKQRQVVRAGDVIGYVGSTGKSTGPH 291

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    A++P+ F  
Sbjct: 292 LHFEVRIGGKAVNPLDFFN 310


>gi|239814805|ref|YP_002943715.1| peptidase M23 [Variovorax paradoxus S110]
 gi|239801382|gb|ACS18449.1| Peptidase M23 [Variovorax paradoxus S110]
          Length = 298

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN I+++H+++ +T Y+H  T  V++ Q V +G  I   G S +A   +
Sbjct: 219 VVYAGAGLRGYGNLIILKHNNTYLTAYAHNQTLLVKEDQSVQKGQKIAEMGNS-DADRVK 277

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 278 LHFEIRRQGKPVDPARYLPSR 298


>gi|33946400|gb|AAQ55815.1| lipoprotein [Pseudomonas syringae]
          Length = 152

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 73  VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKVGQTIAEMGSTG-TDRVK 131

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 132 LHFEIRRQGKPVDPLQFLPRR 152


>gi|37520711|ref|NP_924088.1| hypothetical protein gll1142 [Gloeobacter violaceus PCC 7421]
 gi|35211706|dbj|BAC89083.1| gll1142 [Gloeobacter violaceus PCC 7421]
          Length = 353

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 43/79 (54%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      GN + +RH+D +V+ Y+H+    V+  Q +  G  +G +G +G    P 
Sbjct: 275 VLFAGWMSGGFGNAVDVRHEDGMVSRYAHLSRILVRPDQILEAGQILGATGCTGRCTGPH 334

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H EL     A++P+ FL+
Sbjct: 335 LHLELHVGGRAVNPLPFLK 353


>gi|121607092|ref|YP_994899.1| peptidase M23B [Verminephrobacter eiseniae EF01-2]
 gi|121551732|gb|ABM55881.1| peptidase M23B [Verminephrobacter eiseniae EF01-2]
          Length = 295

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ +   GN I+++H+++ +T Y+H  +  VQ+ Q V +G  I   G + +A   +
Sbjct: 216 VVYAGSAIRGYGNLIILKHNNTFLTAYAHNRSLQVQEEQTVRKGQKIAEMGDT-DADRVK 274

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+N   +DP ++L  +
Sbjct: 275 LHFEIRRNGRPVDPSRYLPAR 295


>gi|326316272|ref|YP_004233944.1| peptidase M23 [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323373108|gb|ADX45377.1| Peptidase M23 [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 299

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN ++++H+++ +T Y+H  T  V++ Q V RG  I   G S +    +
Sbjct: 220 VVYAGAGLRGYGNLVILKHNNTYLTAYAHNQTLLVKEDQSVRRGQKIAEMGSS-DTDRVK 278

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 279 LHFEIRRQGKPVDPARYLPAR 299


>gi|325982715|ref|YP_004295117.1| peptidase M23 [Nitrosomonas sp. AL212]
 gi|325532234|gb|ADZ26955.1| Peptidase M23 [Nitrosomonas sp. AL212]
          Length = 355

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 50/79 (63%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+I+H+++ ++ Y+H     V++G+ V++G  I   G + +    Q
Sbjct: 275 VVYSGHGLRGYGNLIIIKHNNTFLSAYAHNSRLLVKEGEAVAKGQKIAEMGNT-DTDMTQ 333

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+RK+   +DP+++L 
Sbjct: 334 LHFEIRKHGKPVDPLEYLP 352


>gi|153956456|ref|YP_001397221.1| peptidase [Clostridium kluyveri DSM 555]
 gi|219856761|ref|YP_002473883.1| hypothetical protein CKR_3418 [Clostridium kluyveri NBRC 12016]
 gi|146349314|gb|EDK35850.1| Predicted peptidase [Clostridium kluyveri DSM 555]
 gi|219570485|dbj|BAH08469.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 363

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 1   MVIYVGN-DLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQH 59
           +V YV N      G  ++I H D +VT+Y H    YV+ GQ V +G  I   G +G +  
Sbjct: 283 VVSYVKNSGSSGYGYHVVIDHGDGMVTLYGHCSKVYVRSGQTVQQGDVIAAVGSTGRSTG 342

Query: 60  PQVHFELRKNAIAMDPIKFLE 80
             +H E+R     ++P +FL 
Sbjct: 343 NHLHLEVRIGGKKVNPRQFLP 363


>gi|330721573|gb|EGG99603.1| Peptidase2C M23/M37 family [gamma proteobacterium IMCC2047]
          Length = 309

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G +    GN + I H    VT Y H     V+ G  V +G TI L G +G +   
Sbjct: 227 VVTWSG-ERYGYGNLVEINHGGGYVTRYGHSKELLVEVGDVVDKGQTIALMGNTGRSTGA 285

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VHFE+ +    +DP +++  K
Sbjct: 286 HVHFEVLRAGTPVDPKRYINRK 307


>gi|78047317|ref|YP_363492.1| outer membrane lipoprotein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78035747|emb|CAJ23438.1| outer membrane lipoprotein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 259

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 179 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-ASRD 237

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 238 MLHFEIRYNGKPVDPLLYLPKK 259


>gi|89069967|ref|ZP_01157299.1| peptidase, M23/M37 family protein [Oceanicola granulosus HTCC2516]
 gi|89044415|gb|EAR50546.1| peptidase, M23/M37 family protein [Oceanicola granulosus HTCC2516]
          Length = 434

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      G    I+H+  I T Y+H     V+ G++VSRG  IG  G SG +  P
Sbjct: 350 VVTEAGWA-SGYGRLTKIQHEFGIETRYAHQSRIRVRVGERVSRGQHIGDIGNSGRSTGP 408

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R     ++P+ ++ 
Sbjct: 409 HLHYEVRVGGRPVNPMIYIR 428


>gi|160900459|ref|YP_001566041.1| peptidase M23B [Delftia acidovorans SPH-1]
 gi|160366043|gb|ABX37656.1| peptidase M23B [Delftia acidovorans SPH-1]
          Length = 292

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN I+++H+++ +T Y+H  T  V++ Q V +G  I   G + +A   +
Sbjct: 213 VVYAGAGLRGYGNLIILKHNNTYLTAYAHNQTLLVKEDQTVRKGQKIAEMGST-DADRVK 271

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 272 LHFEVRRQGKPVDPSRYLPSR 292


>gi|92114750|ref|YP_574678.1| peptidase M23B [Chromohalobacter salexigens DSM 3043]
 gi|91797840|gb|ABE59979.1| peptidase M23B [Chromohalobacter salexigens DSM 3043]
          Length = 367

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G+ +   GN I+++H+D  ++ Y+H DT  V++   V  G  I   G++ +A   
Sbjct: 287 IVVYAGSGVRGYGNLIILKHNDHFLSAYAHNDTLRVEENDVVDAGDVIATMGET-DADRV 345

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
           ++HFE+R++    DP+++L  +
Sbjct: 346 KLHFEVRQDGQPQDPMEYLPAR 367


>gi|220905421|ref|YP_002480733.1| peptidase M23 [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
 gi|219869720|gb|ACL50055.1| Peptidase M23 [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
          Length = 299

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G+D    G +I I H   I+T Y H+    V  G  V RG  IG  G SG    P 
Sbjct: 221 VIQSGHD-GAYGLSIEINHGGGIITKYGHMQRCAVPAGVWVKRGQVIGYVGMSGRTTGPH 279

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N + ++P++++
Sbjct: 280 LHYEVRLNGVPVNPMRYI 297


>gi|327438191|dbj|BAK14556.1| membrane protein [Solibacillus silvestris StLB046]
          Length = 489

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      GN +++ H +   ++Y+H+    V+ GQ V +G  +G  G +G +   
Sbjct: 411 VVKTAGKHST-YGNYVVVNHKNGFESLYAHLSRIDVEVGQVVEQGSALGQVGSTGRSTGT 469

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+ KN   ++P+ +L 
Sbjct: 470 HLHFEIHKNGTEVNPLSYLN 489


>gi|167769664|ref|ZP_02441717.1| hypothetical protein ANACOL_00998 [Anaerotruncus colihominis DSM
           17241]
 gi|167668025|gb|EDS12155.1| hypothetical protein ANACOL_00998 [Anaerotruncus colihominis DSM
           17241]
          Length = 403

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 39/69 (56%)

Query: 10  VELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN 69
              G  ++I H   I T+Y+H+    V  GQ V++G  IG  G +G +  P +HFE+RK+
Sbjct: 333 YGYGKYVIIDHGGGIQTLYAHMSALSVTVGQTVAQGEKIGEVGSTGWSTGPHIHFEIRKD 392

Query: 70  AIAMDPIKF 78
             A++P  F
Sbjct: 393 GQAINPDSF 401


>gi|226328648|ref|ZP_03804166.1| hypothetical protein PROPEN_02543 [Proteus penneri ATCC 35198]
 gi|225203381|gb|EEG85735.1| hypothetical protein PROPEN_02543 [Proteus penneri ATCC 35198]
          Length = 385

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+D  ++ Y+H DT  V++ Q V+ G  I   G SG +   +
Sbjct: 306 VVYAGSALRGYGNLVIIKHNDEYLSAYAHNDTILVREQQNVNAGQQIATMGSSGTSS-VR 364

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+ +L +K
Sbjct: 365 LHFEIRYKEKSLNPMSYLPKK 385


>gi|75675863|ref|YP_318284.1| peptidase M23B [Nitrobacter winogradskyi Nb-255]
 gi|74420733|gb|ABA04932.1| peptidase M23B [Nitrobacter winogradskyi Nb-255]
          Length = 454

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V          G  + + H + + T Y H+    V+ GQ V  G  +G  G +G +  P 
Sbjct: 369 VTTANW-TGGYGRMVEVDHGNGLSTRYGHLSAINVKVGQSVKAGQAVGEVGSTGRSTGPH 427

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E R +  A+DP KFL 
Sbjct: 428 LHYETRIDGEAVDPQKFLR 446


>gi|307592153|ref|YP_003899744.1| peptidase M23 [Cyanothece sp. PCC 7822]
 gi|306985798|gb|ADN17678.1| Peptidase M23 [Cyanothece sp. PCC 7822]
          Length = 189

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G      GN + ++H D  +T+Y H +   V  GQ V +G  I   G +GN+  P
Sbjct: 97  VVVFAGWSTEGYGNLVTLKHPDGSLTLYGHNEHILVNVGQPVQQGQQISAMGNTGNSSGP 156

Query: 61  QVHFELRKNAI-AMDPIKFLE 80
            +HFE+R     A +P  FL 
Sbjct: 157 HLHFEIRPQGKEAANPRAFLP 177


>gi|45657441|ref|YP_001527.1| membrane peptidase [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|45600680|gb|AAS70164.1| membrane peptidase [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 336

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 49/83 (59%), Gaps = 1/83 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G +    GNT++I HD+   T+Y+H     +++G +V+ G  IG  G++G+A  P
Sbjct: 241 VVSFAGVN-GGYGNTVIIDHDNGYKTMYAHCSKITIEQGTRVNTGTVIGAIGRTGSATGP 299

Query: 61  QVHFELRKNAIAMDPIKFLEEKI 83
            +HFE+  N   ++P   L++ +
Sbjct: 300 HLHFEVFLNGNRVNPDVALKKAL 322


>gi|294828093|ref|NP_712558.2| M23 family metalloendopeptidase [Leptospira interrogans serovar Lai
           str. 56601]
 gi|293385941|gb|AAN49576.2| M23 family metalloendopeptidase [Leptospira interrogans serovar Lai
           str. 56601]
          Length = 334

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 49/83 (59%), Gaps = 1/83 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G +    GNT++I HD+   T+Y+H     +++G +V+ G  IG  G++G+A  P
Sbjct: 239 VVSFAGVN-GGYGNTVIIDHDNGYKTMYAHCSKITIEQGTRVNTGTVIGAIGRTGSATGP 297

Query: 61  QVHFELRKNAIAMDPIKFLEEKI 83
            +HFE+  N   ++P   L++ +
Sbjct: 298 HLHFEVFLNGNRVNPDVALKKAL 320


>gi|120610103|ref|YP_969781.1| peptidase M23B [Acidovorax citrulli AAC00-1]
 gi|120588567|gb|ABM32007.1| peptidase M23B [Acidovorax citrulli AAC00-1]
          Length = 299

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN ++++H+++ +T Y+H  T  V++ Q V RG  I   G S +    +
Sbjct: 220 VVYAGAGLRGYGNLVILKHNNTYLTAYAHNQTLLVKEDQSVRRGQKIAEMGSS-DTDRVK 278

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 279 LHFEIRRQGKPVDPARYLPAR 299


>gi|154248332|ref|YP_001419290.1| peptidase M23B [Xanthobacter autotrophicus Py2]
 gi|154162417|gb|ABS69633.1| peptidase M23B [Xanthobacter autotrophicus Py2]
          Length = 447

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 50/78 (64%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y GN+L   GN +L++H D  VT Y+H     V++G  V RG  I  +G+SGN   PQ
Sbjct: 367 VAYAGNELKGYGNLVLVKHADGYVTAYAHNSELNVKRGDTVRRGQIIAKAGQSGNVNSPQ 426

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RK + A+DP +++
Sbjct: 427 LHFEIRKGSTAVDPSRYV 444


>gi|327480190|gb|AEA83500.1| lipoprotein NlpD [Pseudomonas stutzeri DSM 4166]
          Length = 271

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 192 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 250

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 251 LHFEIRRQGKPVDPLQYLPRR 271


>gi|319940789|ref|ZP_08015128.1| hypothetical protein HMPREF9464_00347 [Sutterella wadsworthensis
           3_1_45B]
 gi|319805671|gb|EFW02452.1| hypothetical protein HMPREF9464_00347 [Sutterella wadsworthensis
           3_1_45B]
          Length = 420

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++    L   GN ++I H  + ++VY++ ++     G KV+ G TI   G SG +  P 
Sbjct: 342 VVFSDW-LRGYGNLLIIDHGGTYMSVYANNESVLKNVGDKVTAGETISTVGTSGASDEPG 400

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           ++FE+R     ++P  +L +
Sbjct: 401 LYFEIRYKGKPINPQPWLAK 420


>gi|319952368|ref|YP_004163635.1| peptidase m23 [Cellulophaga algicola DSM 14237]
 gi|319421028|gb|ADV48137.1| Peptidase M23 [Cellulophaga algicola DSM 14237]
          Length = 325

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V    ++    GN I I H    V++Y+H+    V  G+ V RG  IG  G +G ++ P 
Sbjct: 224 VTRADSNSSGYGNHIRIDHGFGYVSLYAHMSKYNVTAGKTVKRGDLIGFVGSTGRSEAPH 283

Query: 62  VHFELRKNAIAMDPIKF 78
           +H+E+ K+   ++PI F
Sbjct: 284 LHYEVFKDDQRINPINF 300


>gi|257139192|ref|ZP_05587454.1| M23/M37 familypeptidase protein [Burkholderia thailandensis E264]
          Length = 407

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+      +  G  V++G  IG  G +G A 
Sbjct: 262 VVSFVGYDPGGYGKYVVIDHPDRRSTYYAHLSAFAPGLDIGMTVAQGQRIGAVGSTGAAT 321

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 322 GPHLHFEVRVDDQPVDPL 339


>gi|256819843|ref|YP_003141122.1| Peptidase M23 [Capnocytophaga ochracea DSM 7271]
 gi|256581426|gb|ACU92561.1| Peptidase M23 [Capnocytophaga ochracea DSM 7271]
          Length = 324

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 42/78 (53%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V    ++    GN I I H    VT+Y H+    V+ GQ V RG  IG  G +G ++ P
Sbjct: 222 VVARADSNASGYGNHIRIDHGYGYVTLYGHLSAYNVRAGQHVKRGDLIGRVGSTGRSEAP 281

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E+ KN   ++PI F
Sbjct: 282 HLHYEVIKNGEHINPIHF 299


>gi|288572933|ref|ZP_06391290.1| Peptidase M23 [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288568674|gb|EFC90231.1| Peptidase M23 [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 396

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   G  +++ +  +  TVY+H+    + +GQ+VS G  IG  G +G A  P 
Sbjct: 320 VLYAGW-LRGYGQIVILDNGGNFSTVYAHLSRILISEGQRVSDGQPIGNVGDTGVATGPH 378

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N  A DP+K+L
Sbjct: 379 LHFEVRVNGDARDPLKYL 396


>gi|167620107|ref|ZP_02388738.1| Peptidase family M23/M37 [Burkholderia thailandensis Bt4]
          Length = 346

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+      +  G  V++G  IG  G +G A 
Sbjct: 201 VVSFVGYDPGGYGKYVVIDHPDRRSTYYAHLSAFAPGLDIGMTVAQGQRIGAVGSTGAAT 260

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 261 GPHLHFEVRVDDQPVDPL 278


>gi|83719735|ref|YP_442968.1| M23/M37 familypeptidase [Burkholderia thailandensis E264]
 gi|83653560|gb|ABC37623.1| Peptidase family M23/M37 [Burkholderia thailandensis E264]
          Length = 499

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+      +  G  V++G  IG  G +G A 
Sbjct: 354 VVSFVGYDPGGYGKYVVIDHPDRRSTYYAHLSAFAPGLDIGMTVAQGQRIGAVGSTGAAT 413

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 414 GPHLHFEVRVDDQPVDPL 431


>gi|158334675|ref|YP_001515847.1| peptidase [Acaryochloris marina MBIC11017]
 gi|158304916|gb|ABW26533.1| peptidase, putative [Acaryochloris marina MBIC11017]
          Length = 561

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    GN + IRH D  +T+Y+H      + GQ V +G  I   G +G +  P
Sbjct: 479 IVTTAGWNRWGYGNLVEIRHPDGSLTLYAHNHRIKTRVGQSVYQGQQIAEMGSTGLSTGP 538

Query: 61  QVHFELRKNAI-AMDPIKFLEE 81
             HFEL      A++P+ FL +
Sbjct: 539 HTHFELHPAGKGAINPVPFLRK 560


>gi|146299653|ref|YP_001194244.1| peptidase M23B [Flavobacterium johnsoniae UW101]
 gi|146154071|gb|ABQ04925.1| zoocin A; peptidase family M23 [Flavobacterium johnsoniae UW101]
          Length = 325

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V    +     GN ++IRH     ++Y+H+     + GQKV RG  IG  G +G ++ P
Sbjct: 223 VVARADDTASGFGNHVVIRHGFGYESLYAHLSKYNCRPGQKVKRGDVIGYVGSTGRSEGP 282

Query: 61  QVHFELRKNAIAMDPIKF 78
             H+E+ K+   ++P+ F
Sbjct: 283 HCHYEVHKDGKVVNPLNF 300


>gi|298369465|ref|ZP_06980782.1| M23 peptidase domain protein [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298282022|gb|EFI23510.1| M23 peptidase domain protein [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 440

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 2/75 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G      GNT++I+H + + T+Y H+         KVS G  IG  G +G +  P
Sbjct: 325 VVVFKGWK-GGYGNTVMIQHANGVETLYGHMSAFS-PSQGKVSAGEIIGYVGTTGRSTGP 382

Query: 61  QVHFELRKNAIAMDP 75
            +H+E R N   ++P
Sbjct: 383 HLHYEARVNGQPVNP 397


>gi|329890378|ref|ZP_08268721.1| peptidase family M23 family protein [Brevundimonas diminuta ATCC
           11568]
 gi|328845679|gb|EGF95243.1| peptidase family M23 family protein [Brevundimonas diminuta ATCC
           11568]
          Length = 197

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 43/76 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      GN I ++H + + ++Y+H+    V  G+ V+ G  IGL G +G +  P 
Sbjct: 108 VLRAGYQAGGYGNFIELQHPNGMTSLYAHLSRIDVHSGKTVTAGERIGLVGSTGYSTGPH 167

Query: 62  VHFELRKNAIAMDPIK 77
           +HFE+R+N   +DP K
Sbjct: 168 LHFEVRRNGGQVDPAK 183


>gi|188586729|ref|YP_001918274.1| Peptidase M23 [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179351416|gb|ACB85686.1| Peptidase M23 [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 323

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      GN I+I H     T Y+H     V  GQ V +G  IG  G SGNA    
Sbjct: 247 VTFSGWR-GSYGNLIIIEHPGDYETYYAHNAGHTVSVGQSVEKGEVIGHVGNSGNATGSH 305

Query: 62  VHFELRKNAIAMDPIKF 78
           +HFE+R+N   ++P+ +
Sbjct: 306 LHFEIRRNGEHVNPLDY 322


>gi|21241557|ref|NP_641139.1| peptidase [Xanthomonas axonopodis pv. citri str. 306]
 gi|21106909|gb|AAM35675.1| peptidase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 313

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  VT Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 224 VVSYAG-VRGGYGNVVEVDHGNGYVTRYAHNSRLVVKVGDLVRAGQQVARAGSSGRSTGA 282

Query: 61  QVHFELRKNAIAMDPIKFLEEKIP 84
            VHFE+  +   ++P KFL E  P
Sbjct: 283 HVHFEVWADGRVVNPRKFLGETTP 306


>gi|119898457|ref|YP_933670.1| peptidase [Azoarcus sp. BH72]
 gi|119670870|emb|CAL94783.1| peptidase [Azoarcus sp. BH72]
          Length = 314

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G    E G T+ I H + +VT Y+H    +V+ G+ V+ G  I   G +G +  P 
Sbjct: 235 VVYAG-IRPEYGYTVEIDHGNGLVTRYAHCSRLWVKVGEVVTPGRRIAAVGSTGRSTGPH 293

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+ K+    DP  +L
Sbjct: 294 LHFEVLKDGRYSDPALYL 311


>gi|226953391|ref|ZP_03823855.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
 gi|226835868|gb|EEH68251.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
          Length = 246

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      G  + I H +  VT Y+H     V  G++V  G  I   G +G    P
Sbjct: 165 VVTKSGWGT-GYGQYVEIDHGNGYVTRYAHASRLMVNAGERVGAGQHIANVGCTGRCTGP 223

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+ K+    +P  +L
Sbjct: 224 HLHFEVVKDGQRRNPSTYL 242


>gi|302390227|ref|YP_003826048.1| Peptidase M23 [Thermosediminibacter oceani DSM 16646]
 gi|302200855|gb|ADL08425.1| Peptidase M23 [Thermosediminibacter oceani DSM 16646]
          Length = 382

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 42/67 (62%)

Query: 14  NTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAM 73
           NT+++ H   I T+Y+H+    V  G+KV RG  +GL G +G +  P +HFE+RKN   +
Sbjct: 316 NTVIVDHGGGISTLYAHLSKILVSDGEKVKRGDRVGLVGSTGYSTGPHLHFEVRKNGQHV 375

Query: 74  DPIKFLE 80
           +P  +L+
Sbjct: 376 NPWNWLK 382


>gi|163759443|ref|ZP_02166528.1| lipoprotein precursor protein [Hoeflea phototrophica DFL-43]
 gi|162283040|gb|EDQ33326.1| lipoprotein precursor protein [Hoeflea phototrophica DFL-43]
          Length = 635

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 41/80 (51%), Positives = 60/80 (75%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E G T+L+RHDD +VTVY+H +  +V++G KV+RG  I  SG +G A+ P
Sbjct: 556 VVIYSGDGLKEYGKTVLVRHDDGLVTVYAHANDLHVKRGDKVARGQVIASSGMTGVAKTP 615

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKNA  +DP+ +LE
Sbjct: 616 RLHFEVRKNASPVDPMGYLE 635


>gi|261492213|ref|ZP_05988779.1| M23B subfamily peptidase/lipoprotein [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261495100|ref|ZP_05991565.1| M23B subfamily peptidase/lipoprotein [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261309235|gb|EEY10473.1| M23B subfamily peptidase/lipoprotein [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261312133|gb|EEY13270.1| M23B subfamily peptidase/lipoprotein [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 426

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H D  ++ Y+H +T  V + + V  G  I   G +G     +
Sbjct: 347 VVYAGNALQGYGNLIIIKHTDDFLSAYAHNNTIEVDEQETVKAGQKIATLGSTGTNT-NK 405

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 406 LHFEIRYKGKSVDPARYLPRK 426


>gi|254362197|ref|ZP_04978312.1| M23B subfamily peptidase/lipoprotein [Mannheimia haemolytica
           PHL213]
 gi|153093769|gb|EDN74708.1| M23B subfamily peptidase/lipoprotein [Mannheimia haemolytica
           PHL213]
          Length = 426

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H D  ++ Y+H +T  V + + V  G  I   G +G     +
Sbjct: 347 VVYAGNALQGYGNLIIIKHTDDFLSAYAHNNTIEVDEQETVKAGQKIATLGSTGTNT-NK 405

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  K
Sbjct: 406 LHFEIRYKGKSVDPARYLPRK 426


>gi|167581945|ref|ZP_02374819.1| Peptidase family M23/M37 [Burkholderia thailandensis TXDOH]
          Length = 407

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+      +  G  V++G  IG  G +G A 
Sbjct: 262 VVSFVGYDPGGYGKYVVIDHPDRRSTYYAHLSAFAPGLDVGMTVAQGQRIGAVGSTGAAT 321

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 322 GPHLHFEVRVDDQPVDPL 339


>gi|308048076|ref|YP_003911642.1| peptidase M23 [Ferrimonas balearica DSM 9799]
 gi|307630266|gb|ADN74568.1| Peptidase M23 [Ferrimonas balearica DSM 9799]
          Length = 301

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  +   GN + I H + + T Y H     V+ GQ V++G T+ L G +G +  P
Sbjct: 218 VVSYSGT-MFGYGNLVEIDHGNGVKTRYGHNKENLVELGQVVAKGETVALIGNTGRSTGP 276

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VH+E+  N   +DP +++  K
Sbjct: 277 HVHYEVMLNDQQVDPARYVYRK 298


>gi|217966489|ref|YP_002351995.1| peptidase M23 [Dictyoglomus turgidum DSM 6724]
 gi|217335588|gb|ACK41381.1| Peptidase M23 [Dictyoglomus turgidum DSM 6724]
          Length = 305

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V +VG +    G  I I H   I+T Y+H+ +  V+ GQ V +G  IG  G +G +  P
Sbjct: 217 IVSFVGWE-SGYGKVIKINHGRGIITYYAHLSSYAVRVGQFVKKGQFIGRVGSTGTSIGP 275

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R+    ++P  +L
Sbjct: 276 HLHYEVRRGGSPVNPSAYL 294


>gi|194364388|ref|YP_002026998.1| peptidase M23 [Stenotrophomonas maltophilia R551-3]
 gi|194347192|gb|ACF50315.1| Peptidase M23 [Stenotrophomonas maltophilia R551-3]
          Length = 318

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + + H +  VT Y+H     V+ G  V  G  +  +G +G +   
Sbjct: 227 VVSFSG-VKGGYGNVVDVDHGNGYVTRYAHNSRLVVKVGDLVRAGQEVAKAGSTGRSTGA 285

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+ +N   ++P KFL
Sbjct: 286 HVHFEVWENGNVVNPRKFL 304


>gi|262195096|ref|YP_003266305.1| peptidase M23 [Haliangium ochraceum DSM 14365]
 gi|262078443|gb|ACY14412.1| Peptidase M23 [Haliangium ochraceum DSM 14365]
          Length = 293

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 41/83 (49%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+     +   G  + I H D + T Y+H+    V++G  V  G  +G  G SG A  P 
Sbjct: 203 VVRSARRMRGYGRVVYIDHGDGVETRYAHLQRITVREGDTVRPGERVGTVGSSGRATGPH 262

Query: 62  VHFELRKNAIAMDPIKFLEEKIP 84
           +HFELR +  A +P + +   +P
Sbjct: 263 LHFELRIDKQAYNPAQVIGPLMP 285


>gi|24415300|gb|AAN59885.1| lipoprotein [Pseudomonas syringae pv. aptata]
          Length = 95

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2  VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
          V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 16 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 74

Query: 62 VHFELRKNAIAMDPIKFLEEK 82
          +HFE+R+    +DP+ FL  +
Sbjct: 75 LHFEIRRQGKPVDPLGFLPRR 95


>gi|260061768|ref|YP_003194848.1| putative peptidase [Robiginitalea biformata HTCC2501]
 gi|88785900|gb|EAR17069.1| putative peptidase [Robiginitalea biformata HTCC2501]
          Length = 325

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V    N+    G  I I H    +++Y+H+    V++GQ+V RG  IG  G +G ++ P 
Sbjct: 224 VSRADNNASGYGKHIRIDHGYGYMSLYAHLSKYNVRRGQQVKRGDLIGFVGSTGRSEAPH 283

Query: 62  VHFELRKNAIAMDPIKF 78
           +H+E+ K+   ++PI F
Sbjct: 284 LHYEVWKDGDRINPINF 300


>gi|163791250|ref|ZP_02185665.1| peptidase, M48 family protein [Carnobacterium sp. AT7]
 gi|159873454|gb|EDP67543.1| peptidase, M48 family protein [Carnobacterium sp. AT7]
          Length = 442

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 3/80 (3%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTP--YVQKGQKVSRGHTIGLSGKSGNAQH 59
           V++ G      G  + I H + + T+Y+H+      V  GQ VS+G  IG  G +G++  
Sbjct: 364 VVFAGYH-SSWGYYVKIDHGNGLQTLYAHMVAGSLLVSPGQHVSQGQQIGTMGTTGSSTG 422

Query: 60  PQVHFELRKNAIAMDPIKFL 79
             +HFE+  N   +DP  +L
Sbjct: 423 VHLHFEVYVNGSRVDPANYL 442


>gi|75909402|ref|YP_323698.1| peptidoglycan-binding protein LysM [Anabaena variabilis ATCC 29413]
 gi|75703127|gb|ABA22803.1| Peptidoglycan-binding LysM [Anabaena variabilis ATCC 29413]
          Length = 754

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 42/81 (51%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    GN + IRH D  +T Y+H     VQ GQ+V +G  I   G +G +  P
Sbjct: 667 VVEKSGWNKGGYGNLVDIRHPDGSLTRYAHNSRLLVQAGQQVRQGQQIAAMGSTGFSTGP 726

Query: 61  QVHFELRKNAI-AMDPIKFLE 80
             HFE+ K+   A++PI  L 
Sbjct: 727 HTHFEIHKSGKGAINPIAMLP 747


>gi|146281945|ref|YP_001172098.1| lipoprotein NlpD [Pseudomonas stutzeri A1501]
 gi|145570150|gb|ABP79256.1| lipoprotein NlpD [Pseudomonas stutzeri A1501]
          Length = 271

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H D+ V+ Y H     V++GQ+V  G +I   G +G     +
Sbjct: 192 VVYAGSGLRGYGELVIIKHSDTYVSAYGHNRRLLVREGQQVKAGQSIAEMGSTG-TDRVK 250

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 251 LHFEIRRQGKPVDPLQYLPRR 271


>gi|323493641|ref|ZP_08098762.1| membrane protein [Vibrio brasiliensis LMG 20546]
 gi|323312164|gb|EGA65307.1| membrane protein [Vibrio brasiliensis LMG 20546]
          Length = 303

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+D+ ++ Y+H D   V +GQ V  G  I   G SG +   +
Sbjct: 226 VVYSGNALRGYGNLVIIKHNDNYLSAYAHNDRLLVHEGQSVKAGQKIATMGSSGASS-VR 284

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    +++P ++L 
Sbjct: 285 LHFEIRYQGKSVNPKRYLP 303


>gi|325924515|ref|ZP_08186034.1| metalloendopeptidase-like membrane protein [Xanthomonas gardneri
           ATCC 19865]
 gi|325545010|gb|EGD16345.1| metalloendopeptidase-like membrane protein [Xanthomonas gardneri
           ATCC 19865]
          Length = 257

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 177 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-AARD 235

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 236 MLHFEIRYNGKPVDPLLYLPKK 257


>gi|312883941|ref|ZP_07743658.1| hypothetical protein VIBC2010_01623 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368399|gb|EFP95934.1| hypothetical protein VIBC2010_01623 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 304

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+D+ ++ Y+H D   V +GQ V  G  I   G SG +   +
Sbjct: 227 VVYSGNALRGYGNLVIIKHNDNYLSAYAHNDRLLVHEGQSVKAGQKIATMGSSGTSS-VR 285

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    +++P ++L 
Sbjct: 286 LHFEIRYQGKSVNPKRYLP 304


>gi|169830176|ref|YP_001700334.1| metalloprotease yebA [Lysinibacillus sphaericus C3-41]
 gi|168994664|gb|ACA42204.1| Hypothetical metalloprotease yebA precursor [Lysinibacillus
           sphaericus C3-41]
          Length = 493

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      GN I+I H++   T+Y H+ +  V+ GQ V +G  IG+ G +GN+   
Sbjct: 414 VVSAAGTS-GTYGNRIVINHNNGYTTLYGHLSSINVEVGQVVEKGSVIGIMGSTGNSTGT 472

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +HFE+ KN   ++P+ ++  
Sbjct: 473 HLHFEVEKNGSLVNPLSYVGR 493


>gi|33601994|ref|NP_889554.1| putative peptidase [Bordetella bronchiseptica RB50]
 gi|33576432|emb|CAE33510.1| putative peptidase [Bordetella bronchiseptica RB50]
          Length = 292

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +  LGN I+I H +  +T Y+H     V+ GQ V RG  I   G++ +   P+
Sbjct: 213 VMYSGNGVRGLGNLIIINHQNGFITAYAHNRALLVKTGQNVKRGAKIAEIGET-DTTSPR 271

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 272 LHFEIRRQGTPVDPMQYLPPR 292


>gi|33592792|ref|NP_880436.1| putative peptidase [Bordetella pertussis Tohama I]
 gi|33572440|emb|CAE42008.1| putative peptidase [Bordetella pertussis Tohama I]
 gi|332382205|gb|AEE67052.1| putative peptidase [Bordetella pertussis CS]
          Length = 294

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +  LGN I+I H +  +T Y+H     V+ GQ V RG  I   G++ +   P+
Sbjct: 215 VMYSGNGVRGLGNLIIINHQNGFITAYAHNRALLVKTGQNVKRGAKIAEIGET-DTTSPR 273

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 274 LHFEIRRQGTPVDPMQYLPPR 294


>gi|33597591|ref|NP_885234.1| putative peptidase [Bordetella parapertussis 12822]
 gi|33574019|emb|CAE38342.1| putative peptidase [Bordetella parapertussis]
          Length = 294

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +  LGN I+I H +  +T Y+H     V+ GQ V RG  I   G++ +   P+
Sbjct: 215 VMYSGNGVRGLGNLIIINHQNGFITAYAHNRALLVKTGQNVKRGAKIAEIGET-DTTSPR 273

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 274 LHFEIRRQGTPVDPMQYLPPR 294


>gi|301628965|ref|XP_002943617.1| PREDICTED: uncharacterized metalloprotease yebA-like [Xenopus
           (Silurana) tropicalis]
          Length = 457

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + ++H +   TVY+H+    V KGQ V++G  +G  G +G A  P
Sbjct: 340 VVEFAGVQN-GYGNVVFVKHGNGHETVYAHLSRMDVHKGQSVAQGDILGAVGATGWATGP 398

Query: 61  QVHFELRKNAIAMDPIK 77
            +HFE R      DP+ 
Sbjct: 399 HLHFEFRVKGQQQDPMT 415


>gi|254429745|ref|ZP_05043452.1| M23 peptidase domain protein [Alcanivorax sp. DG881]
 gi|196195914|gb|EDX90873.1| M23 peptidase domain protein [Alcanivorax sp. DG881]
          Length = 310

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G +    G  + I H + + T Y H     V+ G+ V  G  +G  G SG +  P
Sbjct: 228 VVTYSG-ERSGYGKMVEINHGNGLSTRYGHAKELLVEPGEIVRTGDVVGKVGSSGRSTGP 286

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VH+E+ KN   ++P  ++
Sbjct: 287 HVHYEVLKNGAQVNPQPYI 305


>gi|126726326|ref|ZP_01742167.1| peptidase, M23/M37 family protein [Rhodobacterales bacterium
           HTCC2150]
 gi|126704189|gb|EBA03281.1| peptidase, M23/M37 family protein [Rhodobacterales bacterium
           HTCC2150]
          Length = 446

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V +        G  I I+H+  I T Y+H+    V+ GQ+VSRG  IG  G SG +   
Sbjct: 362 VVSHAAWS-SGYGRLIKIKHEFGIETRYAHLLRLRVKPGQRVSRGERIGDMGNSGRSTGT 420

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R    A++P+ +++
Sbjct: 421 HLHYEIRIGGNAVNPMTYIK 440


>gi|315225243|ref|ZP_07867060.1| peptidase, family M23 [Capnocytophaga ochracea F0287]
 gi|314944926|gb|EFS96958.1| peptidase, family M23 [Capnocytophaga ochracea F0287]
          Length = 357

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 42/78 (53%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V    ++    GN I I H    VT+Y H+    V+ GQ V RG  IG  G +G ++ P
Sbjct: 255 VVARADSNASGYGNHIRIDHGYGYVTLYGHLSAYNVRAGQHVKRGDLIGRVGSTGRSEAP 314

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E+ KN   ++PI F
Sbjct: 315 HLHYEVIKNGEHINPIHF 332


>gi|260773543|ref|ZP_05882459.1| lipoprotein NlpD [Vibrio metschnikovii CIP 69.14]
 gi|260612682|gb|EEX37885.1| lipoprotein NlpD [Vibrio metschnikovii CIP 69.14]
          Length = 322

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D   VQ+GQ V+ G  I   G SG     +
Sbjct: 245 VVYSGNALRGYGNLIIIKHNDDYLSAYAHNDQLLVQEGQNVTAGQKIATMGSSG-TTSVR 303

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R     ++P ++L 
Sbjct: 304 LHFEIRYQGKPVNPQRYLP 322


>gi|109900162|ref|YP_663417.1| peptidase M23B [Pseudoalteromonas atlantica T6c]
 gi|109702443|gb|ABG42363.1| peptidase M23B [Pseudoalteromonas atlantica T6c]
          Length = 272

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++++H DS ++ Y+H D+  V++ Q V  G  I   GKSG +   +
Sbjct: 193 VVYTGDALRGYGKLVIVKHSDSFLSAYAHNDSILVKEQQWVRAGQKIATMGKSG-SDTVK 251

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP+++L ++
Sbjct: 252 LHFEVRYKGQSIDPLRYLPKR 272


>gi|188587495|ref|YP_001919040.1| Peptidase M23 [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179352182|gb|ACB86452.1| Peptidase M23 [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 468

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      GN I+I H     T Y+H    +VQ+GQ+V+RG  IGL G +G +    
Sbjct: 389 VTFSGYK-GGYGNLIVIEHSGGYETYYAHNSENHVQEGQQVNRGDVIGLVGSTGRSTGAH 447

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+ ++    +P+ + 
Sbjct: 448 LHFEIHRHGSHTNPLNYF 465


>gi|114562237|ref|YP_749750.1| peptidase M23B [Shewanella frigidimarina NCIMB 400]
 gi|114333530|gb|ABI70912.1| peptidase M23B [Shewanella frigidimarina NCIMB 400]
          Length = 309

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+D  ++ Y+H DT  V++ Q VS G T+   G +G      
Sbjct: 230 VVYAGNALRGYGNLVIIKHNDDFLSAYAHADTILVKEKQYVSAGQTVAKMGSTG-THQVM 288

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +  +++P+++L ++
Sbjct: 289 LHFEVRFHGKSVNPLRYLPKQ 309


>gi|309390085|gb|ADO77965.1| Peptidase M23 [Halanaerobium praevalens DSM 2228]
          Length = 328

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VG      G  ++I H     T+Y H++   V+KG  V RG TI L+G SG +  P 
Sbjct: 249 VTHVGWK-GGYGRAVIIDHGQGYKTLYGHLNGYKVKKGDYVKRGDTIALTGNSGRSTGPH 307

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +H+E+  N+   +P+ ++  +
Sbjct: 308 LHYEVLVNSKPKNPLDYIGGR 328


>gi|116622668|ref|YP_824824.1| peptidase M23B [Candidatus Solibacter usitatus Ellin6076]
 gi|116225830|gb|ABJ84539.1| peptidase M23B [Candidatus Solibacter usitatus Ellin6076]
          Length = 300

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 41/79 (51%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI         G  +++ H + + T Y+H+    V  GQ+V RG  +GL G SG    P
Sbjct: 206 VVIQAEMVAGGYGRLVIVDHGNGVQTYYAHLSKISVHAGQEVRRGEIVGLVGSSGRTTAP 265

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R     M+P ++L
Sbjct: 266 HLHYEVRVGGTPMNPSRYL 284


>gi|221212963|ref|ZP_03585939.1| peptidase M23B [Burkholderia multivorans CGD1]
 gi|221167176|gb|EED99646.1| peptidase M23B [Burkholderia multivorans CGD1]
          Length = 412

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G+ +++ H D   T Y+H+      ++ G+ V +G  IG  G +G A 
Sbjct: 267 VVSFVGTDPGGYGHYVIVDHADGYSTYYAHLSAFARGLKVGEVVKQGQRIGSVGMTGAAT 326

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 327 GPHLHFEVRVANEPVDPL 344


>gi|161524791|ref|YP_001579803.1| peptidase M23B [Burkholderia multivorans ATCC 17616]
 gi|160342220|gb|ABX15306.1| peptidase M23B [Burkholderia multivorans ATCC 17616]
          Length = 412

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G+ +++ H D   T Y+H+      ++ G+ V +G  IG  G +G A 
Sbjct: 267 VVSFVGTDPGGYGHYVIVDHADGYSTYYAHLSAFARGLKVGEVVKQGQRIGSVGMTGAAT 326

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 327 GPHLHFEVRVANEPVDPL 344


>gi|83311617|ref|YP_421881.1| membrane protein related to metalloendopeptidase [Magnetospirillum
           magneticum AMB-1]
 gi|82946458|dbj|BAE51322.1| Membrane protein related to metalloendopeptidase [Magnetospirillum
           magneticum AMB-1]
          Length = 363

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/83 (43%), Positives = 58/83 (69%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V YVGN+L   GN +LI+H D+ +T Y+H D   V++G +V RG TI   G SG+   P
Sbjct: 267 VVAYVGNELKGFGNLLLIKHADNWMTAYAHNDQLMVKRGDRVRRGQTIATLGASGSVTSP 326

Query: 61  QVHFELRKNAIAMDPIKFLEEKI 83
           Q+HFE+R+   A++P+++L++K+
Sbjct: 327 QLHFEIRRGTEAVNPVEYLQDKV 349


>gi|326386218|ref|ZP_08207842.1| peptidase M23B [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209443|gb|EGD60236.1| peptidase M23B [Novosphingobium nitrogenifigens DSM 19370]
          Length = 410

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      GN + I H   +VT Y+H+       GQ+V  G  IG  G +G +  P 
Sbjct: 307 VSFTG-VRQGYGNCVEITHGAGLVTRYAHMSRILAHMGQQVVAGTQIGAIGSTGRSTGPH 365

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N   ++P  FLE
Sbjct: 366 LHFEVRINDRPVNPRPFLE 384


>gi|77457358|ref|YP_346863.1| peptidase M23B [Pseudomonas fluorescens Pf0-1]
 gi|77381361|gb|ABA72874.1| putative lipoprotein [Pseudomonas fluorescens Pf0-1]
          Length = 293

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++I+H ++ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 214 VVYAGSGLRGYGELVIIKHSETYVSAYGHNRRLLVREGQQVKVGQTIAEMGSTG-TDRVK 272

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP++FL  +
Sbjct: 273 LHFEIRRQGKPVDPLQFLPRR 293


>gi|323144153|ref|ZP_08078789.1| peptidase, M23 family [Succinatimonas hippei YIT 12066]
 gi|322416061|gb|EFY06759.1| peptidase, M23 family [Succinatimonas hippei YIT 12066]
          Length = 410

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I HD+  ++ Y+H D   V++GQKV RG  I   G + +A    
Sbjct: 332 VVYAGNALRGYGNLVIINHDNEFLSAYAHNDVLLVKEGQKVKRGQQIAKMGST-DASSVG 390

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    +++PIK+L +
Sbjct: 391 LHFEIRYRGQSVNPIKYLPK 410


>gi|124023168|ref|YP_001017475.1| LysM motif-containing protein [Prochlorococcus marinus str. MIT
           9303]
 gi|123963454|gb|ABM78210.1| LysM motif:Peptidase family M23/M37 [Prochlorococcus marinus str.
           MIT 9303]
          Length = 360

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 42/84 (50%), Gaps = 2/84 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      G  + I H +   T Y+H +   V+KGQ V +G  I   G +G +  P
Sbjct: 257 IVSYAGWK-GAYGYLVEIAHANGDSTRYAHNNRLLVKKGQIVPQGAKIATMGSTGRSTGP 315

Query: 61  QVHFELRKN-AIAMDPIKFLEEKI 83
            +HFE+RK    A++P   L  KI
Sbjct: 316 HLHFEIRKKSGTAINPANLLPSKI 339


>gi|285017204|ref|YP_003374915.1| peptidase [Xanthomonas albilineans GPE PC73]
 gi|283472422|emb|CBA14927.1| putative peptidase protein [Xanthomonas albilineans]
          Length = 404

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++    +   G  +++ H +  +++Y+H DT     G +V RG  +   G SG    P 
Sbjct: 325 VVFSEW-MTGYGMILIVDHGNGYMSLYAHNDTLLRDAGDRVKRGDPVAKVGNSGGQGRPA 383

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           ++FELR N   +DP  +L+ +
Sbjct: 384 LYFELRHNGQPVDPASWLQRR 404


>gi|126651968|ref|ZP_01724160.1| Membrane protein [Bacillus sp. B14905]
 gi|126591237|gb|EAZ85346.1| Membrane protein [Bacillus sp. B14905]
          Length = 508

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      GN I+I H++   T+Y H+ +  V+ GQ V +G  IG+ G +GN+   
Sbjct: 429 VVSAAGTS-GTYGNRIVINHNNGYTTLYGHLSSINVEVGQVVEKGSVIGIMGSTGNSTGT 487

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +HFE+ KN   ++P+ ++  
Sbjct: 488 HLHFEVEKNGSLVNPLSYVGR 508


>gi|313157671|gb|EFR57082.1| peptidase, M23 family [Alistipes sp. HGB5]
          Length = 356

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 41/81 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V     +    GN ++IRHD+ + T Y H+    V+  Q V  G  IGL G +G +  P 
Sbjct: 184 VRISEYNKGGYGNLVIIRHDNGLETYYGHLSERMVEPNQWVEAGQIIGLGGSTGRSTGPH 243

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE R    + DP + ++ K
Sbjct: 244 LHFETRYYGQSFDPERLIDFK 264


>gi|260655325|ref|ZP_05860813.1| M23/M37, cell wall endopeptidase family [Jonquetella anthropi E3_33
           E1]
 gi|260629773|gb|EEX47967.1| M23/M37, cell wall endopeptidase family [Jonquetella anthropi E3_33
           E1]
          Length = 473

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G  +   G  ++ RHD    T+Y+H  T  V KGQ+VS G  I   G SG +  P 
Sbjct: 396 VIFAGW-MNGYGRVVVTRHDSVSSTLYAHAQTLKVCKGQQVSAGQVIATVGTSGRSTGPH 454

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N    +P+ +L 
Sbjct: 455 LHFEIRLNNKPTNPMSYLR 473


>gi|221197902|ref|ZP_03570948.1| peptidase M23B [Burkholderia multivorans CGD2M]
 gi|221204540|ref|ZP_03577557.1| peptidase M23B [Burkholderia multivorans CGD2]
 gi|221175397|gb|EEE07827.1| peptidase M23B [Burkholderia multivorans CGD2]
 gi|221181834|gb|EEE14235.1| peptidase M23B [Burkholderia multivorans CGD2M]
          Length = 412

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G+ +++ H D   T Y+H+      ++ G+ V +G  IG  G +G A 
Sbjct: 267 VVSFVGTDPGGYGHYVIVDHADGYSTYYAHLSAFARGLKVGEVVKQGQRIGSVGMTGAAT 326

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 327 GPHLHFEVRVANEPVDPL 344


>gi|167628730|ref|YP_001679229.1| m23 peptidase domain protein [Heliobacterium modesticaldum Ice1]
 gi|167591470|gb|ABZ83218.1| m23 peptidase domain protein [Heliobacterium modesticaldum Ice1]
          Length = 361

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 35/79 (44%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++        G  + I H    VT Y+H     V +GQ V  G  I   G +G +  P 
Sbjct: 283 VLFARYKTTGYGYHLAIDHGGGFVTFYAHCSKILVTEGQAVKAGDIIAEVGSTGRSTGPH 342

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N    +P  +L 
Sbjct: 343 LHFEVRINGEIQNPRSYLP 361


>gi|319792728|ref|YP_004154368.1| peptidase m23 [Variovorax paradoxus EPS]
 gi|315595191|gb|ADU36257.1| Peptidase M23 [Variovorax paradoxus EPS]
          Length = 302

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN I+++H+++ +T Y+H     V++ Q V +G  I   G S +A   +
Sbjct: 223 VVYAGAGLRGYGNLIILKHNNTYLTAYAHNQALLVKEDQSVQKGQKIAEMGNS-DADRVK 281

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 282 LHFEIRRQGKPVDPSRYLPGR 302


>gi|312149667|gb|ADQ29738.1| M23 peptidase domain protein [Borrelia burgdorferi N40]
          Length = 417

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 VVVTAGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|221217641|ref|ZP_03589109.1| M23 peptidase domain protein [Borrelia burgdorferi 72a]
 gi|225549069|ref|ZP_03770044.1| M23 peptidase domain protein [Borrelia burgdorferi 94a]
 gi|221192318|gb|EEE18537.1| M23 peptidase domain protein [Borrelia burgdorferi 72a]
 gi|225370295|gb|EEG99733.1| M23 peptidase domain protein [Borrelia burgdorferi 94a]
          Length = 417

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 VVVTAGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|15594607|ref|NP_212396.1| hypothetical protein BB0262 [Borrelia burgdorferi B31]
 gi|218249217|ref|YP_002374785.1| M23 peptidase domain protein [Borrelia burgdorferi ZS7]
 gi|226320562|ref|ZP_03796122.1| M23 peptidase domain protein [Borrelia burgdorferi 29805]
 gi|226321580|ref|ZP_03797106.1| M23 peptidase domain protein [Borrelia burgdorferi Bol26]
 gi|2688203|gb|AAC66685.1| conserved hypothetical protein [Borrelia burgdorferi B31]
 gi|218164405|gb|ACK74466.1| M23 peptidase domain protein [Borrelia burgdorferi ZS7]
 gi|226232769|gb|EEH31522.1| M23 peptidase domain protein [Borrelia burgdorferi Bol26]
 gi|226233981|gb|EEH32702.1| M23 peptidase domain protein [Borrelia burgdorferi 29805]
          Length = 417

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 VVVTAGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|238027062|ref|YP_002911293.1| peptidoglycan-binding LysM [Burkholderia glumae BGR1]
 gi|237876256|gb|ACR28589.1| Peptidoglycan-binding LysM [Burkholderia glumae BGR1]
          Length = 302

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 223 VVYAGNGLRGYGNLIIVKHDATYLTAYAHNRALMVKEGDSVTKGQKIAEMGNS-DSDRVM 281

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 282 LHFEVRRQGKPVDPLKYLP 300


>gi|319783195|ref|YP_004142671.1| peptidase M23 [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169083|gb|ADV12621.1| Peptidase M23 [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 500

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 57/80 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E GNT+L+RH++ +VTVY H  +  VQ+GQKV RG  I LSG SG    P
Sbjct: 421 VVIYAGDGLKEFGNTVLVRHENGLVTVYGHASSIEVQRGQKVKRGQEIALSGMSGTTDSP 480

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  +DP  +LE
Sbjct: 481 KLHFEVRKNSAPVDPSGYLE 500


>gi|13471177|ref|NP_102746.1| lipoprotein [Mesorhizobium loti MAFF303099]
 gi|14021921|dbj|BAB48532.1| lipoprotein [Mesorhizobium loti MAFF303099]
          Length = 515

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/80 (52%), Positives = 57/80 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L E GNT+L+RH++ +VTVY H  +  VQ+GQKV RG  I LSG SG    P
Sbjct: 436 VVIYAGDGLKEFGNTVLVRHENGLVTVYGHASSIEVQRGQKVKRGQEIALSGMSGTTDSP 495

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           ++HFE+RKN+  +DP  +LE
Sbjct: 496 KLHFEVRKNSAPVDPSGYLE 515


>gi|302387463|ref|YP_003823285.1| Peptidase M23 [Clostridium saccharolyticum WM1]
 gi|302198091|gb|ADL05662.1| Peptidase M23 [Clostridium saccharolyticum WM1]
          Length = 363

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 1   MVIYVGN-DLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQH 59
           +V YV N      G  ++I H D +VT+Y H    YV+ GQ V +G  I   G +G +  
Sbjct: 283 VVSYVKNSGSSGYGYHVVIDHGDGMVTLYGHCSKVYVRSGQTVQQGDVIAAVGSTGRSTG 342

Query: 60  PQVHFELRKNAIAMDPIKFLE 80
             +H E+R     ++P +FL 
Sbjct: 343 NHLHLEVRIGGKKVNPRQFLP 363


>gi|113955129|ref|YP_730532.1| peptidase, M23 family protein [Synechococcus sp. CC9311]
 gi|113882480|gb|ABI47438.1| peptidase, M23 family protein [Synechococcus sp. CC9311]
          Length = 333

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + + H D   + Y+H     V+KGQ + +G  I L G +G +  P
Sbjct: 249 VVKFSGWS-SGYGYLVELTHPDGSSSRYAHNSRLLVRKGQIIPQGAKISLMGSTGRSTGP 307

Query: 61  QVHFELR-KNAIAMDPIKFLEEKIP 84
            +HFE+R +   A+DP+  L  + P
Sbjct: 308 HLHFEIRQRGGSALDPMAKLPARRP 332


>gi|257057269|ref|YP_003135101.1| metalloendopeptidase-like membrane protein [Saccharomonospora
           viridis DSM 43017]
 gi|256587141|gb|ACU98274.1| metalloendopeptidase-like membrane protein [Saccharomonospora
           viridis DSM 43017]
          Length = 326

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      G  + ++HD+ ++TVY HI+   V  GQ+V  G  I   G  G +  P 
Sbjct: 243 VISSGPA-SGFGLWVRVQHDNGLITVYGHINESLVSVGQRVEAGQQIATMGNRGQSTGPH 301

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+ +N + +DP+ +LE 
Sbjct: 302 LHFEVHENGVKIDPLPWLES 321


>gi|24415297|gb|AAN59883.1| lipoprotein [Pseudomonas syringae pv. aptata]
          Length = 94

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2  VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
          V+Y G+ L   G  I+I+H D+ V+ Y H     V++GQ+V  G TI   G +G     +
Sbjct: 15 VVYAGSGLRGYGELIIIKHSDTYVSAYGHNRRLLVREGQQVKAGQTIAEMGSTG-TDRVK 73

Query: 62 VHFELRKNAIAMDPIKFLEEK 82
          +HFE+R+    +DP+ FL  +
Sbjct: 74 LHFEIRRQGKPVDPLGFLPRR 94


>gi|21230207|ref|NP_636124.1| peptidase [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66769803|ref|YP_244565.1| peptidase [Xanthomonas campestris pv. campestris str. 8004]
 gi|21111746|gb|AAM40048.1| peptidase [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66575135|gb|AAY50545.1| peptidase [Xanthomonas campestris pv. campestris str. 8004]
          Length = 314

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  VT Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 224 VVSYAG-VRGGYGNVVEVDHGNGYVTRYAHNSRLVVRVGDLVRAGQQVAKAGSSGRSTGA 282

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+  +   ++P KFL
Sbjct: 283 HVHFEVWADGRVVNPRKFL 301


>gi|223888731|ref|ZP_03623322.1| M23 peptidase domain protein [Borrelia burgdorferi 64b]
 gi|224533843|ref|ZP_03674431.1| M23 peptidase domain protein [Borrelia burgdorferi CA-11.2a]
 gi|225550156|ref|ZP_03771116.1| M23 peptidase domain protein [Borrelia burgdorferi 118a]
 gi|223885547|gb|EEF56646.1| M23 peptidase domain protein [Borrelia burgdorferi 64b]
 gi|224513136|gb|EEF83499.1| M23 peptidase domain protein [Borrelia burgdorferi CA-11.2a]
 gi|225369268|gb|EEG98721.1| M23 peptidase domain protein [Borrelia burgdorferi 118a]
 gi|312148409|gb|ADQ31068.1| M23 peptidase domain protein [Borrelia burgdorferi JD1]
          Length = 417

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 VVVTAGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|218778806|ref|YP_002430124.1| peptidase M23 [Desulfatibacillum alkenivorans AK-01]
 gi|218760190|gb|ACL02656.1| Peptidase M23 [Desulfatibacillum alkenivorans AK-01]
          Length = 317

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      GN I+I H   I T Y+H+    ++KG KV RG  +G  G +G +  P 
Sbjct: 239 VTFCGKK-SGFGNVIVIDHGHGISTRYAHLSKFKIKKGDKVQRGEIVGEVGNTGRSTGPH 297

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+  N + M+P +++
Sbjct: 298 LHYEVHLNGVPMNPQRYI 315


>gi|114321716|ref|YP_743399.1| peptidase M23B [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228110|gb|ABI57909.1| peptidase M23B [Alkalilimnicola ehrlichii MLHE-1]
          Length = 405

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y       LG  +++ H D  +++Y + ++ +V++G+ V  G  +   G SG  + P 
Sbjct: 326 VVYADW-FRGLGLLVILDHGDGYLSLYGYNESLFVEEGEWVQAGAVLASVGASGGRREPG 384

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           ++FE+R +   +DP+ +L  +
Sbjct: 385 LYFEVRADGDPVDPLPWLAAR 405


>gi|189499513|ref|YP_001958983.1| Peptidase M23 [Chlorobium phaeobacteroides BS1]
 gi|189494954|gb|ACE03502.1| Peptidase M23 [Chlorobium phaeobacteroides BS1]
          Length = 308

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ G +    G  I+I H     TVY+H+    V KGQKV+RG  I LSG +G +  P
Sbjct: 208 IVIFTGYNF-GYGKKIVIDHGFGYKTVYAHLSRSLVHKGQKVTRGDVIALSGNTGISTGP 266

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+ K    ++P  + 
Sbjct: 267 HLHYEVHKYNRKVNPSAYF 285


>gi|21231162|ref|NP_637079.1| lipoprotein [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66768830|ref|YP_243592.1| lipoprotein [Xanthomonas campestris pv. campestris str. 8004]
 gi|21112801|gb|AAM41003.1| lipoprotein [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66574162|gb|AAY49572.1| lipoprotein [Xanthomonas campestris pv. campestris str. 8004]
          Length = 266

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 186 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-AARD 244

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 245 MLHFEIRYNGKPVDPLLYLPKK 266


>gi|124267930|ref|YP_001021934.1| putative transmembrane protein [Methylibium petroleiphilum PM1]
 gi|124260705|gb|ABM95699.1| putative transmembrane protein [Methylibium petroleiphilum PM1]
          Length = 332

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 2/85 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+         G T+ I H + +VT Y+H     V  G  + RG  I   G +G +  P 
Sbjct: 233 VVMSAETHPAYGRTVEIDHGNGLVTRYAHAARLLVVPGDLIRRGQKIAEVGSTGRSTGPH 292

Query: 62  VHFELRKNAIAMDPIKFLEE--KIP 84
           +HFE+  +    DP KFL +  ++P
Sbjct: 293 LHFEVLVDGAPQDPAKFLAQASRLP 317


>gi|167616451|ref|ZP_02385083.1| lipoprotein NlpD, putative [Burkholderia thailandensis Bt4]
          Length = 131

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G+ L   GN ++I+HDD+ ++ Y+H     V++G  V++G  I   G S +A   
Sbjct: 51  VVAYAGDSLRGYGNFVIIKHDDTYLSAYAHNRKLLVKEGDPVAKGQVIAEMGDS-DADRV 109

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R+  +A+DP+K+L  +
Sbjct: 110 MLHFEIRRKGVAVDPLKYLPAR 131


>gi|224533120|ref|ZP_03673720.1| M23 peptidase domain protein [Borrelia burgdorferi WI91-23]
 gi|224511847|gb|EEF82248.1| M23 peptidase domain protein [Borrelia burgdorferi WI91-23]
          Length = 417

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 VVVTAGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|195941384|ref|ZP_03086766.1| hypothetical protein Bbur8_00680 [Borrelia burgdorferi 80a]
          Length = 417

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 VVVTAGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|206560035|ref|YP_002230799.1| subfamily M23B metalopeptidase [Burkholderia cenocepacia J2315]
 gi|198036076|emb|CAR51970.1| metallo peptidase, subfamily M23B [Burkholderia cenocepacia J2315]
          Length = 421

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  +++ H D   T Y+H+      ++ G+ V +G  IG  G +G A 
Sbjct: 276 VVSFVGTDPGGYGRYVIVDHADGYSTYYAHLSAFARGLKTGETVKQGQRIGSVGMTGAAT 335

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 336 GPHLHFEVRVANDPVDPL 353


>gi|167823854|ref|ZP_02455325.1| lipoprotein NlpD, putative [Burkholderia pseudomallei 9]
          Length = 164

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 85  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 143

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 144 LHFEVRRQGKPVDPLKYLP 162


>gi|170732944|ref|YP_001764891.1| peptidase M23B [Burkholderia cenocepacia MC0-3]
 gi|169816186|gb|ACA90769.1| peptidase M23B [Burkholderia cenocepacia MC0-3]
          Length = 400

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  +++ H D   T Y+H+      ++ G+ V +G  IG  G +G A 
Sbjct: 255 VVSFVGTDPGGYGRYVIVDHADGYSTYYAHLSAFARGLKTGETVKQGQRIGSVGMTGAAT 314

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 315 GPHLHFEVRVANDPVDPL 332


>gi|116689642|ref|YP_835265.1| peptidase M23B [Burkholderia cenocepacia HI2424]
 gi|116647731|gb|ABK08372.1| peptidase M23B [Burkholderia cenocepacia HI2424]
          Length = 421

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  +++ H D   T Y+H+      ++ G+ V +G  IG  G +G A 
Sbjct: 276 VVSFVGTDPGGYGRYVIVDHADGYSTYYAHLSAFARGLKTGETVKQGQRIGSVGMTGAAT 335

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 336 GPHLHFEVRVANDPVDPL 353


>gi|107022693|ref|YP_621020.1| peptidase M23B [Burkholderia cenocepacia AU 1054]
 gi|105892882|gb|ABF76047.1| peptidase M23B [Burkholderia cenocepacia AU 1054]
          Length = 421

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  +++ H D   T Y+H+      ++ G+ V +G  IG  G +G A 
Sbjct: 276 VVSFVGTDPGGYGRYVIVDHADGYSTYYAHLSAFARGLKTGETVKQGQRIGSVGMTGAAT 335

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 336 GPHLHFEVRVANDPVDPL 353


>gi|254245479|ref|ZP_04938800.1| Peptidase  M23B [Burkholderia cenocepacia PC184]
 gi|124870255|gb|EAY61971.1| Peptidase M23B [Burkholderia cenocepacia PC184]
          Length = 424

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  +++ H D   T Y+H+      ++ G+ V +G  IG  G +G A 
Sbjct: 279 VVSFVGTDPGGYGRYVIVDHADGYSTYYAHLSAFARGLKTGETVKQGQRIGSVGMTGAAT 338

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 339 GPHLHFEVRVANDPVDPL 356


>gi|297585570|ref|YP_003701350.1| peptidase M23 [Bacillus selenitireducens MLS10]
 gi|297144027|gb|ADI00785.1| Peptidase M23 [Bacillus selenitireducens MLS10]
          Length = 476

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    G T+ I H++ + TVY+H+   +V  GQ V +G  IG+ G +G +   
Sbjct: 398 VVSSAGWEN-GYGYTVRINHNNGMETVYAHLRDIHVSTGQTVGKGRQIGVMGTTGRSSGI 456

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+ +     +P+ +L 
Sbjct: 457 HLHFEVIQGGSHQNPMNYLR 476


>gi|262373753|ref|ZP_06067031.1| peptidase family M23 family protein [Acinetobacter junii SH205]
 gi|262311506|gb|EEY92592.1| peptidase family M23 family protein [Acinetobacter junii SH205]
          Length = 235

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      G  + I H +  +T Y+H     V  G +VS G  I   G +G    P
Sbjct: 154 VVTKSGWG-SGYGQYVEIDHGNGYITRYAHASRLIVNAGDRVSAGEHIANVGCTGRCTGP 212

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+ K+    +P  +L
Sbjct: 213 HLHFEVVKDGQRKNPSTYL 231


>gi|332187174|ref|ZP_08388914.1| peptidase M23 family protein [Sphingomonas sp. S17]
 gi|332012874|gb|EGI54939.1| peptidase M23 family protein [Sphingomonas sp. S17]
          Length = 249

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + I H   I T Y H+    V  G +V+RG  I L G +G +   
Sbjct: 144 IVDHAGWQ-GGYGNLVEINHGKGIATRYGHLSKVLVADGARVTRGQLIALMGSTGRSTGS 202

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R +  A++P+ FL
Sbjct: 203 HLHYEVRMDGHAVNPVPFL 221


>gi|319788530|ref|YP_004148005.1| peptidase M23 [Pseudoxanthomonas suwonensis 11-1]
 gi|317467042|gb|ADV28774.1| Peptidase M23 [Pseudoxanthomonas suwonensis 11-1]
          Length = 404

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 42/81 (51%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++    +   G  ++I H +  +++Y+H D      G +V +G  +   G SG    P 
Sbjct: 325 VVFSEW-MTGYGLILIIDHGNGYMSLYAHNDALLRDVGDRVRKGDPVARVGSSGGHGRPA 383

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           ++FELR++   +DP  +L+ +
Sbjct: 384 LYFELRRDGKPVDPSAWLQRR 404


>gi|302389012|ref|YP_003824833.1| Peptidase M23 [Thermosediminibacter oceani DSM 16646]
 gi|302199640|gb|ADL07210.1| Peptidase M23 [Thermosediminibacter oceani DSM 16646]
          Length = 311

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G      G  + I H D + T Y+H+    V++G  V  G  IG  G +G +  P 
Sbjct: 234 VAYAGWC-GGYGIAVFIWHGDGMETRYAHLSGTAVRQGAVVKAGDIIGYVGSTGKSTGPH 292

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H E+R    A++P+ F +
Sbjct: 293 LHLEVRVGGKAVNPLDFFK 311


>gi|17230845|ref|NP_487393.1| hypothetical protein alr3353 [Nostoc sp. PCC 7120]
 gi|17132448|dbj|BAB75052.1| alr3353 [Nostoc sp. PCC 7120]
          Length = 760

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    GN + IRH D  +T Y+H     VQ GQ+V +G  I   G +G +  P
Sbjct: 673 VVEKSGWNRGGYGNLVDIRHPDGSLTRYAHNSRLLVQAGQQVRQGQQIAAMGSTGFSTGP 732

Query: 61  QVHFELRKNAI-AMDPIKFLE 80
             HFE+ K    A++PI  L 
Sbjct: 733 HTHFEIHKTGKGAINPIAMLP 753


>gi|332308185|ref|YP_004436036.1| Peptidase M23 [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332175514|gb|AEE24768.1| Peptidase M23 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 273

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++++H DS ++ Y+H D+  V++ Q V  G  I   GKSG +   +
Sbjct: 194 VVYTGDALRGYGKLVIVKHSDSFLSAYAHNDSILVKEQQWVRAGQKIATMGKSG-SDTVK 252

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L ++
Sbjct: 253 LHFEVRYKGQSVDPSRYLPKR 273


>gi|325103094|ref|YP_004272748.1| Peptidase M23 [Pedobacter saltans DSM 12145]
 gi|324971942|gb|ADY50926.1| Peptidase M23 [Pedobacter saltans DSM 12145]
          Length = 322

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+    +    GN I+I H    VT Y+H+     +KG++V RG  IG  G +G +  P 
Sbjct: 221 VVIAQGNERGYGNRIMINHGYGYVTKYAHMSKFKAKKGERVKRGDLIGYVGNTGASTGPH 280

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+ KN   ++P+ F 
Sbjct: 281 LHYEVFKNGKVVNPMNFF 298


>gi|188993018|ref|YP_001905028.1| exported peptidase-like enzyme [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167734778|emb|CAP52988.1| exported peptidase-like enzyme [Xanthomonas campestris pv.
           campestris]
          Length = 314

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  VT Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 224 VVSYAG-VRGGYGNVVEVDHGNGYVTRYAHNSRLVVKVGDLVRAGQQVAKAGSSGRSTGA 282

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+  +   ++P KFL
Sbjct: 283 HVHFEVWADGRVVNPRKFL 301


>gi|301169421|emb|CBW29021.1| predicted outer membrane lipoprotein [Haemophilus influenzae 10810]
          Length = 405

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSGTNT-VK 384

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    ++DP+++L  
Sbjct: 385 LHFEIRYKGKSVDPVRYLPR 404


>gi|237812179|ref|YP_002896630.1| peptidase, M23/M37 family [Burkholderia pseudomallei MSHR346]
 gi|237503883|gb|ACQ96201.1| peptidase, M23/M37 family [Burkholderia pseudomallei MSHR346]
          Length = 471

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 326 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 385

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 386 GPHLHFEVRVDDQPVDPL 403


>gi|269120729|ref|YP_003308906.1| peptidase M23 [Sebaldella termitidis ATCC 33386]
 gi|268614607|gb|ACZ08975.1| Peptidase M23 [Sebaldella termitidis ATCC 33386]
          Length = 262

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN ++I H   + + Y+H+D+  V+  + V +G  +  SG +GN+  P
Sbjct: 158 IVSFAGQQN-GYGNVVIIDHSFGLQSFYAHLDSYSVKTREFVKKGQVVAKSGNTGNSTGP 216

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+E+R   + +DP+ F++
Sbjct: 217 HLHYEIRFYGVQLDPMNFIK 236


>gi|217421832|ref|ZP_03453336.1| peptidase, M23/M37 family [Burkholderia pseudomallei 576]
 gi|217395574|gb|EEC35592.1| peptidase, M23/M37 family [Burkholderia pseudomallei 576]
          Length = 471

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 326 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 385

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 386 GPHLHFEVRVDDQPVDPL 403


>gi|188587871|ref|YP_001922686.1| peptidase, M23/M37 family [Clostridium botulinum E3 str. Alaska
           E43]
 gi|188498152|gb|ACD51288.1| peptidase, M23/M37 family [Clostridium botulinum E3 str. Alaska
           E43]
          Length = 377

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 44/72 (61%)

Query: 9   LVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRK 68
           +   GN I I+H+D + T+Y H+ +  V+KGQ++ +G  IG  G +G +  P +HFELR 
Sbjct: 305 VSGYGNMIKIKHEDGLETLYGHLSSINVKKGQEIKKGDVIGAVGSTGRSTGPHLHFELRS 364

Query: 69  NAIAMDPIKFLE 80
               ++P  +++
Sbjct: 365 KGTPINPETYIK 376


>gi|167919029|ref|ZP_02506120.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei
           BCC215]
          Length = 335

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 190 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 249

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 250 GPHLHFEVRVDDQPVDPL 267


>gi|167902769|ref|ZP_02489974.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei NCTC
           13177]
          Length = 332

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 187 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 246

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 247 GPHLHFEVRVDDQPVDPL 264


>gi|167845796|ref|ZP_02471304.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei
           B7210]
          Length = 319

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 174 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 233

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 234 GPHLHFEVRVDDQPVDPL 251


>gi|167824249|ref|ZP_02455720.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei 9]
          Length = 338

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 193 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 252

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 253 GPHLHFEVRVDDQPVDPL 270


>gi|167815879|ref|ZP_02447559.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei 91]
          Length = 326

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 181 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 240

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 241 GPHLHFEVRVDDQPVDPL 258


>gi|167719666|ref|ZP_02402902.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei
           DM98]
          Length = 334

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 189 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 248

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 249 GPHLHFEVRVDDQPVDPL 266


>gi|134282253|ref|ZP_01768958.1| peptidase, M23/M37 family [Burkholderia pseudomallei 305]
 gi|134246291|gb|EBA46380.1| peptidase, M23/M37 family [Burkholderia pseudomallei 305]
          Length = 471

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 326 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 385

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 386 GPHLHFEVRVDDQPVDPL 403


>gi|126451678|ref|YP_001066165.1| M24/M37 family peptidase [Burkholderia pseudomallei 1106a]
 gi|226196385|ref|ZP_03791967.1| peptidase, M23/M37 family [Burkholderia pseudomallei Pakistan 9]
 gi|242314848|ref|ZP_04813864.1| peptidase, M23/M37 family [Burkholderia pseudomallei 1106b]
 gi|254261347|ref|ZP_04952401.1| peptidase, M23/M37 family [Burkholderia pseudomallei 1710a]
 gi|126225320|gb|ABN88860.1| peptidase, M23/M37 family [Burkholderia pseudomallei 1106a]
 gi|225931602|gb|EEH27607.1| peptidase, M23/M37 family [Burkholderia pseudomallei Pakistan 9]
 gi|242138087|gb|EES24489.1| peptidase, M23/M37 family [Burkholderia pseudomallei 1106b]
 gi|254220036|gb|EET09420.1| peptidase, M23/M37 family [Burkholderia pseudomallei 1710a]
          Length = 471

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 326 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 385

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 386 GPHLHFEVRVDDQPVDPL 403


>gi|126441274|ref|YP_001058922.1| M24/M37 family peptidase [Burkholderia pseudomallei 668]
 gi|126220767|gb|ABN84273.1| peptidase, M23/M37 family [Burkholderia pseudomallei 668]
          Length = 472

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 327 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 386

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 387 GPHLHFEVRVDDQPVDPL 404


>gi|124383640|ref|YP_001026322.1| metallopeptidase [Burkholderia mallei NCTC 10229]
          Length = 509

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 364 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 423

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 424 GPHLHFEVRVDDQPVDPL 441


>gi|121598381|ref|YP_992991.1| peptidase [Burkholderia mallei SAVP1]
 gi|121227191|gb|ABM49709.1| subfamily M23B unassigned peptidase [Burkholderia mallei SAVP1]
          Length = 470

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 325 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 384

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 385 GPHLHFEVRVDDQPVDPL 402


>gi|76810289|ref|YP_333450.1| peptidase [Burkholderia pseudomallei 1710b]
 gi|76579742|gb|ABA49217.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei
           1710b]
          Length = 512

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 367 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 426

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 427 GPHLHFEVRVDDQPVDPL 444


>gi|53719419|ref|YP_108405.1| peptidase [Burkholderia pseudomallei K96243]
 gi|52209833|emb|CAH35805.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei
           K96243]
          Length = 413

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 268 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 327

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 328 GPHLHFEVRVDDQPVDPL 345


>gi|296186832|ref|ZP_06855233.1| peptidase, M23 family [Clostridium carboxidivorans P7]
 gi|296048546|gb|EFG87979.1| peptidase, M23 family [Clostridium carboxidivorans P7]
          Length = 341

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 38/70 (54%)

Query: 11  ELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNA 70
             GN I I H + + TVY+H        G+ V RG  IG  G +G +  P VHFE+R N 
Sbjct: 272 GYGNVIKIDHGNGMQTVYAHCSKICSNVGEYVKRGQKIGEVGSTGRSTGPHVHFEVRVNG 331

Query: 71  IAMDPIKFLE 80
              +P+K+L+
Sbjct: 332 KPENPLKYLQ 341


>gi|145641969|ref|ZP_01797542.1| lipoprotein [Haemophilus influenzae R3021]
 gi|145273335|gb|EDK13208.1| lipoprotein [Haemophilus influenzae 22.4-21]
          Length = 405

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSGTNT-VK 384

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    ++DP+++L  
Sbjct: 385 LHFEIRYKGKSVDPVRYLPR 404


>gi|309973797|gb|ADO96998.1| Outer membrane antigenic lipoprotein B [Haemophilus influenzae
           R2846]
          Length = 405

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSGTNT-VK 384

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    ++DP+++L  
Sbjct: 385 LHFEIRYKGKSVDPVRYLPR 404


>gi|251780122|ref|ZP_04823042.1| peptidase, M23/M37 family [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243084437|gb|EES50327.1| peptidase, M23/M37 family [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 395

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 44/72 (61%)

Query: 9   LVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRK 68
           +   GN I I+H+D + T+Y H+ +  V+KGQ++ +G  IG  G +G +  P +HFELR 
Sbjct: 322 VSGYGNMIKIKHEDGLETLYGHLSSINVKKGQEIKKGDVIGAVGSTGRSTGPHLHFELRS 381

Query: 69  NAIAMDPIKFLE 80
               ++P  +++
Sbjct: 382 KGTPINPETYIK 393


>gi|145633762|ref|ZP_01789487.1| lipoprotein [Haemophilus influenzae 3655]
 gi|229845538|ref|ZP_04465666.1| lipoprotein [Haemophilus influenzae 6P18H1]
 gi|144985421|gb|EDJ92248.1| lipoprotein [Haemophilus influenzae 3655]
 gi|229811554|gb|EEP47255.1| lipoprotein [Haemophilus influenzae 6P18H1]
          Length = 405

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSGTNT-VK 384

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    ++DP+++L  
Sbjct: 385 LHFEIRYKGKSVDPVRYLPR 404


>gi|186681531|ref|YP_001864727.1| peptidase M23B [Nostoc punctiforme PCC 73102]
 gi|186463983|gb|ACC79784.1| peptidase M23B [Nostoc punctiforme PCC 73102]
          Length = 303

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G D   LGN I I+H D   TVY H     V K Q+V +G  I   G +GN+  P 
Sbjct: 88  VVKAGWDNWGLGNAITIKHLDGSTTVYGHNRRLLVSKNQQVIQGQIIAEMGSTGNSTAPH 147

Query: 62  VHFELRKNAI-AMDPIKFL 79
           +HFE+  N   A+DP++ L
Sbjct: 148 LHFEVHPNGRIAVDPLRLL 166


>gi|163839258|ref|YP_001623663.1| peptidase M23B [Renibacterium salmoninarum ATCC 33209]
 gi|162952734|gb|ABY22249.1| peptidase M23B [Renibacterium salmoninarum ATCC 33209]
          Length = 336

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 45/78 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G   +  GN I+I H + + T Y H  T  V+ GQKVSRG  + LSG +GN+    
Sbjct: 259 VTFAGWHQLGGGNRIVIDHGNGLSTAYLHNTTLQVKVGQKVSRGDLVALSGTTGNSTGCH 318

Query: 62  VHFELRKNAIAMDPIKFL 79
           VHFE+  +   +DP+ ++
Sbjct: 319 VHFEVMVDDKTVDPLGWI 336


>gi|254468802|ref|ZP_05082208.1| peptidase M23B [beta proteobacterium KB13]
 gi|207087612|gb|EDZ64895.1| peptidase M23B [beta proteobacterium KB13]
          Length = 286

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G DL   G  I+I+HDD I++VY H     V +GQK+S G  I   G++ +     
Sbjct: 206 VIYAGEDLKGYGKLIIIKHDDDILSVYGHNRELLVTEGQKISAGEIISTMGQTDD-GKIH 264

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK+ ++++P+ + + +
Sbjct: 265 LHFEIRKSGLSVNPMNYFKSR 285


>gi|148239456|ref|YP_001224843.1| zinc metallopeptidase [Synechococcus sp. WH 7803]
 gi|147847995|emb|CAK23546.1| Zinc metallopeptidase with a LysM domain [Synechococcus sp. WH
           7803]
          Length = 328

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           ++ Y G      G  + I H D   T Y+H    +V+KGQ V +G  I L G +G +  P
Sbjct: 245 VIAYSGWS-SGYGYLVEISHGDGSSTRYAHSSRLFVKKGQLVPQGARIALMGSTGRSTGP 303

Query: 61  QVHFELRK-NAIAMDPIKFLEEK 82
            +HFE+RK    AMDP+  L  +
Sbjct: 304 HLHFEIRKAGGAAMDPMTMLPSR 326


>gi|145635555|ref|ZP_01791254.1| lipoprotein [Haemophilus influenzae PittAA]
 gi|145267218|gb|EDK07223.1| lipoprotein [Haemophilus influenzae PittAA]
          Length = 405

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSGTNT-VK 384

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    ++DP+++L  
Sbjct: 385 LHFEIRYKGKSVDPVRYLPR 404


>gi|292490633|ref|YP_003526072.1| peptidase M23 [Nitrosococcus halophilus Nc4]
 gi|291579228|gb|ADE13685.1| Peptidase M23 [Nitrosococcus halophilus Nc4]
          Length = 287

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V +VG +    G  + I H +  VT Y+H     VQ G+ + +G  I   G SG +  P
Sbjct: 204 IVTWVG-ERSGYGKMVEIDHGNGYVTRYAHNQKNLVQVGESIVKGQPIAAMGSSGRSTGP 262

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VH E+      +DP++F+
Sbjct: 263 HVHLEVLHEGRTVDPLRFV 281


>gi|260582961|ref|ZP_05850744.1| lipoprotein [Haemophilus influenzae NT127]
 gi|260093945|gb|EEW77850.1| lipoprotein [Haemophilus influenzae NT127]
          Length = 405

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSGTNT-VK 384

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    ++DP+++L  
Sbjct: 385 LHFEIRYKGKSVDPVRYLPR 404


>gi|253998696|ref|YP_003050759.1| peptidase M23 [Methylovorus sp. SIP3-4]
 gi|253985375|gb|ACT50232.1| Peptidase M23 [Methylovorus sp. SIP3-4]
          Length = 354

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 52/83 (62%), Gaps = 1/83 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G+DL   G  ++I+H+ + ++VY+H +   V++GQ+VSRG  I   G S +    +
Sbjct: 273 VIYSGSDLRGYGKLVIIKHNKTYLSVYAHNNQILVKEGQQVSRGQKIAEMGNS-DTDKVK 331

Query: 62  VHFELRKNAIAMDPIKFLEEKIP 84
           +HFE+R+   ++DP K+L    P
Sbjct: 332 LHFEIRQQGKSVDPAKYLPGSNP 354


>gi|167761642|ref|ZP_02433769.1| hypothetical protein CLOSCI_04054 [Clostridium scindens ATCC 35704]
 gi|167660785|gb|EDS04915.1| hypothetical protein CLOSCI_04054 [Clostridium scindens ATCC 35704]
          Length = 369

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      G  I+I H + + T Y H +  YV  GQ VS+G  I   G +GN+  P 
Sbjct: 293 VVSAGYSGNA-GKMIVINHGNGLTTYYMHCNDLYVSAGQSVSKGQNIAAVGTTGNSTGPH 351

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++  N   ++P  +L
Sbjct: 352 LHFQVNLNGTPVNPANYL 369


>gi|189350455|ref|YP_001946083.1| membrane protein [Burkholderia multivorans ATCC 17616]
 gi|189334477|dbj|BAG43547.1| membrane protein [Burkholderia multivorans ATCC 17616]
          Length = 389

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G+ +++ H D   T Y+H+      ++ G+ V +G  IG  G +G A 
Sbjct: 244 VVSFVGTDPGGYGHYVIVDHADGYSTYYAHLSAFARGLKVGEVVKQGQRIGSVGMTGAAT 303

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 304 GPHLHFEVRVANEPVDPL 321


>gi|302339124|ref|YP_003804330.1| peptidase M23 [Spirochaeta smaragdinae DSM 11293]
 gi|301636309|gb|ADK81736.1| Peptidase M23 [Spirochaeta smaragdinae DSM 11293]
          Length = 370

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 43/75 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ VG+     G  ++IRH     ++Y H+    V+KGQ +S+G  IG  G +G +  P 
Sbjct: 290 VVLVGDRPRGFGKYVVIRHSHGFQSLYGHLSRILVRKGQHISQGQQIGEMGSTGRSTGPH 349

Query: 62  VHFELRKNAIAMDPI 76
           +HF L +N + ++P+
Sbjct: 350 LHFALYRNNVPVNPL 364


>gi|225011404|ref|ZP_03701842.1| Peptidase M23 [Flavobacteria bacterium MS024-2A]
 gi|225003907|gb|EEG41879.1| Peptidase M23 [Flavobacteria bacterium MS024-2A]
          Length = 325

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V    N     GN I I H    V++Y+H+    V++GQKV RG  IG  G +G +  P
Sbjct: 223 VVKRADNRASGYGNHIRIDHGFGYVSLYAHLSKYNVRRGQKVKRGDLIGYVGNTGRSAGP 282

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E+ K+   ++P+ F
Sbjct: 283 HLHYEIFKDKKRINPLNF 300


>gi|89897682|ref|YP_521169.1| hypothetical protein DSY4936 [Desulfitobacterium hafniense Y51]
 gi|219670832|ref|YP_002461267.1| peptidase M23 [Desulfitobacterium hafniense DCB-2]
 gi|89337130|dbj|BAE86725.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219541092|gb|ACL22831.1| Peptidase M23 [Desulfitobacterium hafniense DCB-2]
          Length = 230

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+         G T+L+ H + + ++Y+H     V  G+ V +G  I L+G +G +  P 
Sbjct: 149 VVKAQWHD-IYGLTVLLEHGNGVQSLYAHNQKILVSPGEWVEQGDCIALAGDTGRSTGPH 207

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R +  A+DP  +L +
Sbjct: 208 LHFEIRLHGKAVDPKPYLPQ 227


>gi|313200771|ref|YP_004039429.1| peptidase m23 [Methylovorus sp. MP688]
 gi|312440087|gb|ADQ84193.1| Peptidase M23 [Methylovorus sp. MP688]
          Length = 353

 Score = 92.9 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 52/83 (62%), Gaps = 1/83 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G+DL   G  ++I+H+ + ++VY+H +   V++GQ+VSRG  I   G S +    +
Sbjct: 272 VIYSGSDLRGYGKLVIIKHNKTYLSVYAHNNQILVKEGQQVSRGQKIAEMGNS-DTDKVK 330

Query: 62  VHFELRKNAIAMDPIKFLEEKIP 84
           +HFE+R+   ++DP K+L    P
Sbjct: 331 LHFEIRQQGKSVDPAKYLPGSNP 353


>gi|294626640|ref|ZP_06705237.1| lipoprotein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|294665643|ref|ZP_06730920.1| lipoprotein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|292599060|gb|EFF43200.1| lipoprotein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292604589|gb|EFF47963.1| lipoprotein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 259

 Score = 92.9 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 179 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-AARD 237

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 238 MLHFEIRYNGKPVDPLLYLPKK 259


>gi|223041604|ref|ZP_03611803.1| outer membrane antigenic lipoprotein B precursor [Actinobacillus
           minor 202]
 gi|223017579|gb|EEF15991.1| outer membrane antigenic lipoprotein B precursor [Actinobacillus
           minor 202]
          Length = 409

 Score = 92.9 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V +   V  G  I   G +G     +
Sbjct: 330 VVYAGNALEGYGNLIIIKHNDDFLSAYAHNDSIKVDEQDSVRAGEKIATLGSTG-TTSNK 388

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L ++
Sbjct: 389 LHFEIRYKGKSVDPTRYLPKQ 409


>gi|332187037|ref|ZP_08388778.1| peptidase M23 family protein [Sphingomonas sp. S17]
 gi|332013047|gb|EGI55111.1| peptidase M23 family protein [Sphingomonas sp. S17]
          Length = 491

 Score = 92.9 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + + H   I + Y H+    V+ G +V +G  IG  G +G +  P
Sbjct: 385 VVQFAGRS-GGYGNFVKLVHGGGIASGYGHMSRFAVRSGTRVKQGQVIGYVGSTGMSTGP 443

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E+ KN + ++P   
Sbjct: 444 HLHWEVWKNGVTVNPRSL 461


>gi|145637593|ref|ZP_01793249.1| lipoprotein [Haemophilus influenzae PittHH]
 gi|148827876|ref|YP_001292629.1| lipoprotein [Haemophilus influenzae PittGG]
 gi|145269190|gb|EDK09137.1| lipoprotein [Haemophilus influenzae PittHH]
 gi|148719118|gb|ABR00246.1| lipoprotein [Haemophilus influenzae PittGG]
          Length = 405

 Score = 92.9 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSGTNT-VK 384

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    ++DP+++L  
Sbjct: 385 LHFEIRYKGKSVDPVRYLPR 404


>gi|294651902|ref|ZP_06729192.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|292822225|gb|EFF81138.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 227

 Score = 92.9 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      G  + I H +  VT Y+H     V  G++V  G  I   G +G    P
Sbjct: 146 VVTKSGWGT-GYGQYVEIDHGNGYVTRYAHASRLMVNAGERVGAGQHIANVGCTGRCTGP 204

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+ K+    +P  +L
Sbjct: 205 HLHFEVVKDGQRRNPSTYL 223


>gi|261379252|ref|ZP_05983825.1| M23 peptidase domain protein [Neisseria subflava NJ9703]
 gi|319639129|ref|ZP_07993885.1| M23 peptidase domain-containing protein [Neisseria mucosa C102]
 gi|284797679|gb|EFC53026.1| M23 peptidase domain protein [Neisseria subflava NJ9703]
 gi|317399606|gb|EFV80271.1| M23 peptidase domain-containing protein [Neisseria mucosa C102]
          Length = 431

 Score = 92.9 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GNT++IRH + + T+Y H+         +V  G  IG  G +G +  P 
Sbjct: 317 VIFKGWK-GGYGNTVMIRHANGVETLYGHMSAFS-PADGRVRAGEVIGFVGTTGRSTGPH 374

Query: 62  VHFELRKNAIAMDP 75
           +H+E R N   ++P
Sbjct: 375 LHYEARVNGQPVNP 388


>gi|15837407|ref|NP_298095.1| hypothetical protein XF0805 [Xylella fastidiosa 9a5c]
 gi|9105703|gb|AAF83615.1|AE003920_6 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 319

 Score = 92.9 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  +T Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 225 VVSYAGYRN-GYGNVVDVDHSNGYLTRYAHNSRLTVKVGDLVRTGQEVAKAGSSGRSTGA 283

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+ K+ + M+PIKFL
Sbjct: 284 HVHFEVWKDGVVMNPIKFL 302


>gi|84625253|ref|YP_452625.1| peptidase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188575305|ref|YP_001912234.1| peptidase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|84369193|dbj|BAE70351.1| peptidase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188519757|gb|ACD57702.1| peptidase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 313

 Score = 92.9 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  VT Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 224 VVSYAG-VRGGYGNVVEVDHGNGYVTRYAHNSRLVVKVGDLVRAGQQVARAGSSGRSTAA 282

Query: 61  QVHFELRKNAIAMDPIKFLEEKIP 84
            VHFE+  +   ++P KFL E  P
Sbjct: 283 HVHFEVWADGRVVNPRKFLGETTP 306


>gi|16272646|ref|NP_438864.1| lipoprotein [Haemophilus influenzae Rd KW20]
 gi|260581475|ref|ZP_05849286.1| outer membrane antigenic lipoprotein B [Haemophilus influenzae
           RdAW]
 gi|1170822|sp|P44833|LPPB_HAEIN RecName: Full=Outer membrane antigenic lipoprotein B; Flags:
           Precursor
 gi|1573707|gb|AAC22363.1| lipoprotein [Haemophilus influenzae Rd KW20]
 gi|260091876|gb|EEW75828.1| outer membrane antigenic lipoprotein B [Haemophilus influenzae
           RdAW]
          Length = 405

 Score = 92.9 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSGTNT-VK 384

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    ++DP+++L  
Sbjct: 385 LHFEIRYKGKSVDPVRYLPR 404


>gi|261250228|ref|ZP_05942804.1| lipoprotein NlpD [Vibrio orientalis CIP 102891]
 gi|260939344|gb|EEX95330.1| lipoprotein NlpD [Vibrio orientalis CIP 102891]
          Length = 302

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+D+ ++ Y+H D   V++GQ V  G  I   G SG +   +
Sbjct: 225 VVYSGNALRGYGNLVIIKHNDNYLSAYAHNDRLLVREGQSVKAGQKIATMGSSGASS-VR 283

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    +++P ++L 
Sbjct: 284 LHFEIRYQGKSVNPKRYLP 302


>gi|300781703|ref|ZP_07091557.1| M23B family peptidase [Corynebacterium genitalium ATCC 33030]
 gi|300533410|gb|EFK54471.1| M23B family peptidase [Corynebacterium genitalium ATCC 33030]
          Length = 236

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G      GN I +RHDD  V+VY H++T  V  G++V  G  I   G  G +   
Sbjct: 151 VVIDSGPA-QGYGNWIRLRHDDGTVSVYGHMETLDVAVGERVKAGQKIAGMGSRGFSTGS 209

Query: 61  QVHFELRKNA-IAMDPIKFLEEK 82
            +HFE+  +    +DP+ +L  +
Sbjct: 210 HLHFEVHPDGTTPVDPVPWLAAR 232


>gi|23012163|ref|ZP_00052317.1| COG0739: Membrane proteins related to metalloendopeptidases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 233

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 34/78 (43%), Positives = 49/78 (62%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH++  V+ Y+H     V+ G+KV RG TI  SG +GN   PQ
Sbjct: 154 VAYAGSDVKGYGKLVLVRHNNGYVSAYAHNGELDVRPGEKVKRGQTIAKSGATGNVTSPQ 213

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+RK A  +DP+  L
Sbjct: 214 LHFEIRKGATPVDPMPHL 231


>gi|126437273|ref|YP_001072964.1| peptidase M23B [Mycobacterium sp. JLS]
 gi|126237073|gb|ABO00474.1| peptidase M23B [Mycobacterium sp. JLS]
          Length = 360

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI VG      G  + +RH D  VT+Y H++T  V  G++V  G  I   G  GN+  P
Sbjct: 270 VVIDVGP-TAGYGAWVKLRHADGTVTLYGHLNTWSVSMGEQVMAGDQIATMGNRGNSTGP 328

Query: 61  QVHFELRKNA-IAMDPIKFLEEK 82
            +HFE+       +DP+ +L ++
Sbjct: 329 HLHFEVMVGGSNRIDPVGWLSKR 351


>gi|255066230|ref|ZP_05318085.1| peptidase M23B [Neisseria sicca ATCC 29256]
 gi|255049440|gb|EET44904.1| peptidase M23B [Neisseria sicca ATCC 29256]
          Length = 306

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S ++ Y H     V +GQ+V RG TI   G + +A   Q
Sbjct: 228 VVYAGSGLRGYGNLVIIQHNSSYLSAYGHNQRLLVNEGQQVKRGQTIANMGNT-DASRTQ 286

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 287 LHFEVRQNGKPVNPANYV 304


>gi|94495760|ref|ZP_01302340.1| membrane protein [Sphingomonas sp. SKA58]
 gi|94425148|gb|EAT10169.1| membrane protein [Sphingomonas sp. SKA58]
          Length = 237

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      GN + I H   + T Y H+    V     V RG  IGL G +G +   
Sbjct: 131 VVSRAGWAN-GYGNLVQITHGSGMETRYGHMSKLLVSPNSYVKRGQIIGLMGSTGRSTGS 189

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R +  A++PI F+
Sbjct: 190 HLHYEVRVDGAAINPIPFV 208


>gi|152990092|ref|YP_001355814.1| M24/M37 family peptidase [Nitratiruptor sp. SB155-2]
 gi|151421953|dbj|BAF69457.1| peptidase, M23/M37 family [Nitratiruptor sp. SB155-2]
          Length = 417

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GN I+I H D   T+Y+H+    V++G++V +G  IGL G +G +  P 
Sbjct: 271 VIFSGRK-GGYGNVIIIAHADGYRTLYAHLQKRLVRRGRRVKQGSLIGLVGNTGLSTGPH 329

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HF L KN  A++P++ ++
Sbjct: 330 LHFGLYKNGRAINPLRVVK 348


>gi|209551096|ref|YP_002283013.1| peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209536852|gb|ACI56787.1| Peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 640

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           V   G D    GN  +IRH +   + Y+H       V  G K+ +G  IG  G +G +  
Sbjct: 524 VEKAGWDSGGYGNQTIIRHANGYESSYNHQSAIAKGVTPGAKIRQGQVIGWVGTTGESTG 583

Query: 60  PQVHFELRKNAIAMDPIKFLEEKIP 84
           P +H+EL  N   +DP   L  ++P
Sbjct: 584 PHLHYELIVNGTKVDP---LRIRLP 605


>gi|158317726|ref|YP_001510234.1| peptidase M23B [Frankia sp. EAN1pec]
 gi|158113131|gb|ABW15328.1| peptidase M23B [Frankia sp. EAN1pec]
          Length = 284

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 4/81 (4%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G +    GN + I H++++VT Y H+    V+ GQ+V+ G  IGL G +G +  P 
Sbjct: 198 VIYAGWE-SGYGNFVQIMHENNVVTSYGHLSRIDVRLGQEVATGEQIGLEGNTGKSTGPH 256

Query: 62  VHFELRKNAIA---MDPIKFL 79
           +HFE+R N      +DP+ +L
Sbjct: 257 LHFEVRLNGQYGTKVDPLTWL 277


>gi|20808379|ref|NP_623550.1| membrane proteins related to metalloendopeptidase
           [Thermoanaerobacter tengcongensis MB4]
 gi|20516991|gb|AAM25154.1| Membrane proteins related to metalloendopeptidases
           [Thermoanaerobacter tengcongensis MB4]
          Length = 389

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 40/65 (61%)

Query: 16  ILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDP 75
           ++I H D I T+Y+H     V++G  V RG  I   G +G +  P +HFE+RKN + ++P
Sbjct: 325 VIIDHGDGISTLYAHCSALLVKEGDTVKRGQVIAKIGSTGLSTGPHLHFEVRKNGVPVNP 384

Query: 76  IKFLE 80
           + +L+
Sbjct: 385 MDWLK 389


>gi|317402459|gb|EFV83028.1| peptidase family M23/M37 protein [Achromobacter xylosoxidans C54]
          Length = 327

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+         GN + I H D ++T Y+H  +  V++GQ V RG  +   G SG +  P
Sbjct: 230 VVLEA-KFHPGYGNMVEIDHGDGLITRYAHASSLMVKQGQLVERGQQVARVGSSGRSTGP 288

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R     +DP  FL
Sbjct: 289 HLHFEVRLAGQPLDPRLFL 307


>gi|261417170|ref|YP_003250853.1| Peptidase M23 [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|261373626|gb|ACX76371.1| Peptidase M23 [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|302325517|gb|ADL24718.1| peptidase, M23/M37 family [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 306

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 41/78 (52%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ +       GN +++ H + + T Y H+    V  G+ V R   +G  G +G +  P 
Sbjct: 221 VVEISQLSSSFGNFVVLNHGNGLKTRYGHMQMSAVTPGEFVHRYQILGYMGNTGRSVGPH 280

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+ KN + ++P+ ++
Sbjct: 281 LHYEVWKNGVPVNPLPYI 298


>gi|209522221|ref|ZP_03270858.1| Peptidase M23 [Burkholderia sp. H160]
 gi|209497350|gb|EDZ97568.1| Peptidase M23 [Burkholderia sp. H160]
          Length = 244

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 165 VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 223

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 224 LHFEVRRQGKPVDPLKYLP 242


>gi|153003649|ref|YP_001377974.1| peptidase M23B [Anaeromyxobacter sp. Fw109-5]
 gi|152027222|gb|ABS24990.1| peptidase M23B [Anaeromyxobacter sp. Fw109-5]
          Length = 305

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G +    G  ++I H   + T Y+H+   +V+ G  V RG  +   G +G +    
Sbjct: 227 VVFAGTE-GSYGKVLVIDHGYGVRTRYAHLSEIFVRAGSLVRRGDKVAAVGNTGRSTGTH 285

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N I  +P KF+
Sbjct: 286 LHYEVRVNGIPENPRKFI 303


>gi|172060283|ref|YP_001807935.1| peptidase M23 [Burkholderia ambifaria MC40-6]
 gi|171992800|gb|ACB63719.1| Peptidase M23 [Burkholderia ambifaria MC40-6]
          Length = 230

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+   +T Y+H     V++GQ V++G TI   G S ++    
Sbjct: 151 VVYAGNGLRGYGNLIILKHNADYLTAYAHNRALLVKEGQSVTQGQTIAEMGNS-DSDRVA 209

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 210 LHFELRYGGRSIDPARYLPAR 230


>gi|167036987|ref|YP_001664565.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167039698|ref|YP_001662683.1| peptidase M23B [Thermoanaerobacter sp. X514]
 gi|256750631|ref|ZP_05491517.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915053|ref|ZP_07132368.1| Peptidase M23 [Thermoanaerobacter sp. X561]
 gi|307724976|ref|YP_003904727.1| peptidase M23 [Thermoanaerobacter sp. X513]
 gi|320115405|ref|YP_004185564.1| peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166853938|gb|ABY92347.1| peptidase M23B [Thermoanaerobacter sp. X514]
 gi|166855821|gb|ABY94229.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256750471|gb|EEU63489.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888777|gb|EFK83924.1| Peptidase M23 [Thermoanaerobacter sp. X561]
 gi|307582037|gb|ADN55436.1| Peptidase M23 [Thermoanaerobacter sp. X513]
 gi|319928496|gb|ADV79181.1| Peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 379

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 42/66 (63%)

Query: 15  TILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMD 74
           T++I H D I T+Y+H     V++G  V RG  I  +G +G +  P +HFE+RKN + ++
Sbjct: 314 TVIIDHGDGISTLYAHNSALLVKEGDTVKRGQVIAKAGSTGLSTGPHLHFEVRKNGVPVN 373

Query: 75  PIKFLE 80
           P+ +L+
Sbjct: 374 PMDWLK 379


>gi|124266447|ref|YP_001020451.1| peptidase [Methylibium petroleiphilum PM1]
 gi|124259222|gb|ABM94216.1| subfamily M23B unassigned peptidase [Methylibium petroleiphilum
           PM1]
          Length = 317

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++++H+ + +T Y+H  T  V++ Q V RG  I   G + +A+  Q
Sbjct: 238 VVYAGSGLRGYGNLVIVKHNTTYLTAYAHNQTLLVKEDQPVKRGQKIAEMGST-DAERVQ 296

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK    +DP+K L  +
Sbjct: 297 LHFEIRKLGKPVDPVKLLPPR 317


>gi|325916045|ref|ZP_08178335.1| metalloendopeptidase-like membrane protein [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325537721|gb|EGD09427.1| metalloendopeptidase-like membrane protein [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 258

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 178 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQSVKAGQQIAEMGRSG-AARD 236

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 237 MLHFEIRYNGKPVDPLLYLPKK 258


>gi|221133809|ref|ZP_03560114.1| peptidase, M23/M37 family protein [Glaciecola sp. HTCC2999]
          Length = 295

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           ++ + G      GN + I H + +VT Y H     V  G+ V++G  I   G +G +  P
Sbjct: 215 VITWSGERF-GYGNLVEIDHGNGLVTRYGHNQLLLVNVGEVVTKGQQIAQVGNTGRSTGP 273

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VH+E+ KN   +DP+ F+
Sbjct: 274 HVHYEIIKNGTQIDPLPFV 292


>gi|323140692|ref|ZP_08075613.1| peptidase, M23 family [Phascolarctobacterium sp. YIT 12067]
 gi|322414816|gb|EFY05614.1| peptidase, M23 family [Phascolarctobacterium sp. YIT 12067]
          Length = 381

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y G  L   GN ++I H   +VT+Y+H     V +GQ VS+G  +  +G +G +  P 
Sbjct: 304 IVYSGW-LGGYGNCVMIDHGGGLVTLYAHNSALNVGEGQYVSKGTVVAYAGSTGYSTGPH 362

Query: 62  VHFELRKNAIAMDPIKFLE 80
            HFE+R +    +P+ +L 
Sbjct: 363 CHFEVRLHGELTEPLNYLP 381


>gi|254773953|ref|ZP_05215469.1| hypothetical protein MaviaA2_04664 [Mycobacterium avium subsp.
           avium ATCC 25291]
          Length = 350

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G      G  + +RH D  VT+Y HI+T  V  G++V  G  I   G  GN+  P
Sbjct: 260 VVIEAGPA-GGYGMLVKLRHADGTVTLYGHINTALVSVGERVMAGDQIATMGNRGNSTGP 318

Query: 61  QVHFELRKNAI-AMDPIKFLEEK 82
            +HFE+ +     +DP+ +L ++
Sbjct: 319 HLHFEVLQGGTERIDPVPWLAKR 341


>gi|167738253|ref|ZP_02411027.1| lipoprotein NlpD, putative [Burkholderia pseudomallei 14]
          Length = 143

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 64  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 122

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 123 LHFEVRRQGKPVDPLKYLP 141


>gi|108801292|ref|YP_641489.1| peptidase M23B [Mycobacterium sp. MCS]
 gi|119870443|ref|YP_940395.1| peptidase M23B [Mycobacterium sp. KMS]
 gi|108771711|gb|ABG10433.1| peptidase M23B [Mycobacterium sp. MCS]
 gi|119696532|gb|ABL93605.1| peptidase M23B [Mycobacterium sp. KMS]
          Length = 360

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI VG      G  + +RH D  VT+Y H++T  V  G++V  G  I   G  GN+  P
Sbjct: 270 VVIDVGP-TAGYGAWVKLRHADGTVTLYGHLNTWSVSMGEQVMAGDQIATMGNRGNSTGP 328

Query: 61  QVHFELRKNA-IAMDPIKFLEEK 82
            +HFE+       +DP+ +L ++
Sbjct: 329 HLHFEVMVGGSNRIDPVGWLSKR 351


>gi|225552006|ref|ZP_03772946.1| M23 peptidase domain protein [Borrelia sp. SV1]
 gi|225371004|gb|EEH00434.1| M23 peptidase domain protein [Borrelia sp. SV1]
          Length = 417

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 IVVTAGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|78184721|ref|YP_377156.1| peptidoglycan-binding LysM [Synechococcus sp. CC9902]
 gi|78169015|gb|ABB26112.1| Peptidoglycan-binding LysM [Synechococcus sp. CC9902]
          Length = 358

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I H D   T Y+H     V+KGQ + +G  I L G +G +  P
Sbjct: 275 VVAFAGWS-GAYGYLVEIAHADGDSTRYAHNSRILVRKGQIIPQGSRISLMGSTGRSTGP 333

Query: 61  QVHFELRK-NAIAMDPIKFLEEK 82
            +HFE+R+    A++P+  L  +
Sbjct: 334 HLHFEIRRAGGAALNPLSKLPAR 356


>gi|219684568|ref|ZP_03539511.1| M23 peptidase domain protein [Borrelia garinii PBr]
 gi|219671930|gb|EED28984.1| M23 peptidase domain protein [Borrelia garinii PBr]
          Length = 417

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+ VG +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 IVVTVGFNAGGYGKYIIISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|167911013|ref|ZP_02498104.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei 112]
          Length = 334

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 189 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGTAVAQGQRIGAVGSTGAAT 248

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 249 GPHLHFEVRVDDQPVDPL 266


>gi|167738653|ref|ZP_02411427.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei 14]
          Length = 322

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 177 VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGTAVAQGQRIGAVGSTGAAT 236

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 237 GPHLHFEVRVDDQPVDPL 254


>gi|220915820|ref|YP_002491124.1| Peptidase M23 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219953674|gb|ACL64058.1| Peptidase M23 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 372

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      GN +++ H D   T+ +H+ +     G+ V  G  +G  G +G+ + P 
Sbjct: 294 VVHAGW-FKGYGNIVIVDHGDGYHTLVAHLASMRTAMGEDVPAGAVLGTVGDTGSLKGPY 352

Query: 62  VHFELRKNAIAMDPIKFL 79
           ++FELR+    +DP  +L
Sbjct: 353 LYFELREKGRPVDPRPWL 370


>gi|197121119|ref|YP_002133070.1| peptidase M23 [Anaeromyxobacter sp. K]
 gi|196170968|gb|ACG71941.1| Peptidase M23 [Anaeromyxobacter sp. K]
          Length = 373

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      GN +++ H D   T+ +H+ +     G+ V  G  +G  G +G+ + P 
Sbjct: 295 VVHAGW-FKGYGNIVIVDHGDGYHTLVAHLASMRTAMGEDVPAGAVLGTVGDTGSLKGPY 353

Query: 62  VHFELRKNAIAMDPIKFL 79
           ++FELR+    +DP  +L
Sbjct: 354 LYFELREKGRPVDPRPWL 371


>gi|148263991|ref|YP_001230697.1| peptidase M23B [Geobacter uraniireducens Rf4]
 gi|146397491|gb|ABQ26124.1| peptidase M23B [Geobacter uraniireducens Rf4]
          Length = 396

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+        GN +++ H     ++Y+H    + + G  V++   +   G + +++ P 
Sbjct: 319 VIFADY-FKGYGNMVIVDHGGGFFSLYAHAANLFKKVGATVAKNDVVASVGDTDSSKGPM 377

Query: 62  VHFELRKNAIAMDPIKFLE 80
           ++FE+R     +DP  +  
Sbjct: 378 LYFEIRYQGKPVDPSPWFR 396


>gi|327193412|gb|EGE60312.1| putative peptidase protein, M23/M37 family [Rhizobium etli
           CNPAF512]
          Length = 640

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           V   G D    GN  +IRH +   + Y+H       V  G K+ +G  IG  G +G +  
Sbjct: 524 VEKAGWDSGGYGNQTIIRHANGYESSYNHQSAIAKGVVPGAKIRQGQVIGWVGTTGESTG 583

Query: 60  PQVHFELRKNAIAMDPIKFLEEKIP 84
           P +H+EL  N   +DP   L  ++P
Sbjct: 584 PHLHYELIVNGTKVDP---LRIRLP 605


>gi|307266014|ref|ZP_07547561.1| Peptidase M23 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326389768|ref|ZP_08211333.1| Peptidase M23 [Thermoanaerobacter ethanolicus JW 200]
 gi|306918976|gb|EFN49203.1| Peptidase M23 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325994250|gb|EGD52677.1| Peptidase M23 [Thermoanaerobacter ethanolicus JW 200]
          Length = 389

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 40/65 (61%)

Query: 16  ILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDP 75
           ++I H D I T+Y H     V++G  V RG  I  +G +G +  P +HFE+RKN + +DP
Sbjct: 325 VIIDHGDGISTLYGHNSALLVKEGDMVKRGQVIAKAGSTGLSTGPHLHFEVRKNGVPVDP 384

Query: 76  IKFLE 80
           + +L+
Sbjct: 385 MDWLK 389


>gi|190893587|ref|YP_001980129.1| peptidase, M23/M37 family [Rhizobium etli CIAT 652]
 gi|190698866|gb|ACE92951.1| putative peptidase protein, M23/M37 family [Rhizobium etli CIAT
           652]
          Length = 640

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           V   G D    GN  +IRH +   + Y+H       V  G K+ +G  IG  G +G +  
Sbjct: 524 VEKAGWDSGGYGNQTIIRHANGYESSYNHQSAIAKGVVPGAKIRQGQVIGWVGTTGESTG 583

Query: 60  PQVHFELRKNAIAMDPIKFLEEKIP 84
           P +H+EL  N   +DP   L  ++P
Sbjct: 584 PHLHYELIVNGTKVDP---LRIRLP 605


>gi|167629006|ref|YP_001679505.1| peptidoglycan-binding peptidase m23b, putative [Heliobacterium
           modesticaldum Ice1]
 gi|167591746|gb|ABZ83494.1| peptidoglycan-binding peptidase m23b, putative [Heliobacterium
           modesticaldum Ice1]
          Length = 256

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G   V  G T++I H   + T+Y+H     V +G++V RG  I   G +G A  P 
Sbjct: 173 VVFAGWKAV-YGQTVIIEHPFGVATLYAHSSKILVNEGERVERGRPIAQVGATGVATGPH 231

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R ++ A++P  +L 
Sbjct: 232 LHFEVRLDSRAVNPAAYLR 250


>gi|86359336|ref|YP_471228.1| M24/M37 family peptidase [Rhizobium etli CFN 42]
 gi|86283438|gb|ABC92501.1| putative peptidase protein, M23/M37 family [Rhizobium etli CFN 42]
          Length = 640

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           V   G D    GN  +IRH +   + Y+H       V  G K+ +G  IG  G +G +  
Sbjct: 524 VEKAGWDSGGYGNQTIIRHANGYESSYNHQSAIAKGVVPGAKIRQGQVIGWVGTTGESTG 583

Query: 60  PQVHFELRKNAIAMDPIKFLEEKIP 84
           P +H+EL  N   +DP   L  ++P
Sbjct: 584 PHLHYELIVNGTKVDP---LRIRLP 605


>gi|167772187|ref|ZP_02444240.1| hypothetical protein ANACOL_03562 [Anaerotruncus colihominis DSM
           17241]
 gi|167665628|gb|EDS09758.1| hypothetical protein ANACOL_03562 [Anaerotruncus colihominis DSM
           17241]
          Length = 361

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 37/79 (46%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V     +    G  ++I H + + T+Y H      Q GQ V  G  + LSG +G +  P 
Sbjct: 279 VTVSQYNAGGYGYYVMIDHSNGLSTLYGHNSRLLAQVGQTVEAGDIVALSGSTGRSTGPH 338

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R N    +P  +L 
Sbjct: 339 LHFEVRVNGERTNPRFYLP 357


>gi|241204421|ref|YP_002975517.1| peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858311|gb|ACS55978.1| Peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 534

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 455 VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVTRGQKIQRGQTVAVSGMSGDVKQP 514

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 515 QVHFEVRKDASPVNPMTFLE 534


>gi|145631563|ref|ZP_01787330.1| lipoprotein [Haemophilus influenzae R3021]
 gi|144982832|gb|EDJ90354.1| lipoprotein [Haemophilus influenzae R3021]
          Length = 405

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSGTNT-VK 384

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    ++DP+++L  
Sbjct: 385 LHFEIRYKGKSVDPVRYLPR 404


>gi|332530283|ref|ZP_08406229.1| peptidase M23B [Hylemonella gracilis ATCC 19624]
 gi|332040269|gb|EGI76649.1| peptidase M23B [Hylemonella gracilis ATCC 19624]
          Length = 494

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  +++RH +   T+Y+H+    V+ GQ++++G T+  SG +G A  P
Sbjct: 380 VVEFAGEQ-GGYGKVVILRHRNGHQTLYAHLSRILVRHGQRIAQGQTLAASGATGWATGP 438

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +H+E R N    +P+  +  
Sbjct: 439 HLHYEFRINGQHQNPLLIVRR 459


>gi|307317053|ref|ZP_07596494.1| Peptidase M23 [Sinorhizobium meliloti AK83]
 gi|306897141|gb|EFN27886.1| Peptidase M23 [Sinorhizobium meliloti AK83]
          Length = 512

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 56/80 (70%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L ELGN +L+RHDD  VTVY +     VQ+GQKV RG T+  SG +G A  P
Sbjct: 433 VVIYSGSSLKELGNAVLVRHDDGTVTVYGNAAELKVQRGQKVQRGQTLASSGMTGRATRP 492

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RKNA  ++P  +LE
Sbjct: 493 QVHFEVRKNATPVNPATYLE 512


>gi|118467033|ref|YP_880327.1| M23 peptidase domain-containing protein [Mycobacterium avium 104]
 gi|118168320|gb|ABK69217.1| M23 peptidase domain protein [Mycobacterium avium 104]
          Length = 350

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G      G  + +RH D  VT+Y HI+T  V  G++V  G  I   G  GN+  P
Sbjct: 260 VVIEAGPA-GGYGMLVKLRHADGTVTLYGHINTALVSVGERVMAGDQIATMGNRGNSTGP 318

Query: 61  QVHFELRKNAI-AMDPIKFLEEK 82
            +HFE+ +     +DP+ +L ++
Sbjct: 319 HLHFEVLQGGTERIDPVPWLAKR 341


>gi|1754723|gb|AAB88077.1| lipoprotein [Sinorhizobium meliloti]
          Length = 512

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 56/80 (70%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L ELGN +L+RHDD  VTVY +     VQ+GQKV RG T+  SG +G A  P
Sbjct: 433 VVIYSGSSLKELGNAVLVRHDDGTVTVYGNAAELKVQRGQKVQRGQTLASSGMTGRATRP 492

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RKNA  ++P  +LE
Sbjct: 493 QVHFEVRKNATPVNPATYLE 512


>gi|15965289|ref|NP_385642.1| lipoprotein precursor [Sinorhizobium meliloti 1021]
 gi|307307879|ref|ZP_07587604.1| Peptidase M23 [Sinorhizobium meliloti BL225C]
 gi|15074469|emb|CAC46115.1| Lipoprotein precursor [Sinorhizobium meliloti 1021]
 gi|306901495|gb|EFN32098.1| Peptidase M23 [Sinorhizobium meliloti BL225C]
          Length = 512

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 56/80 (70%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L ELGN +L+RHDD  VTVY +     VQ+GQKV RG T+  SG +G A  P
Sbjct: 433 VVIYSGSSLKELGNAVLVRHDDGTVTVYGNAAELKVQRGQKVQRGQTLASSGMTGRATRP 492

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RKNA  ++P  +LE
Sbjct: 493 QVHFEVRKNATPVNPATYLE 512


>gi|188991945|ref|YP_001903955.1| Outer membrane lipoprotein [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167733705|emb|CAP51910.1| Outer membrane lipoprotein [Xanthomonas campestris pv. campestris]
          Length = 255

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H+D  ++ Y H     + +GQ V  G  I   G+SG A   
Sbjct: 175 VVVYSGAGLVGYGELIIIKHNDQWLSAYGHNRKRLLNEGQNVKAGQQIAEMGRSG-AARD 233

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L +K
Sbjct: 234 MLHFEIRYNGKPVDPLLYLPKK 255


>gi|221636052|ref|YP_002523928.1| lytic transglycosylase, catalytic [Thermomicrobium roseum DSM 5159]
 gi|221157769|gb|ACM06887.1| lytic transglycosylase, catalytic [Thermomicrobium roseum DSM 5159]
          Length = 327

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +VGN     G  I + H + + T+Y H+    V+ GQ+V RG  IG SG +G +  P 
Sbjct: 106 VRFVGN-TDGYGLRIEVDHGNGVTTLYGHLSAADVRPGQRVQRGQVIGKSGNTGLSTGPH 164

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+R+N  A+DP   L 
Sbjct: 165 LHYEIRQNGRAVDPGPLLR 183


>gi|91776178|ref|YP_545934.1| peptidase M23B [Methylobacillus flagellatus KT]
 gi|91710165|gb|ABE50093.1| peptidase M23B [Methylobacillus flagellatus KT]
          Length = 333

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 51/79 (64%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G+DL   G  ++I+H+++ ++VY+H     V++GQ+V+RG  I   G + +    +
Sbjct: 252 VIYSGSDLRGYGKLVIIKHNNTFLSVYAHNSNILVKEGQQVTRGQKIAEMGDT-DTDKVK 310

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+   ++DP K+L 
Sbjct: 311 LHFEIRRQGKSVDPSKYLP 329


>gi|77919918|ref|YP_357733.1| metalloendopeptidase-like membrane protein [Pelobacter carbinolicus
           DSM 2380]
 gi|77546001|gb|ABA89563.1| metalloendopeptidase-like membrane protein [Pelobacter carbinolicus
           DSM 2380]
          Length = 321

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 39/78 (50%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+       + G  +++ H     T+Y H     V+ GQ+V RG  I   G +G +  P 
Sbjct: 244 VVKRVRTASDYGKMVVVDHGYGYQTLYGHNSKVLVKVGQRVRRGDVIAHIGNTGRSTGPH 303

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N + ++P KF 
Sbjct: 304 LHYEVRLNGVPVNPRKFF 321


>gi|302383354|ref|YP_003819177.1| peptidase M23 [Brevundimonas subvibrioides ATCC 15264]
 gi|302193982|gb|ADL01554.1| Peptidase M23 [Brevundimonas subvibrioides ATCC 15264]
          Length = 209

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 45/80 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI +G+D    GN I +RH + + T+Y H+    V  G ++     IGL G +G +  P 
Sbjct: 114 VIRIGHDPSGYGNFIEMRHPNGLTTLYGHLSRIDVASGDRIGPRERIGLVGSTGYSTGPH 173

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R++   ++P + + +
Sbjct: 174 LHFEVRRDGAQVNPSRVMGQ 193


>gi|163793027|ref|ZP_02187003.1| Peptidase M23B [alpha proteobacterium BAL199]
 gi|159181673|gb|EDP66185.1| Peptidase M23B [alpha proteobacterium BAL199]
          Length = 472

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      G  + I H   ++T Y+H+    V++G+ V  G TIGL G SG +  P 
Sbjct: 384 VAFAGRRSR-YGRVVEIDHGHGLMTRYAHLAKITVRRGEAVKLGRTIGLLGSSGRSSGPH 442

Query: 62  VHFELRKNAIAMDPIKFLE 80
           VH+E+R N  A++P KFL+
Sbjct: 443 VHYEVRYNGKALNPAKFLK 461


>gi|171318961|ref|ZP_02908091.1| peptidase M23B [Burkholderia ambifaria MEX-5]
 gi|171095846|gb|EDT40790.1| peptidase M23B [Burkholderia ambifaria MEX-5]
          Length = 360

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G+ +++ H D   T Y+H+      ++ G+ V +G  IG  G +G A 
Sbjct: 215 VVSFVGTDPGGYGHYVIVDHADGYSTYYAHLSAYARGLKTGETVKQGQRIGSVGMTGAAT 274

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 275 GPHLHFEVRVANDPVDPL 292


>gi|147679169|ref|YP_001213384.1| membrane protein [Pelotomaculum thermopropionicum SI]
 gi|146275266|dbj|BAF61015.1| membrane protein [Pelotomaculum thermopropionicum SI]
          Length = 294

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      G  ++I H +   T+Y+H     V +G  V     I L+G +G +  P 
Sbjct: 211 VVFAGPR-GTYGLAVIIDHGNGTRTLYAHCSRILVSEGDSVGTSTIIALAGNTGRSNGPH 269

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +H E+ KN + MDP  FLE+
Sbjct: 270 LHLEVLKNGVPMDPALFLEQ 289


>gi|145639464|ref|ZP_01795069.1| outer membrane antigenic lipoprotein B [Haemophilus influenzae
           PittII]
 gi|145271511|gb|EDK11423.1| outer membrane antigenic lipoprotein B [Haemophilus influenzae
           PittII]
          Length = 405

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSGTNT-VK 384

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    ++DP+++L  
Sbjct: 385 LHFEIRYKGKSVDPVRYLPR 404


>gi|254252390|ref|ZP_04945708.1| Membrane protein related to metalloendopeptidase [Burkholderia
           dolosa AUO158]
 gi|124894999|gb|EAY68879.1| Membrane protein related to metalloendopeptidase [Burkholderia
           dolosa AUO158]
          Length = 479

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  +++ H D   T Y+H+      ++ G+ V +G  IG  G +G A 
Sbjct: 334 VVSFVGTDPGGYGRYVIVDHADGYSTYYAHLSAFARGLKVGEPVKQGQRIGSVGMTGAAT 393

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 394 GPHLHFEVRVANDPVDPL 411


>gi|119773502|ref|YP_926242.1| peptidase M23B [Shewanella amazonensis SB2B]
 gi|119766002|gb|ABL98572.1| peptidase M23B [Shewanella amazonensis SB2B]
          Length = 299

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G D+   G  + + H + + T Y H  T  V  G  V++G  I   G +G +  P
Sbjct: 217 VVTWAG-DMFGYGQLVEVDHGNGLRTRYGHNKTLSVAVGDVVAKGEKIATMGSTGRSTGP 275

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VH+E+ ++   +DP K++  K
Sbjct: 276 HVHYEVLRSGQQIDPQKYVYRK 297


>gi|325521808|gb|EGD00540.1| lipoprotein NlpD, putative [Burkholderia sp. TJI49]
          Length = 86

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2  VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
          V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S ++    
Sbjct: 7  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DSDRVM 65

Query: 62 VHFELRKNAIAMDPIKFLE 80
          +HFE+R+    +DP+K+L 
Sbjct: 66 LHFEVRRQGKPVDPLKYLP 84


>gi|94501415|ref|ZP_01307935.1| Membrane protein [Oceanobacter sp. RED65]
 gi|94426528|gb|EAT11516.1| Membrane protein [Oceanobacter sp. RED65]
          Length = 289

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V +  +     G  + + H +   T Y+H D   V+ G  V +G  + L G +G +  P
Sbjct: 207 VVTWA-SKRYGYGLLVEVNHGNGYKTRYAHCDEIVVKVGDVVRKGQVVALMGSTGRSTGP 265

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+ KN   +DP  ++
Sbjct: 266 HVHFEVYKNGRTVDPAAYI 284


>gi|187933752|ref|YP_001887703.1| peptidase, M23/M37 family [Clostridium botulinum B str. Eklund 17B]
 gi|187721905|gb|ACD23126.1| peptidase, M23/M37 family [Clostridium botulinum B str. Eklund 17B]
          Length = 395

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 44/72 (61%)

Query: 9   LVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRK 68
           +   GN I I+H+D + T+Y H+ +  V+KGQ++ +G  IG  G +G +  P +HFELR 
Sbjct: 322 VSGYGNMIKIKHEDGLETLYGHLSSINVKKGQEIKKGDVIGEVGSTGRSTGPHLHFELRS 381

Query: 69  NAIAMDPIKFLE 80
               ++P  +++
Sbjct: 382 KGTPINPELYIK 393


>gi|300775782|ref|ZP_07085643.1| M23 peptidase domain protein [Chryseobacterium gleum ATCC 35910]
 gi|300505809|gb|EFK36946.1| M23 peptidase domain protein [Chryseobacterium gleum ATCC 35910]
          Length = 342

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GN +++ H + + T+Y H+     +   KV  G  I  SG +G +  P 
Sbjct: 264 VIFSG-QKGGYGNCVIVSHSNGLATLYGHLSELISKVNDKVKVGQVIAKSGNTGRSTGPH 322

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +H+E+ KN   ++P  F+ 
Sbjct: 323 LHYEVHKNNTPVNPKLFMN 341


>gi|253577443|ref|ZP_04854758.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843143|gb|EES71176.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 324

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 44/80 (55%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V  V       GN IL++H + +V++Y H+    V++ Q+V +G  IG  G +G +  P 
Sbjct: 241 VTQVIRGSTGYGNAILLQHANGLVSLYGHLTDIGVRQRQQVLQGEVIGWVGSTGKSTGPH 300

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +H E+R N   +DP+ +  +
Sbjct: 301 LHLEIRVNGQKVDPLPYFRQ 320


>gi|226325464|ref|ZP_03800982.1| hypothetical protein COPCOM_03269 [Coprococcus comes ATCC 27758]
 gi|225206207|gb|EEG88561.1| hypothetical protein COPCOM_03269 [Coprococcus comes ATCC 27758]
          Length = 390

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI    +    GN I++ H + + T Y H+ +  V  GQ V+RG  IG  G +G +  P 
Sbjct: 314 VITAQYN-SARGNYIVVNHGNGMQTWYQHLSSMNVTVGQTVARGQVIGNVGTTGISTGPH 372

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+    + ++P+ +L
Sbjct: 373 LHFEVHVGGVPVNPLNYL 390


>gi|94500746|ref|ZP_01307275.1| peptidase M23/LysM domain protein [Oceanobacter sp. RED65]
 gi|94427068|gb|EAT12049.1| peptidase M23/LysM domain protein [Oceanobacter sp. RED65]
          Length = 271

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L+  GN ++I+H+   ++ Y+H     V++ Q+V     I   G SG     +
Sbjct: 192 VVYAGSGLLGYGNLVIIKHNQEFLSAYAHNKKLLVKENQQVKARQPIAEIGSSG-TDQVK 250

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+K+L +K
Sbjct: 251 LHFEIRRRGKPVDPLKYLPKK 271


>gi|41406993|ref|NP_959829.1| hypothetical protein MAP0895c [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41395344|gb|AAS03212.1| hypothetical protein MAP_0895c [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 375

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G      G  + +RH D  VT+Y HI+T  V  G++V  G  I   G  GN+  P
Sbjct: 285 VVIEAGPA-GGYGMLVKLRHADGTVTLYGHINTALVSVGERVMAGDQIATMGNRGNSTGP 343

Query: 61  QVHFELRKNAI-AMDPIKFLEEK 82
            +HFE+ +     +DP+ +L ++
Sbjct: 344 HLHFEVLQGGTERIDPVPWLAKR 366


>gi|297545166|ref|YP_003677468.1| peptidase M23 [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
 gi|296842941|gb|ADH61457.1| Peptidase M23 [Thermoanaerobacter mathranii subsp. mathranii str.
           A3]
          Length = 379

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 40/65 (61%)

Query: 16  ILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDP 75
           ++I H D I T+Y H     V++G  V RG  I  +G +G +  P +HFE+RKN + ++P
Sbjct: 315 VIIDHGDGISTLYGHNSALLVKEGDTVKRGQVIAKAGSTGLSTGPHLHFEVRKNGVPVNP 374

Query: 76  IKFLE 80
           + +L+
Sbjct: 375 MDWLK 379


>gi|289578954|ref|YP_003477581.1| peptidase M23 [Thermoanaerobacter italicus Ab9]
 gi|289528667|gb|ADD03019.1| Peptidase M23 [Thermoanaerobacter italicus Ab9]
          Length = 379

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 40/65 (61%)

Query: 16  ILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDP 75
           ++I H D I T+Y H     V++G  V RG  I  +G +G +  P +HFE+RKN + ++P
Sbjct: 315 VIIDHGDGISTLYGHNSALLVKEGDTVKRGQVIAKAGSTGLSTGPHLHFEVRKNGVPVNP 374

Query: 76  IKFLE 80
           + +L+
Sbjct: 375 MDWLK 379


>gi|218294610|ref|ZP_03495464.1| Peptidase M23 [Thermus aquaticus Y51MC23]
 gi|218244518|gb|EED11042.1| Peptidase M23 [Thermus aquaticus Y51MC23]
          Length = 299

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G  +   G  +L+ H +   T+Y H+    V+ G++V RG  +G  G +G +  P
Sbjct: 215 VVAQAGW-MGPYGLAVLLDHAEGYQTLYGHLSRLLVRPGERVERGQVLGYVGSTGRSTGP 273

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+ + +  +A+DP ++L+
Sbjct: 274 HLHYSVYRRGVAVDPRRYLD 293


>gi|302877588|ref|YP_003846152.1| Peptidase M23 [Gallionella capsiferriformans ES-2]
 gi|302580377|gb|ADL54388.1| Peptidase M23 [Gallionella capsiferriformans ES-2]
          Length = 290

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y        GN + I H + IVT Y+H     V+ GQ V RG  +   G +G +   
Sbjct: 208 VVVYADTHAQ-YGNMVEIDHGNDIVTRYAHASKLLVKAGQVVRRGDKVAEVGSTGRSTGN 266

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+R    A +P++FL+
Sbjct: 267 HLHFEVRYKGSAQNPVRFLQ 286


>gi|289663629|ref|ZP_06485210.1| peptidase [Xanthomonas campestris pv. vasculorum NCPPB702]
 gi|289671009|ref|ZP_06492084.1| peptidase [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 283

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  VT Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 194 VVSYAG-VRGGYGNVVEVDHGNGYVTRYAHNSRLVVKVGDLVRAGQQVARAGSSGRSTGA 252

Query: 61  QVHFELRKNAIAMDPIKFLEEKIP 84
            VHFE+  +   ++P KFL E  P
Sbjct: 253 HVHFEVWADGRVVNPRKFLGETTP 276


>gi|116070593|ref|ZP_01467862.1| Peptidoglycan-binding LysM [Synechococcus sp. BL107]
 gi|116065998|gb|EAU71755.1| Peptidoglycan-binding LysM [Synechococcus sp. BL107]
          Length = 336

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I H D   T Y+H     V+KGQ V +G  I L G +G +  P
Sbjct: 253 VVAFAGWS-GAYGYLVEISHADGDSTRYAHNSRILVRKGQIVPQGSRISLMGSTGRSTGP 311

Query: 61  QVHFELRK-NAIAMDPIKFLEEK 82
            +HFE+R+    A++P+  L  +
Sbjct: 312 HLHFEIRRAGGAALNPLSKLPTR 334


>gi|327189125|gb|EGE56310.1| lipoprotein precursor protein [Rhizobium etli CNPAF512]
          Length = 537

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 458 VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVARGQKIQRGQTVAVSGMSGDVKQP 517

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 518 QVHFEVRKDASPVNPMTFLE 537


>gi|190891518|ref|YP_001978060.1| lipoprotein precursor protein [Rhizobium etli CIAT 652]
 gi|190696797|gb|ACE90882.1| lipoprotein precursor protein [Rhizobium etli CIAT 652]
          Length = 529

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 450 VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVARGQKIQRGQTVAVSGMSGDVKQP 509

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 510 QVHFEVRKDASPVNPMTFLE 529


>gi|209549094|ref|YP_002281011.1| peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534850|gb|ACI54785.1| Peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 530

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 451 VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVARGQKIQRGQTVAVSGMSGDVKQP 510

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 511 QVHFEVRKDASPVNPMTFLE 530


>gi|116251812|ref|YP_767650.1| peptidase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256460|emb|CAK07544.1| putative peptidase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 542

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 463 VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVARGQKIQRGQTVAVSGMSGDVKQP 522

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 523 QVHFEVRKDASPVNPMTFLE 542


>gi|86357457|ref|YP_469349.1| lipoprotein precursor protein [Rhizobium etli CFN 42]
 gi|86281559|gb|ABC90622.1| lipoprotein precursor protein [Rhizobium etli CFN 42]
          Length = 529

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 450 VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVARGQKIQRGQTVAVSGMSGDVKQP 509

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 510 QVHFEVRKDASPVNPMTFLE 529


>gi|313672437|ref|YP_004050548.1| peptidase m23 [Calditerrivibrio nitroreducens DSM 19672]
 gi|312939193|gb|ADR18385.1| Peptidase M23 [Calditerrivibrio nitroreducens DSM 19672]
          Length = 325

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G      G  ++I H     T Y+H     V+ GQKV RG  + LSG SG++  P
Sbjct: 236 VVVYSGWQ-QGYGRLVVIDHGFGYKTKYAHNSALKVKVGQKVKRGTVVALSGSSGDSTGP 294

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
             H+E+     ++DP+KF++ 
Sbjct: 295 HCHYEIVIGNTSVDPLKFMKS 315


>gi|307546201|ref|YP_003898680.1| outer membrane lipoprotein [Halomonas elongata DSM 2581]
 gi|307218225|emb|CBV43495.1| predicted outer membrane lipoprotein [Halomonas elongata DSM 2581]
          Length = 368

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G+ +   GN IL++H+D  ++ Y+H DT  V++   V  G  I   G S +AQ  
Sbjct: 288 IVVYAGSGVRGYGNLILLKHNDEYLSAYAHNDTLRVKENDVVQAGEVIATMGDS-DAQDV 346

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
           ++HFE+RK+    DP+++L  +
Sbjct: 347 RLHFEVRKDGQPQDPLEYLPAR 368


>gi|118594435|ref|ZP_01551782.1| Peptidase M23B [Methylophilales bacterium HTCC2181]
 gi|118440213|gb|EAV46840.1| Peptidase M23B [Methylophilales bacterium HTCC2181]
          Length = 301

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G    + G  + I+H D + T Y+H     V +G  V++   IGL G +G +  P
Sbjct: 222 IVVASGYAP-DYGKFVKIKHGDGLETRYAHASKLLVSQGDIVTKEQVIGLVGSTGRSTGP 280

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +H+E+R +  ++DP +++++
Sbjct: 281 HLHYEIRLHGRSLDPRQYIKK 301


>gi|312879553|ref|ZP_07739353.1| Peptidase M23 [Aminomonas paucivorans DSM 12260]
 gi|310782844|gb|EFQ23242.1| Peptidase M23 [Aminomonas paucivorans DSM 12260]
          Length = 404

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 4   YVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVH 63
           + G  L   G  +++ H  ++ TVY+H+    V +G++V  G  IG  G +G A    +H
Sbjct: 329 FCGW-LRGYGQVVILDHGGNLTTVYAHLSKIEVSEGERVKAGDLIGRIGATGVATGSHLH 387

Query: 64  FELRKNAIAMDPIKFLE 80
           FE+R N  A +P+K+L+
Sbjct: 388 FEVRVNGKATNPMKYLQ 404


>gi|307312830|ref|ZP_07592460.1| Peptidase M23 [Escherichia coli W]
 gi|306907265|gb|EFN37771.1| Peptidase M23 [Escherichia coli W]
          Length = 372

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 300 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 358

Query: 62  VHFELRKNAIAMDP 75
           +HFE+R    +++P
Sbjct: 359 LHFEIRYKGKSVNP 372


>gi|325919678|ref|ZP_08181681.1| metalloendopeptidase-like membrane protein [Xanthomonas gardneri
           ATCC 19865]
 gi|325549841|gb|EGD20692.1| metalloendopeptidase-like membrane protein [Xanthomonas gardneri
           ATCC 19865]
          Length = 314

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  VT Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 224 VVSYAG-VRGGYGNVVEVDHGNGYVTRYAHNSRLVVKVGDLVRAGQQVARAGSSGRSTGA 282

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+  +   ++P KFL
Sbjct: 283 HVHFEVWADGRVVNPRKFL 301


>gi|323704627|ref|ZP_08116205.1| Peptidase M23 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323536089|gb|EGB25862.1| Peptidase M23 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 376

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  +   GN ++I + + I T+Y+H +   V  GQ+VS+G  I  SG +G A  P
Sbjct: 298 IVSYSG-LMEGYGNVVIINNGNGISTLYAHNEKLLVVVGQRVSKGEIIAYSGHTGWATGP 356

Query: 61  QVHFELRKNAIAMDPIKFLE 80
             HF +  N I ++P+ +L+
Sbjct: 357 HCHFGVYVNGIPVNPLLYLK 376


>gi|291299379|ref|YP_003510657.1| peptidase M23 [Stackebrandtia nassauensis DSM 44728]
 gi|290568599|gb|ADD41564.1| Peptidase M23 [Stackebrandtia nassauensis DSM 44728]
          Length = 398

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G +    GN   + H D++ T Y H  +  V  GQ VSRG  IG  G +G +    
Sbjct: 317 VVQAGWN-GGYGNYTCVYHGDNVSTCYGHQSSIGVSPGQHVSRGQRIGSVGTTGASTGNH 375

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R N   + P+ +L  
Sbjct: 376 LHFEVRVNGSPVQPLGWLPS 395


>gi|323144472|ref|ZP_08079074.1| peptidase, M23 family [Succinatimonas hippei YIT 12066]
 gi|322415750|gb|EFY06482.1| peptidase, M23 family [Succinatimonas hippei YIT 12066]
          Length = 339

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 5/88 (5%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN I+I H++   TVY H+   +V+KGQKV  G  I  SG +G    P
Sbjct: 216 VVYFSGYQ-RAAGNYIIIEHNNGYKTVYMHLSKRHVKKGQKVKLGQLIAKSGNTGRTSGP 274

Query: 61  QVHFELRKNAIAMDPIKF----LEEKIP 84
            +H+E+  N   +DP+K     L  + P
Sbjct: 275 HLHYEVHVNNRPVDPMKVDLPSLPSQKP 302


>gi|171322651|ref|ZP_02911415.1| peptidase M23B [Burkholderia ambifaria MEX-5]
 gi|171092006|gb|EDT37450.1| peptidase M23B [Burkholderia ambifaria MEX-5]
          Length = 230

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+   +T Y+H     V++GQ V++G TI   G S ++    
Sbjct: 151 VVYAGNGLRGYGNLIILKHNADYLTAYAHNRALLVKEGQSVTQGQTIAEMGNS-DSDRVA 209

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 210 LHFELRYGGRSIDPARYLPAR 230


>gi|319638144|ref|ZP_07992907.1| membrane peptidase [Neisseria mucosa C102]
 gi|317400417|gb|EFV81075.1| membrane peptidase [Neisseria mucosa C102]
          Length = 303

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S ++ Y H     V + Q V RG TI   G + +A   Q
Sbjct: 225 VVYAGSGLRGYGNLVIIQHNSSFLSAYGHNQRLLVNENQTVKRGQTIAHMGNT-DASRTQ 283

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 284 LHFEIRQNGKPVNPANYV 301


>gi|326335985|ref|ZP_08202162.1| peptidase [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325691949|gb|EGD33911.1| peptidase [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 324

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 42/77 (54%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V    ++    G  I I H     T+Y+H+    V+ GQKV RG  IG  G +G ++ P 
Sbjct: 223 VSRADSNSSGYGEHIRIDHGYGYETIYAHLSQYNVRPGQKVKRGDVIGYVGSTGRSEAPH 282

Query: 62  VHFELRKNAIAMDPIKF 78
           +H+E++KN   ++PI F
Sbjct: 283 LHYEVKKNGEHLNPINF 299


>gi|33151923|ref|NP_873276.1| lipoprotein [Haemophilus ducreyi 35000HP]
 gi|33148144|gb|AAP95665.1| lipoprotein [Haemophilus ducreyi 35000HP]
          Length = 372

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   G+ I+I+H +  ++ Y+H ++  V++   V  G  I   G +G   H +
Sbjct: 292 VVYAGNALEGYGHLIIIKHSNDFLSAYAHNESIKVKEKDMVKAGQIIAKMGNTGTNTH-K 350

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DPI++L  +
Sbjct: 351 LHFEIRYKGKSVDPIRYLPIR 371


>gi|121603418|ref|YP_980747.1| peptidase M23B [Polaromonas naphthalenivorans CJ2]
 gi|120592387|gb|ABM35826.1| peptidase M23B [Polaromonas naphthalenivorans CJ2]
          Length = 465

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + I+H +++ TVY+H+    VQ GQ VS+G TIGL G +G A  P
Sbjct: 349 VVEFAGVQN-GFGNVVFIKHRNNLETVYAHLSKINVQPGQTVSQGQTIGLVGSTGWATGP 407

Query: 61  QVHFELRKNAIAMDPI 76
            +HFE+R N +  DP+
Sbjct: 408 HLHFEVRVNGVQQDPM 423


>gi|309751696|gb|ADO81680.1| Outer membrane antigenic lipoprotein B [Haemophilus influenzae
           R2866]
          Length = 405

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++Y GN L   GN I+I+H+D  ++ Y+H D   V   Q+V  G  I   G SG     +
Sbjct: 326 IVYAGNALRGYGNLIIIKHNDDFLSAYAHNDKILVADQQEVKAGQDIAKMGSSGTNT-VK 384

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R    ++DP+++L  
Sbjct: 385 LHFEIRYKGKSVDPVRYLPR 404


>gi|312113115|ref|YP_004010711.1| peptidase M23 [Rhodomicrobium vannielii ATCC 17100]
 gi|311218244|gb|ADP69612.1| Peptidase M23 [Rhodomicrobium vannielii ATCC 17100]
          Length = 624

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 50/79 (63%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V YVG++L   GN ILIRH D  VT Y+H D   V+K   V RG  +  +G +G+A  P
Sbjct: 544 VVAYVGDELPGFGNLILIRHADEFVTAYAHTDEIMVRKCDVVKRGQVVAKAGSTGDASQP 603

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q+HFE+RKNA  +DP   L
Sbjct: 604 QLHFEIRKNAKPVDPAPLL 622


>gi|225075981|ref|ZP_03719180.1| hypothetical protein NEIFLAOT_01006 [Neisseria flavescens
           NRL30031/H210]
 gi|224952696|gb|EEG33905.1| hypothetical protein NEIFLAOT_01006 [Neisseria flavescens
           NRL30031/H210]
          Length = 431

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      GNT++IRH + + T+Y H+         +V  G  IG  G +G +  P 
Sbjct: 317 VIFKGWK-GGYGNTVMIRHANGVETLYGHMSAFS-PADGRVRAGEVIGFVGTTGRSTGPH 374

Query: 62  VHFELRKNAIAMDP 75
           +H+E R N   ++P
Sbjct: 375 LHYEARVNGQPVNP 388


>gi|51598522|ref|YP_072710.1| hypothetical protein BG0265 [Borrelia garinii PBi]
 gi|51573093|gb|AAU07118.1| conserved hypothetical protein [Borrelia garinii PBi]
          Length = 417

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+ VG +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 IVVTVGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|188587513|ref|YP_001919058.1| Peptidase M23 [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179352200|gb|ACB86470.1| Peptidase M23 [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 314

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y        GN I+I H     T Y+H+    V +G++V  G  IG  G +GN+  P 
Sbjct: 236 VVYRSYR-GGYGNLIIIDHGYGYTTYYAHLSDFNVSRGEQVESGDIIGYVGNTGNSTAPH 294

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+  N    +P +++
Sbjct: 295 LHYEVHVNNSPENPREYM 312


>gi|117919572|ref|YP_868764.1| peptidase M23B [Shewanella sp. ANA-3]
 gi|117611904|gb|ABK47358.1| peptidase M23B [Shewanella sp. ANA-3]
          Length = 298

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q V  G T+   G +G      
Sbjct: 219 VVYAGSALRGYGNLVIIKHSDDYLSAYAHADQILVEEKQHVLAGQTVAKMGSTG-TNQVM 277

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           + FE+R +  +++P+ +L ++
Sbjct: 278 LRFEIRYHGQSVNPLNYLPKQ 298


>gi|113969466|ref|YP_733259.1| peptidase M23B [Shewanella sp. MR-4]
 gi|114046699|ref|YP_737249.1| peptidase M23B [Shewanella sp. MR-7]
 gi|113884150|gb|ABI38202.1| peptidase M23B [Shewanella sp. MR-4]
 gi|113888141|gb|ABI42192.1| peptidase M23B [Shewanella sp. MR-7]
          Length = 298

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V++ Q V  G T+   G +G      
Sbjct: 219 VVYAGSALRGYGNLVIIKHSDDYLSAYAHADQILVEEKQHVLAGQTVAKMGSTG-TNQVM 277

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           + FE+R +  +++P+ +L ++
Sbjct: 278 LRFEIRYHGQSVNPLNYLPKQ 298


>gi|297624226|ref|YP_003705660.1| peptidase M23 [Truepera radiovictrix DSM 17093]
 gi|297165406|gb|ADI15117.1| Peptidase M23 [Truepera radiovictrix DSM 17093]
          Length = 374

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 40/85 (47%), Gaps = 4/85 (4%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  L   G  ++I+  D I   Y+H     V  GQ V  G  I   G +G    P 
Sbjct: 292 VTYSGW-LGGYGYLVIIQDGD-IEYYYAHASELLVSVGQWVEAGQVIARVGATGRVTGPH 349

Query: 62  VHFELRKNAIAMDPIKFLEE--KIP 84
           +HFE+R     +DP+ +LE   ++P
Sbjct: 350 LHFEIRIGGQPVDPLPYLERTAQLP 374


>gi|311104009|ref|YP_003976862.1| peptidase family M23 [Achromobacter xylosoxidans A8]
 gi|310758698|gb|ADP14147.1| peptidase family M23 family protein 2 [Achromobacter xylosoxidans
           A8]
          Length = 323

 Score = 92.1 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 38/70 (54%)

Query: 10  VELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN 69
              GN + I H D ++T Y+H  +  V++GQ V RG  +   G SG +  P +HFE+R  
Sbjct: 238 PGYGNMVEIDHGDGLITRYAHASSLMVKQGQLVERGQQVARVGSSGRSTGPHLHFEVRLA 297

Query: 70  AIAMDPIKFL 79
              +DP  FL
Sbjct: 298 GQPLDPRLFL 307


>gi|297618476|ref|YP_003703635.1| peptidase M23 [Syntrophothermus lipocalidus DSM 12680]
 gi|297146313|gb|ADI03070.1| Peptidase M23 [Syntrophothermus lipocalidus DSM 12680]
          Length = 444

 Score = 92.1 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      G T+ I H + IVT Y+H  +  V  G +V +G  I   G +G++    
Sbjct: 367 VIFAGRR-GGYGLTVEISHGNGIVTRYAHCSSILVNVGDQVDKGQIIARVGSTGHSTGSH 425

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+  N    +P+++L 
Sbjct: 426 LHFEVITNGTQRNPLQYLR 444


>gi|71908138|ref|YP_285725.1| peptidoglycan-binding LysM:peptidase M23B [Dechloromonas aromatica
           RCB]
 gi|71847759|gb|AAZ47255.1| Peptidoglycan-binding LysM:Peptidase M23B [Dechloromonas aromatica
           RCB]
          Length = 304

 Score = 92.1 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++++H+ + ++ Y+H     V++GQ+VSRG  I   G + +A+  +
Sbjct: 225 VVYAGSGLRGFGELVIVKHNATYLSAYAHNRKILVKEGQQVSRGQKIAEMGNT-DAESVK 283

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RK    +DP ++L ++
Sbjct: 284 LHFEIRKQGKPVDPAQYLPKR 304


>gi|227823184|ref|YP_002827156.1| putative metalloendopeptidase [Sinorhizobium fredii NGR234]
 gi|227342185|gb|ACP26403.1| putative metalloendopeptidase [Sinorhizobium fredii NGR234]
          Length = 651

 Score = 92.1 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V   G D    GN  LIRH +  V+ Y+H       V+ G KV +G  IG  G +G + 
Sbjct: 534 VVDKAGWDSGGYGNQTLIRHANGYVSSYNHQSAIAKNVKPGAKVVQGQVIGWVGTTGLST 593

Query: 59  HPQVHFELRKNAIAMDPIKFLEEKIP 84
            P +H+EL  N   +DP   L  ++P
Sbjct: 594 GPHLHYELIVNGNKVDP---LRIRLP 616


>gi|225025402|ref|ZP_03714594.1| hypothetical protein EIKCOROL_02300 [Eikenella corrodens ATCC
           23834]
 gi|224941846|gb|EEG23055.1| hypothetical protein EIKCOROL_02300 [Eikenella corrodens ATCC
           23834]
          Length = 337

 Score = 92.1 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 50/79 (63%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+++H+ + +T Y H     V++GQ V RG +I   G S ++Q  Q
Sbjct: 259 VVYSGSGLRGYGNLIIVQHNQTYLTAYGHNQRLLVREGQTVRRGQSIATMGNS-DSQRVQ 317

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFELRKN   +DP++++ 
Sbjct: 318 LHFELRKNGQPVDPLQYIP 336


>gi|218710551|ref|YP_002418172.1| membrane protein [Vibrio splendidus LGP32]
 gi|218323570|emb|CAV19795.1| Membrane protein [Vibrio splendidus LGP32]
          Length = 309

 Score = 92.1 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+D+ ++ Y+H D   V +GQ V  G  I   G SG +   +
Sbjct: 232 VVYSGNALRGYGNLVIVKHNDNYLSAYAHNDRLLVSEGQSVKPGQKIATMGSSGASS-VR 290

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    +++P ++L 
Sbjct: 291 LHFEIRYQGKSVNPKRYLP 309


>gi|192359906|ref|YP_001983376.1| peptidase [Cellvibrio japonicus Ueda107]
 gi|190686071|gb|ACE83749.1| peptidase [Cellvibrio japonicus Ueda107]
          Length = 309

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G    E GN + I+H   +VT Y+H  +  V+ G  V +G  I LSG +G +  P
Sbjct: 227 VVNWAGRHP-EYGNLVEIKHGSGLVTRYAHNKSNQVKVGDVVKKGQVIALSGSTGRSTAP 285

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+ KN   +DP  ++  
Sbjct: 286 HVHFEVYKNGRVVDPASYIRR 306


>gi|295132656|ref|YP_003583332.1| M23 family peptidase [Zunongwangia profunda SM-A87]
 gi|294980671|gb|ADF51136.1| M23 family peptidase [Zunongwangia profunda SM-A87]
          Length = 325

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/77 (37%), Positives = 43/77 (55%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V    N     GN I I H    V++Y+H+    V+KGQKV RG  IG  G +G ++ P 
Sbjct: 224 VTRADNHSTGYGNHIRIDHGYGYVSLYAHLYKYNVRKGQKVKRGDIIGFVGSTGRSEAPH 283

Query: 62  VHFELRKNAIAMDPIKF 78
           +H+E+ K+   ++PI F
Sbjct: 284 LHYEIFKDDEHINPINF 300


>gi|269836577|ref|YP_003318805.1| peptidase M23 [Sphaerobacter thermophilus DSM 20745]
 gi|269785840|gb|ACZ37983.1| Peptidase M23 [Sphaerobacter thermophilus DSM 20745]
          Length = 328

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/79 (41%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+ GN     GN + I+H D  VT+Y+H     VQ GQ V +G  I L+G +G +  P
Sbjct: 107 VVIFAGN-TDSYGNRVEIQHADGTVTLYAHNAELTVQPGQTVRKGEVIALAGSTGASTGP 165

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VH+E+R++  A+DP  FL
Sbjct: 166 HVHYEIRRDGQAIDPWTFL 184


>gi|241760454|ref|ZP_04758547.1| membrane peptidase [Neisseria flavescens SK114]
 gi|241318958|gb|EER55460.1| membrane peptidase [Neisseria flavescens SK114]
          Length = 303

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S ++ Y H     V + Q V RG TI   G + +A   Q
Sbjct: 225 VVYAGSGLRGYGNLVIIQHNSSFLSAYGHNQRLLVNENQTVKRGQTIAHMGNT-DASRTQ 283

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 284 LHFEIRQNGKPVNPANYV 301


>gi|121605472|ref|YP_982801.1| peptidase M23B [Polaromonas naphthalenivorans CJ2]
 gi|120594441|gb|ABM37880.1| peptidase M23B [Polaromonas naphthalenivorans CJ2]
          Length = 301

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L   GN I+++H+++ +T Y+H  +  V++ Q V +G  I   G S +++  +
Sbjct: 222 VVYSGAGLRGYGNLIILKHNNTFLTAYAHNKSLLVKEDQTVKKGQKIAEMGNS-DSEKVK 280

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP K+L  K
Sbjct: 281 LHFEIRRQGKPVDPAKYLPAK 301


>gi|115351255|ref|YP_773094.1| peptidase M23B [Burkholderia ambifaria AMMD]
 gi|115281243|gb|ABI86760.1| peptidase M23B [Burkholderia ambifaria AMMD]
          Length = 230

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+   +T Y+H     V++GQ V++G TI   G S ++    
Sbjct: 151 VVYAGNGLRGYGNLIILKHNADYLTAYAHNRALLVKEGQSVTQGQTIAEMGNS-DSDRVA 209

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 210 LHFELRYGGRSIDPARYLPAR 230


>gi|224534310|ref|ZP_03674888.1| M23 peptidase domain protein [Borrelia spielmanii A14S]
 gi|224514412|gb|EEF84728.1| M23 peptidase domain protein [Borrelia spielmanii A14S]
          Length = 417

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+ VG +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 IVVTVGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|167894367|ref|ZP_02481769.1| metallopeptidase [Burkholderia pseudomallei 7894]
          Length = 177

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  ++I H D   T Y+H+    P ++ G  V++G  IG  G +G A 
Sbjct: 32  VVSFVGYDPGGYGKYVVIDHPDRSSTYYAHLSAFAPKLEVGMAVAQGQRIGAVGSTGAAT 91

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 92  GPHLHFEVRVDDQPVDPL 109


>gi|311694173|gb|ADP97046.1| peptidase M23B [marine bacterium HP15]
          Length = 296

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L+  GN I++ H++  ++ Y+H     VQ+G+ V  G  I   G SG A+ P 
Sbjct: 217 VVYAGNGLLGYGNLIIVNHNEHYLSAYAHNRKILVQEGEDVKAGQVIAELGSSG-AERPM 275

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN   +DP+ +L  +
Sbjct: 276 LHFEIRKNGNPVDPVHYLPPR 296


>gi|326794472|ref|YP_004312292.1| peptidase M23 [Marinomonas mediterranea MMB-1]
 gi|326545236|gb|ADZ90456.1| Peptidase M23 [Marinomonas mediterranea MMB-1]
          Length = 289

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G+ L+  G  ++I+H++  ++ Y++ +   V++ Q V  G ++ + G  G ++ P
Sbjct: 209 IVVYAGSGLIGYGKLVIIKHNEIYLSAYAYNERILVKEQQSVRAGDSLAIIGGKG-SEKP 267

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+RK+   ++P+  L ++
Sbjct: 268 LLHFEVRKDGQPVNPLNVLPKR 289


>gi|312143852|ref|YP_003995298.1| Peptidase M23 [Halanaerobium sp. 'sapolanicus']
 gi|311904503|gb|ADQ14944.1| Peptidase M23 [Halanaerobium sp. 'sapolanicus']
          Length = 410

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G  +   G T++I H +++ T+Y H     V +G+ V +G  I LSG +G +  P 
Sbjct: 333 VVNSGW-MNGFGYTVVIDHGNNVETLYGHNSRLLVSRGENVQQGQKIALSGNTGMSTGPH 391

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HF + +N   ++P  FL 
Sbjct: 392 LHFGVLRNDEPLNPRDFLP 410


>gi|166710661|ref|ZP_02241868.1| peptidase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 313

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  VT Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 224 VVSYAG-VRGGYGNVVEVDHGNGYVTRYAHNSRLVVKVGDLVRAGQQVARAGSSGRSTAA 282

Query: 61  QVHFELRKNAIAMDPIKFLEEKIP 84
            VHFE+  +   ++P KFL E  P
Sbjct: 283 HVHFEVWADGRVVNPRKFLGETTP 306


>gi|58583442|ref|YP_202458.1| peptidase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|58428036|gb|AAW77073.1| peptidase [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 325

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  VT Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 236 VVSYAG-VRGGYGNVVEVDHGNGYVTRYAHNSRLVVKVGDLVRAGQQVARAGSSGRSTAA 294

Query: 61  QVHFELRKNAIAMDPIKFLEEKIP 84
            VHFE+  +   ++P KFL E  P
Sbjct: 295 HVHFEVWADGRVVNPRKFLGETTP 318


>gi|50086466|ref|YP_047976.1| putative signal peptide [Acinetobacter sp. ADP1]
 gi|49532442|emb|CAG70154.1| conserved hypothetical protein; putative signal peptide
           [Acinetobacter sp. ADP1]
          Length = 241

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      G  + I H +  +T Y+H     VQ G +VS G  I   G +G    P
Sbjct: 160 IVTKAGWGT-GYGQYVEINHGNGYLTRYAHASRIMVQVGDRVSAGERIANVGCTGRCTGP 218

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+ K+    +P  +L
Sbjct: 219 HLHFEVVKDGQRKNPGSYL 237


>gi|28199727|ref|NP_780041.1| peptidase [Xylella fastidiosa Temecula1]
 gi|182682473|ref|YP_001830633.1| peptidase M23 [Xylella fastidiosa M23]
 gi|28057848|gb|AAO29690.1| peptidase [Xylella fastidiosa Temecula1]
 gi|182632583|gb|ACB93359.1| Peptidase M23 [Xylella fastidiosa M23]
 gi|307578755|gb|ADN62724.1| peptidase M23 [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 319

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  +T Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 225 VVSYAGYRN-GYGNVVDVDHSNGYLTRYAHNSRLTVKVGDLVRTGQEVAKAGSSGRSTGA 283

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFEL K+ + M+PIKFL
Sbjct: 284 HVHFELWKDGVVMNPIKFL 302


>gi|220933180|ref|YP_002510088.1| peptidase M23B [Halothermothrix orenii H 168]
 gi|219994490|gb|ACL71093.1| peptidase M23B [Halothermothrix orenii H 168]
          Length = 334

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G  +   G  + I H     T Y+H++   V+KGQ V RG  I LSG SG +  P 
Sbjct: 256 VTFAGW-MNGYGWVVKIYHGFGFETRYAHLNRIKVKKGQWVKRGQVIALSGNSGKSTGPH 314

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +H+E+RKN I  +P  ++  
Sbjct: 315 LHYEVRKNNIPQNPRNYIGR 334


>gi|260577846|ref|ZP_05845780.1| peptidoglycan-binding LysM [Corynebacterium jeikeium ATCC 43734]
 gi|258604073|gb|EEW17316.1| peptidoglycan-binding LysM [Corynebacterium jeikeium ATCC 43734]
          Length = 252

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN I I+HDD  VTVY H+ T  V+ G +V+ G  I   G  G +    
Sbjct: 168 VIDSGPA-SGFGNWIRIKHDDGTVTVYGHMATLDVKVGDRVTSGQKIAGMGSLGFSTGSH 226

Query: 62  VHFELRKN-AIAMDPIKFLEEK 82
           +HFE+R N   A+DP  +L E+
Sbjct: 227 LHFEVRPNGGEAVDPKPWLAER 248


>gi|197121186|ref|YP_002133137.1| peptidase M23 [Anaeromyxobacter sp. K]
 gi|220915887|ref|YP_002491191.1| Peptidase M23 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|196171035|gb|ACG72008.1| Peptidase M23 [Anaeromyxobacter sp. K]
 gi|219953741|gb|ACL64125.1| Peptidase M23 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 305

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G +    G  +++ H   + T Y+H+   +V+ G +V RG  +   G +G +  P 
Sbjct: 227 VVFAGTE-GAYGKVLVLDHGYGVKTRYAHLSEVFVRLGDRVKRGDKVAAVGNTGRSTGPH 285

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N I  +P KF+
Sbjct: 286 LHYEVRVNGIPENPRKFI 303


>gi|253701592|ref|YP_003022781.1| peptidase M23 [Geobacter sp. M21]
 gi|251776442|gb|ACT19023.1| Peptidase M23 [Geobacter sp. M21]
          Length = 397

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+  N     GN +++ H D   ++Y+H  +   + G KVS+   +   G+  +++ P 
Sbjct: 320 VIFA-NYFKGYGNMVIVDHGDGFFSLYAHASSMTKRVGAKVSKNEVLASVGEVDSSKGPM 378

Query: 62  VHFELRKNAIAMDPIKFLE 80
           ++FE+R     +DP  +  
Sbjct: 379 LYFEIRYQGKPVDPSPWFR 397


>gi|163759873|ref|ZP_02166957.1| hypothetical protein HPDFL43_16621 [Hoeflea phototrophica DFL-43]
 gi|162282831|gb|EDQ33118.1| hypothetical protein HPDFL43_16621 [Hoeflea phototrophica DFL-43]
          Length = 649

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 5/86 (5%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V   G D    G   +IRH +  V+ YSH ++    V+ G +V +G  IG  G +G + 
Sbjct: 531 VVEEAGWDKGGYGRQTIIRHANGYVSSYSHQNSIAKGVKPGARVRQGQVIGTVGSTGLST 590

Query: 59  HPQVHFELRKNAIAMDPIKFLEEKIP 84
            P +H+EL  N   +DP   L  ++P
Sbjct: 591 GPHLHYELIVNGTKVDP---LRIRLP 613


>gi|111115087|ref|YP_709705.1| hypothetical protein BAPKO_0272 [Borrelia afzelii PKo]
 gi|216263981|ref|ZP_03435975.1| M23 peptidase domain protein [Borrelia afzelii ACA-1]
 gi|110890361|gb|ABH01529.1| conserved hypothetical protein [Borrelia afzelii PKo]
 gi|215980025|gb|EEC20847.1| M23 peptidase domain protein [Borrelia afzelii ACA-1]
          Length = 417

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+ VG +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 IVVTVGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAIIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|300312264|ref|YP_003776356.1| NlpD precursor lipoprotein [Herbaspirillum seropedicae SmR1]
 gi|300075049|gb|ADJ64448.1| NlpD precursor lipoprotein [Herbaspirillum seropedicae SmR1]
          Length = 332

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ +   GN ++I+H  ++++ Y+H  T  V++GQ V++G  I   GKS ++   +
Sbjct: 253 VMYAGSGIRGYGNLVIIKHTSNLLSAYAHNQTILVKEGQSVTKGQKIAEMGKS-DSDTVK 311

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP K+L  +
Sbjct: 312 LHFEIRQQGKPVDPSKYLPPR 332


>gi|254283339|ref|ZP_04958307.1| peptidase M23B [gamma proteobacterium NOR51-B]
 gi|219679542|gb|EED35891.1| peptidase M23B [gamma proteobacterium NOR51-B]
          Length = 292

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  L   G  ++I+H++  ++ Y H D   V++G  V  G  I   G +G     
Sbjct: 212 VVVYAGTGLSGYGALLIIKHNERFLSAYGHNDAMLVKEGDGVREGQQIARMGSTG-TDSV 270

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
           ++HFE+R++   ++P+K L  +
Sbjct: 271 KLHFEIRQDGKPVNPLKLLPAR 292


>gi|254420013|ref|ZP_05033737.1| M23 peptidase domain protein [Brevundimonas sp. BAL3]
 gi|196186190|gb|EDX81166.1| M23 peptidase domain protein [Brevundimonas sp. BAL3]
          Length = 211

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           ++  G D    GN I +RH + + TVY H+    V  G  V+ G  IGL G +G +  P 
Sbjct: 122 IVRTGYDAGGYGNFIEVRHPNGLSTVYGHLSRIDVASGDAVTPGQRIGLVGSTGYSTGPH 181

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R+N   ++P K +  
Sbjct: 182 LHFEVRRNGGQVNPTKVMGR 201


>gi|146329106|ref|YP_001210188.1| M23 peptidase domain-containing protein [Dichelobacter nodosus
           VCS1703A]
 gi|146232576|gb|ABQ13554.1| M23peptidase domain protein [Dichelobacter nodosus VCS1703A]
          Length = 354

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  ++I+HD+   T Y+H+    V  G  + RG  IG  G +G +  P
Sbjct: 240 IVAFAGWQ-GNYGKLVVIKHDNGYETRYAHLSDIAVNMGDIIKRGAVIGKLGNTGFSTGP 298

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E+R N +A DP+K 
Sbjct: 299 HLHYEVRINGVACDPMKV 316


>gi|134295390|ref|YP_001119125.1| peptidase M23B [Burkholderia vietnamiensis G4]
 gi|134138547|gb|ABO54290.1| peptidase M23B [Burkholderia vietnamiensis G4]
          Length = 232

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+   +T Y+H     V++GQ V++G TI   G S ++    
Sbjct: 153 VVYAGNGLRGYGNLIILKHNADYLTAYAHNRALLVREGQSVTQGQTIAEMGSS-DSDRVA 211

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 212 LHFELRYGGRSIDPARYLPAR 232


>gi|261364767|ref|ZP_05977650.1| LysM domain/M23 peptidase domain protein [Neisseria mucosa ATCC
           25996]
 gi|288567075|gb|EFC88635.1| LysM domain/M23 peptidase domain protein [Neisseria mucosa ATCC
           25996]
          Length = 298

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S ++ Y H     V +GQ V RG TI   G + +A   Q
Sbjct: 220 VVYAGSGLRGYGNLVIIQHNSSFLSAYGHNQRLLVNEGQNVKRGQTIAQMGNT-DANRTQ 278

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 279 LHFEVRQNGKPVNPATYI 296


>gi|127514374|ref|YP_001095571.1| peptidase M23B [Shewanella loihica PV-4]
 gi|126639669|gb|ABO25312.1| peptidase M23B [Shewanella loihica PV-4]
          Length = 299

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + GN +   G  + I H + + T Y H  +  V  G  V++G +I   G +G +  P
Sbjct: 217 VVTWAGN-MFGYGELVEIDHGNGLRTRYGHNKSLSVAVGDVVAKGESIAKMGSTGRSTGP 275

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VH+E+ +    +DP K++  K
Sbjct: 276 HVHYEVLRGGQQIDPKKYVYRK 297


>gi|17229854|ref|NP_486402.1| lipoprotein [Nostoc sp. PCC 7120]
 gi|17131454|dbj|BAB74061.1| lipoprotein [Nostoc sp. PCC 7120]
          Length = 77

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 3  IYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQV 62
          I+ G      G T++I H   I T+Y H    YV +GQ V RG  I   G +G +  P +
Sbjct: 2  IFAGW-YGGYGRTVIINHGGGITTLYGHASELYVSEGQTVQRGQAIASVGSTGLSTGPHL 60

Query: 63 HFELRKNAIAMDPIKFL 79
          HFE+R+N   ++P  +L
Sbjct: 61 HFEVRRNGTPVNPADYL 77


>gi|299144272|ref|ZP_07037352.1| peptidase, M23/M37 family [Peptoniphilus sp. oral taxon 386 str.
           F0131]
 gi|298518757|gb|EFI42496.1| peptidase, M23/M37 family [Peptoniphilus sp. oral taxon 386 str.
           F0131]
          Length = 377

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 46/78 (58%), Gaps = 2/78 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI     +   GN +++ H D IVTVY+H  +  V+ GQ VS+G  + L G +G +  P 
Sbjct: 302 VIMA-RAMSGYGNVVMVDHGD-IVTVYAHNSSIKVKVGQSVSQGDIVALVGSTGLSTGPH 359

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N   +DP+ +L
Sbjct: 360 LHFEVRINGQTVDPMGYL 377


>gi|167587238|ref|ZP_02379626.1| Peptidase M23B [Burkholderia ubonensis Bu]
          Length = 393

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYV--QKGQKVSRGHTIGLSGKSGNAQH 59
           V +VG D    G  +++ H D   T Y+H+       + G++V +G  IG  G +G A  
Sbjct: 249 VSFVGTDPGGYGRYVIVDHTDGYSTYYAHLSAFAHGLKVGERVRQGERIGSVGMTGAATG 308

Query: 60  PQVHFELRKNAIAMDPI 76
           P +HFE+R     +DP+
Sbjct: 309 PHLHFEVRVADQPVDPL 325


>gi|327479570|gb|AEA82880.1| peptidase [Pseudomonas stutzeri DSM 4166]
          Length = 324

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      G  + I H + +VT Y+H+    V+KG  V+    IG  G +G +  P 
Sbjct: 233 VRFAGYR-GAYGKLVEIDHGNRLVTRYAHLSRLDVRKGDVVTPAQRIGAVGSTGRSTGPH 291

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+      +DP +FL
Sbjct: 292 LHFEVLHKGRFVDPQRFL 309


>gi|307824680|ref|ZP_07654904.1| Peptidase M23 [Methylobacter tundripaludum SV96]
 gi|307734334|gb|EFO05187.1| Peptidase M23 [Methylobacter tundripaludum SV96]
          Length = 297

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G  L+  GN ++I+H+D  ++ Y++     V +G  V +G  I   G++G +    
Sbjct: 218 VVYSGQGLIGYGNLLIIKHNDLYLSAYANNSRLLVAEGYTVEKGEVIAKVGQAG-SNKTS 276

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN   ++P+ FL EK
Sbjct: 277 LHFEIRKNGKPVNPLSFLPEK 297


>gi|224417872|ref|ZP_03655878.1| hypothetical protein HcanM9_01213 [Helicobacter canadensis MIT
           98-5491]
 gi|253827211|ref|ZP_04870096.1| putative peptidase [Helicobacter canadensis MIT 98-5491]
 gi|253510617|gb|EES89276.1| putative peptidase [Helicobacter canadensis MIT 98-5491]
          Length = 409

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 3/81 (3%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           VI+ G      G T++I+H++   T+Y H+      ++ G  VS+G  IG  G +G +  
Sbjct: 267 VIFAGTK-GGYGKTVIIQHENGYRTLYGHMHKINKGIRTGVYVSQGKQIGTVGSTGLSTG 325

Query: 60  PQVHFELRKNAIAMDPIKFLE 80
           P +HF L KN  A++P K L 
Sbjct: 326 PHLHFGLYKNGSAINPQKHLR 346


>gi|146281392|ref|YP_001171545.1| peptidase [Pseudomonas stutzeri A1501]
 gi|145569597|gb|ABP78703.1| peptidase [Pseudomonas stutzeri A1501]
          Length = 331

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G      G  + I H + +VT Y+H+    V+KG  V+    IG  G +G +  P 
Sbjct: 240 VRFAGYR-GAYGKLVEIDHGNRLVTRYAHLSRLDVRKGDVVTPAQRIGAVGSTGRSTGPH 298

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+      +DP +FL
Sbjct: 299 LHFEVLHKGRFVDPQRFL 316


>gi|33863024|ref|NP_894584.1| LysM motif-containing protein [Prochlorococcus marinus str. MIT
           9313]
 gi|33634941|emb|CAE20927.1| LysM motif:Peptidase family M23/M37 [Prochlorococcus marinus str.
           MIT 9313]
          Length = 357

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 2/84 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      G  + I H +   T Y+H +   V+KGQ + +G TI   G +G +  P
Sbjct: 254 IVSYAGWK-GAYGYLVEIAHVNGDSTRYAHNNRLLVKKGQILPQGATIATMGSTGRSTGP 312

Query: 61  QVHFELRKN-AIAMDPIKFLEEKI 83
            +HFE+RK    A++P   L  KI
Sbjct: 313 HLHFEIRKKSGTAINPATLLPSKI 336


>gi|328956924|ref|YP_004374310.1| hypothetical protein CAR_c05970 [Carnobacterium sp. 17-4]
 gi|328673248|gb|AEB29294.1| conserved hypothetical protein [Carnobacterium sp. 17-4]
          Length = 439

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTP--YVQKGQKVSRGHTIGLSGKSGNAQH 59
           V++ G      G  + I H + + T+Y+H+ +    V  GQ+VS+G  IG  G +G++  
Sbjct: 361 VVFAGYH-SSWGYYVKIDHGNGVQTLYAHMVSGSLLVTAGQQVSQGQQIGTMGTTGSSTG 419

Query: 60  PQVHFELRKNAIAMDPIKFL 79
             +HFE+  N   +DP  +L
Sbjct: 420 VHLHFEVYVNGSRVDPAGYL 439


>gi|310828772|ref|YP_003961129.1| phage protein [Eubacterium limosum KIST612]
 gi|308740506|gb|ADO38166.1| phage protein [Eubacterium limosum KIST612]
          Length = 1189

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 2    VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
            V   G +    GN ++I H   + T+Y H+      +G  V++G  IGL G +GN+  P 
Sbjct: 1002 VELAGPN-GGYGNCVIIDHGGGLKTLYGHMSVIGTSEGASVAQGQVIGLVGSTGNSTGPH 1060

Query: 62   VHFELRKNAIAMDPIKFLE 80
            +HF +      +DP+K   
Sbjct: 1061 LHFSVIMGGEQIDPLKLFP 1079


>gi|149190124|ref|ZP_01868400.1| membrane protein [Vibrio shilonii AK1]
 gi|148836013|gb|EDL52974.1| membrane protein [Vibrio shilonii AK1]
          Length = 318

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+D+ ++ Y+H D   V +GQ V  G  I   G SG     +
Sbjct: 241 VVYSGNALRGYGNLVIVKHNDNYLSAYAHNDRLLVSEGQSVKAGQKIATMGSSGTNS-VR 299

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    +++P ++L 
Sbjct: 300 LHFEIRYQGKSVNPKRYLP 318


>gi|332652692|ref|ZP_08418437.1| peptidase, M23/M37 family [Ruminococcaceae bacterium D16]
 gi|332517838|gb|EGJ47441.1| peptidase, M23/M37 family [Ruminococcaceae bacterium D16]
          Length = 415

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+         GN +++ H D   T+Y+H+    V KGQ VS+G  +G  G +G++    
Sbjct: 321 VVTTSTYNSSYGNYVVVSHSDGTSTLYAHMSRRGVSKGQTVSQGQVVGYVGTTGSSTGNH 380

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N   +DP+ + 
Sbjct: 381 LHFEIRVNGSRVDPVNYF 398


>gi|170728845|ref|YP_001762871.1| peptidase M23B [Shewanella woodyi ATCC 51908]
 gi|169814192|gb|ACA88776.1| peptidase M23B [Shewanella woodyi ATCC 51908]
          Length = 299

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G  +   G  + I H + + T Y H  +  V  G  +++G  I   G +G +  P
Sbjct: 217 VVTWAGK-MFGYGELVEIDHGNGLRTRYGHNKSLSVAVGDVIAKGENIAKMGSTGRSTGP 275

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VH+E+ +    +DP K++  K
Sbjct: 276 HVHYEVLRGGQQIDPQKYVYRK 297


>gi|15839294|ref|NP_299982.1| hypothetical protein XF2705 [Xylella fastidiosa 9a5c]
 gi|9107948|gb|AAF85502.1|AE004076_7 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 455

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           MV++    +   G  +++ H +  +++Y++ DT     G  V RG  +   G+SG     
Sbjct: 375 MVVFAEW-MTGYGMILIVDHGNGYMSLYANNDTLLRNPGTYVKRGELVAKVGRSGGQGVS 433

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            ++FELR N   ++P+ +L+++
Sbjct: 434 ALYFELRHNGQPINPLSWLQKR 455


>gi|37519967|ref|NP_923344.1| hypothetical protein glr0398 [Gloeobacter violaceus PCC 7421]
 gi|35210959|dbj|BAC88339.1| glr0398 [Gloeobacter violaceus PCC 7421]
          Length = 251

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 40/71 (56%)

Query: 10  VELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN 69
              GN +LI H     T Y+H+D+  VQ G  V  G  IG +G +G ++ P +HFEL  N
Sbjct: 64  GGYGNAVLIDHGGGWKTRYAHLDSVRVQAGAPVEAGKPIGRAGNTGLSKGPHLHFELLHN 123

Query: 70  AIAMDPIKFLE 80
              +DP+ +L+
Sbjct: 124 GRPVDPMPYLQ 134


>gi|269215024|ref|ZP_06158991.1| LysM domain/M23 peptidase domain protein [Neisseria lactamica ATCC
           23970]
 gi|269208515|gb|EEZ74970.1| LysM domain/M23 peptidase domain protein [Neisseria lactamica ATCC
           23970]
          Length = 338

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 260 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 318

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 319 LHFEVRQNGKPVNPNSYI 336


>gi|170697979|ref|ZP_02889062.1| peptidase M23B [Burkholderia ambifaria IOP40-10]
 gi|170137145|gb|EDT05390.1| peptidase M23B [Burkholderia ambifaria IOP40-10]
          Length = 230

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+   +T Y+H     V++GQ V++G TI   G S ++    
Sbjct: 151 VVYAGNGLRGYGNLIILKHNADYLTAYAHNRALLVKEGQSVTQGQTIAEMGNS-DSDRVA 209

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 210 LHFELRYGGRSIDPARYLPAR 230


>gi|117927585|ref|YP_872136.1| peptidase M23B [Acidothermus cellulolyticus 11B]
 gi|117648048|gb|ABK52150.1| peptidase M23B [Acidothermus cellulolyticus 11B]
          Length = 271

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G+     G  + I   D   T Y H+    V  G+ V  G  I   G +G+A  P 
Sbjct: 188 VIFAGSAP-GYGRLVKIADSDGTQTWYGHMSRILVHVGETVHAGEEIATVGAAGDATGPH 246

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R + + +DP+ FL  +
Sbjct: 247 LHFEVRVDGVPVDPVPFLAAR 267


>gi|94971718|ref|YP_593766.1| peptidase M23B [Candidatus Koribacter versatilis Ellin345]
 gi|94553768|gb|ABF43692.1| peptidase M23B [Candidatus Koribacter versatilis Ellin345]
          Length = 302

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 41/83 (49%), Gaps = 1/83 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V +  +     G  I + H   IVT Y H+    V +GQ V RG  IG  G SG    P 
Sbjct: 213 VTFA-DFYSGYGRMISLDHGHGIVTRYGHLSGFTVIEGQHVQRGQVIGYVGMSGRTTGPH 271

Query: 62  VHFELRKNAIAMDPIKFLEEKIP 84
           +H+E+R N   ++P K+L +  P
Sbjct: 272 LHYEVRINDTPVNPKKYLRKLSP 294


>gi|15966360|ref|NP_386713.1| hypothetical protein SMc02432 [Sinorhizobium meliloti 1021]
 gi|307313054|ref|ZP_07592681.1| Peptidase M23 [Sinorhizobium meliloti BL225C]
 gi|307321061|ref|ZP_07600467.1| Peptidase M23 [Sinorhizobium meliloti AK83]
 gi|15075631|emb|CAC47186.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306893336|gb|EFN24116.1| Peptidase M23 [Sinorhizobium meliloti AK83]
 gi|306899373|gb|EFN30007.1| Peptidase M23 [Sinorhizobium meliloti BL225C]
          Length = 646

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V   G D    GN  LIRH +  V+ Y+H       V+ G KV +G  IG  G +G + 
Sbjct: 530 VVQKAGWDSGGYGNQTLIRHANGYVSSYNHQSAIAKSVKPGTKVVQGQVIGWVGTTGLST 589

Query: 59  HPQVHFELRKNAIAMDPIKFLEEKIP 84
            P +H+EL  N   +DP   L  ++P
Sbjct: 590 GPHLHYELIVNGNKVDP---LRIRLP 612


>gi|221633912|ref|YP_002523138.1| lipoprotein [Thermomicrobium roseum DSM 5159]
 gi|221157221|gb|ACM06348.1| lipoprotein precursor [Thermomicrobium roseum DSM 5159]
          Length = 542

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHI-DTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           VI+ G +   LG  + I H +  VT Y H+ + P VQ GQ V++G  IG  G +G +  P
Sbjct: 463 VIFSGWNNYGLGYAVAIDHGNGFVTWYGHMAEPPPVQVGQWVNQGQYIGPMGSTGYSTGP 522

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHF +  N +  DP  +L
Sbjct: 523 HVHFIIMYNGVYQDPALYL 541


>gi|24374943|ref|NP_718986.1| lipoprotein NlpD [Shewanella oneidensis MR-1]
 gi|24349661|gb|AAN56430.1|AE015780_1 lipoprotein NlpD [Shewanella oneidensis MR-1]
          Length = 298

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D  ++ Y+H D   V + Q V  G TI   G +G      
Sbjct: 219 VVYAGSALRGYGNLVIIKHSDDYLSAYAHADQILVDEKQHVLAGQTIAKMGSTG-TNQVM 277

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           + FE+R +  +++P+ +L ++
Sbjct: 278 LRFEIRYHGQSVNPLNYLPKQ 298


>gi|94311054|ref|YP_584264.1| peptidase M23B [Cupriavidus metallidurans CH34]
 gi|93354906|gb|ABF08995.1| metallopeptidase, M23B subfamily [Cupriavidus metallidurans CH34]
          Length = 295

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 2/79 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+VG  L   GN ++I+H+D+ +T Y H D   V +   V +G  I   G S ++   +
Sbjct: 217 VIHVGP-LRGYGNLVIIKHNDTYLTAYGHNDKVLVTEQSTVRKGQKIAEMGNS-DSDRVK 274

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+RKN   +DP+++L 
Sbjct: 275 LHFEVRKNGKPVDPMRYLP 293


>gi|330752590|emb|CBL87536.1| peptidase M23 family [uncultured Flavobacteria bacterium]
          Length = 325

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V    N     G  I I H    V++Y+H+    V++GQKV RG  IG  G +G +  P
Sbjct: 223 IVKRADNRSSGYGRHIRIDHGFGYVSLYAHLSKYNVRRGQKVKRGEIIGYVGNTGRSAGP 282

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E+ K+   ++P+ F
Sbjct: 283 HLHYEILKDKKKINPLNF 300


>gi|167752134|ref|ZP_02424261.1| hypothetical protein ALIPUT_00376 [Alistipes putredinis DSM 17216]
 gi|167660375|gb|EDS04505.1| hypothetical protein ALIPUT_00376 [Alistipes putredinis DSM 17216]
          Length = 372

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 41/79 (51%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V     +    GN I++RHD+ + T Y H+    VQ G+ V  G  IGL G +G +  P 
Sbjct: 200 VRISEYNRGGYGNLIIVRHDNGLETYYGHLSERLVQSGEWVEAGQIIGLGGSTGRSTGPH 259

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE R    A DP + ++
Sbjct: 260 LHFETRYYGQAFDPERLID 278


>gi|197117677|ref|YP_002138104.1| membrane-bound metalloendopeptidase [Geobacter bemidjiensis Bem]
 gi|197087037|gb|ACH38308.1| membrane-bound metalloendopeptidase [Geobacter bemidjiensis Bem]
          Length = 397

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+  N     GN I++ H D   ++Y+H  +   + G KVS+   +   G   +++ P 
Sbjct: 320 VIFA-NYFKGYGNMIIVDHGDGFFSLYAHASSMTKKVGAKVSKNEVLASVGDVDSSKGPM 378

Query: 62  VHFELRKNAIAMDPIKFLE 80
           ++FE+R     +DP  +  
Sbjct: 379 LYFEIRYQGKPVDPSPWFR 397


>gi|170744609|ref|YP_001773264.1| peptidase M23B [Methylobacterium sp. 4-46]
 gi|168198883|gb|ACA20830.1| peptidase M23B [Methylobacterium sp. 4-46]
          Length = 501

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 45/76 (59%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH +  V+ Y+H     V+ G KV RG  I  SG SGN   PQ
Sbjct: 421 VAYAGSDVKGYGKLVLVRHANGYVSAYAHNGEIDVRPGDKVKRGQVIAKSGASGNVTSPQ 480

Query: 62  VHFELRKNAIAMDPIK 77
           +HFE+RK A  +DPI 
Sbjct: 481 LHFEIRKGATPVDPIP 496


>gi|220927134|ref|YP_002502436.1| peptidase M23 [Methylobacterium nodulans ORS 2060]
 gi|219951741|gb|ACL62133.1| Peptidase M23 [Methylobacterium nodulans ORS 2060]
          Length = 537

 Score = 91.7 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 45/76 (59%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G+D+   G  +L+RH +  V+ Y+H     V+ G KV RG  I  SG SGN   PQ
Sbjct: 457 VAYAGSDVKGYGKLVLVRHANGYVSAYAHNGEIDVRPGDKVKRGQVIAKSGASGNVTSPQ 516

Query: 62  VHFELRKNAIAMDPIK 77
           +HFE+RK A  +DPI 
Sbjct: 517 LHFEIRKGATPVDPIP 532


>gi|86157161|ref|YP_463946.1| peptidase M23B [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773672|gb|ABC80509.1| peptidase M23B [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 305

 Score = 91.3 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G +    G  +++ H   + T Y+H+   +V+ G +V RG  +   G +G +  P 
Sbjct: 227 VVFSGTE-GAYGKVLVLDHGYGVKTRYAHLSEIFVRLGDRVKRGDKVAAVGNTGRSTGPH 285

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N I  +P KF+
Sbjct: 286 LHYEVRVNGIPENPRKFI 303


>gi|331082646|ref|ZP_08331769.1| hypothetical protein HMPREF0992_00693 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330400265|gb|EGG79907.1| hypothetical protein HMPREF0992_00693 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 431

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H +   TVY H    YV+ GQKVS G  I   G +G +  P +HF + KN + 
Sbjct: 365 GNYVTIDHGNGFYTVYMHASARYVKVGQKVSAGQQIAAVGSTGYSTGPHLHFGVMKNGVY 424

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 425 VNPMNYL 431


>gi|260589238|ref|ZP_05855151.1| peptidase, M23/M37 family protein [Blautia hansenii DSM 20583]
 gi|260540319|gb|EEX20888.1| peptidase, M23/M37 family protein [Blautia hansenii DSM 20583]
          Length = 431

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 38/67 (56%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H +   TVY H    YV+ GQKVS G  I   G +G +  P +HF + KN + 
Sbjct: 365 GNYVTIDHGNGFYTVYMHASARYVKVGQKVSAGQQIAAVGSTGYSTGPHLHFGVMKNGVY 424

Query: 73  MDPIKFL 79
           ++P+ +L
Sbjct: 425 VNPMNYL 431


>gi|254521407|ref|ZP_05133462.1| YgeR [Stenotrophomonas sp. SKA14]
 gi|219718998|gb|EED37523.1| YgeR [Stenotrophomonas sp. SKA14]
          Length = 273

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H D  ++ Y H     V +GQ V  G  I   G++G A   
Sbjct: 193 VVVYSGAGLVGYGELIIIKHSDQWLSAYGHNRKRLVNEGQSVKAGEQIAEMGRTG-ANRD 251

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VHFE+R N   +DP ++L  +
Sbjct: 252 MVHFEIRYNGKPVDPQQYLPAR 273


>gi|169832309|ref|YP_001718291.1| peptidase M23B [Candidatus Desulforudis audaxviator MP104C]
 gi|169639153|gb|ACA60659.1| peptidase M23B [Candidatus Desulforudis audaxviator MP104C]
          Length = 284

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      G  +++ H D + T Y+H     V    +V+ G  I   G +G +  P 
Sbjct: 201 VVFAGPA-GTFGLLVILDHGDGLTTYYAHCSEITVSYQDRVNAGEIIARVGSTGRSFGPH 259

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R N    DP+ +L
Sbjct: 260 LHFEVRWNGEPYDPMLYL 277


>gi|150397696|ref|YP_001328163.1| peptidase M23B [Sinorhizobium medicae WSM419]
 gi|150029211|gb|ABR61328.1| peptidase M23B [Sinorhizobium medicae WSM419]
          Length = 646

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V   G D    GN  LIRH +  V+ Y+H       V+ G KV +G  IG  G +G + 
Sbjct: 530 VVQKAGWDSGGYGNQTLIRHANGYVSSYNHQSAIAKSVKPGAKVVQGQVIGWVGTTGLST 589

Query: 59  HPQVHFELRKNAIAMDPIKFLEEKIP 84
            P +H+EL  N   +DP   L  ++P
Sbjct: 590 GPHLHYELIVNGNKVDP---LRIRLP 612


>gi|330828424|ref|YP_004391376.1| lipoprotein NlpD [Aeromonas veronii B565]
 gi|328803560|gb|AEB48759.1| Lipoprotein NlpD [Aeromonas veronii B565]
          Length = 345

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+++HDD  ++ Y+H D   V++G  V  G  I   G + +A   +
Sbjct: 266 VVYAGSALRGYGKLIILKHDDDYLSAYAHNDELRVKEGDSVKGGSVIANMGST-DAPDVR 324

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+ +L ++
Sbjct: 325 LHFEIRYRGKSINPMSYLPKR 345


>gi|225076478|ref|ZP_03719677.1| hypothetical protein NEIFLAOT_01524 [Neisseria flavescens
           NRL30031/H210]
 gi|224952157|gb|EEG33366.1| hypothetical protein NEIFLAOT_01524 [Neisseria flavescens
           NRL30031/H210]
          Length = 319

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S ++ Y H     V + Q V RG TI   G + +A   Q
Sbjct: 241 VVYAGSGLRGYGNLVIIQHNSSFLSAYGHNQRLLVNENQTVKRGQTIAHMGNT-DASRTQ 299

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 300 LHFEIRQNGKPVNPANYV 317


>gi|183220818|ref|YP_001838814.1| putative metalloendopeptidase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189910917|ref|YP_001962472.1| metalloendopeptidase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167775593|gb|ABZ93894.1| Metalloendopeptidase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167779240|gb|ABZ97538.1| Putative metalloendopeptidase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 374

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G  +   GN I++ HDD+  T+Y+H    YV++G  VS G  I  SG +G    P 
Sbjct: 292 VTYSGW-MGGYGNAIILSHDDNYQTLYAHNSKLYVKEGDYVSAGKIISRSGCTGYCFGPH 350

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+ K+   ++P K ++
Sbjct: 351 LHFEVIKDGKNINPTKLIK 369


>gi|119505112|ref|ZP_01627188.1| Fe-S type hydro-lyases tartrate/fumarate alpha region [marine gamma
           proteobacterium HTCC2080]
 gi|119459094|gb|EAW40193.1| Fe-S type hydro-lyases tartrate/fumarate alpha region [marine gamma
           proteobacterium HTCC2080]
          Length = 310

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 41/83 (49%), Gaps = 1/83 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  + I H D +VT Y H     V+ G  V +G  I L G SG +  P
Sbjct: 228 VVSWSGERT-GYGTLVEIAHGDGLVTRYGHNRENRVEIGDLVRQGDVIALMGNSGRSTGP 286

Query: 61  QVHFELRKNAIAMDPIKFLEEKI 83
            VHFE+ K+  A+DP  ++   +
Sbjct: 287 HVHFEIFKHGRAVDPSSYVRRTL 309


>gi|116669124|ref|YP_830057.1| peptidase M23B [Arthrobacter sp. FB24]
 gi|116609233|gb|ABK01957.1| peptidase M23B [Arthrobacter sp. FB24]
          Length = 445

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 42/78 (53%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V  VG      GN + I H + ++T Y+H++   V+KG  V  G  I   G +G++   
Sbjct: 171 VVRAVGWHPWGGGNRVEIDHGNGLITTYNHLEGIAVKKGDSVQVGEVIAKVGTTGSSTGC 230

Query: 61  QVHFELRKNAIAMDPIKF 78
            +HFE   + + ++P+++
Sbjct: 231 HLHFETILDGVHVNPLQW 248


>gi|46201936|ref|ZP_00208309.1| COG0739: Membrane proteins related to metalloendopeptidases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 320

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 36/83 (43%), Positives = 58/83 (69%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V YVGN+L   GN +LI+H D+ +T Y+H D   V++G +V RG TI   G SG+   P
Sbjct: 224 VVAYVGNELKGFGNLLLIKHADNWMTAYAHNDQLMVKRGDRVRRGQTIATLGASGSVASP 283

Query: 61  QVHFELRKNAIAMDPIKFLEEKI 83
           Q+HFE+R+   A++P+++L++K+
Sbjct: 284 QLHFEIRRGTEAVNPMEYLQDKV 306


>gi|313141415|ref|ZP_07803608.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|313130446|gb|EFR48063.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
          Length = 403

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 3/81 (3%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           VI+ G      G T++I+H++   T+Y H+      ++ G  VS+G  IG  G +G +  
Sbjct: 261 VIFAGTK-GGYGKTVIIQHENGYRTLYGHMHKINKGIRTGVYVSQGKQIGTVGSTGLSTG 319

Query: 60  PQVHFELRKNAIAMDPIKFLE 80
           P +HF L KN  A++P K L 
Sbjct: 320 PHLHFGLYKNGSAINPQKHLR 340


>gi|86146342|ref|ZP_01064666.1| membrane protein [Vibrio sp. MED222]
 gi|85835821|gb|EAQ53955.1| membrane protein [Vibrio sp. MED222]
          Length = 304

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+D+ ++ Y+H D   V +GQ V  G  I   G SG +   +
Sbjct: 227 VVYSGNALRGYGNLVIVKHNDNYLSAYAHNDRLLVSEGQSVKPGQKIATMGSSGASS-VR 285

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    +++P ++L 
Sbjct: 286 LHFEIRYQGKSVNPKRYLP 304


>gi|212693637|ref|ZP_03301765.1| hypothetical protein BACDOR_03156 [Bacteroides dorei DSM 17855]
 gi|212663890|gb|EEB24464.1| hypothetical protein BACDOR_03156 [Bacteroides dorei DSM 17855]
          Length = 286

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    GNTI + H    +T Y+H+    V+ GQKV RG  IG  G +G +  P
Sbjct: 185 VVVKAGWET-GYGNTIEVNHGFGYLTRYAHLSAYKVRPGQKVVRGEVIGAVGSTGKSTGP 243

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E+       +P+ +
Sbjct: 244 HLHYEVHVKGKVQNPVNY 261


>gi|297539065|ref|YP_003674834.1| peptidase M23 [Methylotenera sp. 301]
 gi|297258412|gb|ADI30257.1| Peptidase M23 [Methylotenera sp. 301]
          Length = 352

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 51/78 (65%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G+DL   G  ++I+H+ + ++VY+H     V++GQ+VSRG  I   G + ++   +
Sbjct: 273 VIYSGSDLRGYGKLVIIKHNANYLSVYAHNSLILVKEGQQVSRGQKIAEMGNT-DSNSVK 331

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+   ++DP K+L
Sbjct: 332 LHFEIRRQGKSVDPSKYL 349


>gi|304320845|ref|YP_003854488.1| M23/M37 peptidase domain protein [Parvularcula bermudensis
           HTCC2503]
 gi|303299747|gb|ADM09346.1| M23/M37 peptidase domain protein [Parvularcula bermudensis
           HTCC2503]
          Length = 142

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G  +   G  + +RH   + T Y+H+    VQ G +V RG TIG +G SGNA    
Sbjct: 60  VIFAGW-MGGFGRLVKVRHKGEVETWYAHLSKFTVQPGSRVYRGQTIGFAGASGNATGAH 118

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R     +DP+ +L  +
Sbjct: 119 LHFEIRHRGKPVDPLLYLNTR 139


>gi|298529922|ref|ZP_07017324.1| Peptidase M23 [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509296|gb|EFI33200.1| Peptidase M23 [Desulfonatronospira thiodismutans ASO3-1]
          Length = 359

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 47/82 (57%), Gaps = 2/82 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++   D    GN +++ H +   TVY+H     VQ+G +V +G  I  SG +G +  P 
Sbjct: 269 VVFADKD-GGYGNKVILEHPNGWKTVYAHNSKNLVQEGDRVDQGQEIARSGNTGRSTGPH 327

Query: 62  VHFELRKNAIAMDPIKFLEEKI 83
           +HFE+R+  +A DP   +++++
Sbjct: 328 LHFEVRQGDMAWDP-NLIKDRM 348


>gi|84390121|ref|ZP_00991383.1| lipoprotein NlpD [Vibrio splendidus 12B01]
 gi|84376775|gb|EAP93650.1| lipoprotein NlpD [Vibrio splendidus 12B01]
          Length = 304

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+D+ ++ Y+H D   V +GQ V  G  I   G SG +   +
Sbjct: 227 VVYSGNALRGYGNLVIVKHNDNYLSAYAHNDRLLVSEGQSVKPGQKIATMGSSGASS-VR 285

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    +++P ++L 
Sbjct: 286 LHFEIRYQGKSVNPKRYLP 304


>gi|224824775|ref|ZP_03697882.1| Peptidase M23 [Lutiella nitroferrum 2002]
 gi|224603268|gb|EEG09444.1| Peptidase M23 [Lutiella nitroferrum 2002]
          Length = 361

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   G  I+I+H+ + ++ Y+H     V++GQ V +G  I   G + +A   +
Sbjct: 281 VVYSGNGLRGYGKLIIIKHNKTFLSAYAHNSQLLVKEGQAVKKGQPIAEMGNT-DADQVK 339

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+R+    +DP+++L+ 
Sbjct: 340 LHFEIRRFGKPVDPLQYLDS 359


>gi|258593263|emb|CBE69602.1| exported protein of unknown function [NC10 bacterium 'Dutch
           sediment']
          Length = 411

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y        G  I++ H D   TVY+H     V+ G  V++G TIGL G +G+    
Sbjct: 331 VVLYADW-FKGYGRLIVLDHGDGYYTVYAHAAEILVRLGDHVTKGQTIGLVGATGSVTGS 389

Query: 61  QVHFELRKNAIAMDPIKFL 79
           Q++FE+R    A DP  +L
Sbjct: 390 QLYFEVRYQGGAQDPAAWL 408


>gi|55981739|ref|YP_145036.1| M23/M37 family endopeptidase [Thermus thermophilus HB8]
 gi|55773152|dbj|BAD71593.1| putative endopeptidase, family M23/M37 [Thermus thermophilus HB8]
          Length = 299

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G  +   G  +++ H     T+Y H+    V+ GQ+V+RG  +G  G +G +  P
Sbjct: 215 VVVQAGW-MGVYGLAVVVDHARGYRTLYGHLSRLAVRPGQRVARGGLLGYVGSTGRSTGP 273

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+ + +    +DP  +L+
Sbjct: 274 HLHYGVYRYGTPVDPRAYLD 293


>gi|115351571|ref|YP_773410.1| peptidase M23B [Burkholderia ambifaria AMMD]
 gi|115281559|gb|ABI87076.1| peptidase M23B [Burkholderia ambifaria AMMD]
          Length = 425

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  +++ H D   T Y+H+      ++ G+ V +G  IG  G +G A 
Sbjct: 280 VVSFVGTDPDGYGRYVIVDHADGYSTYYAHLSAYARGLKTGETVKQGQRIGSVGMTGAAT 339

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 340 GPHLHFEVRVANDPVDPL 357


>gi|258544578|ref|ZP_05704812.1| opacity-associated protein A family metalloprotease
           [Cardiobacterium hominis ATCC 15826]
 gi|258520209|gb|EEV89068.1| opacity-associated protein A family metalloprotease
           [Cardiobacterium hominis ATCC 15826]
          Length = 369

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  I+I H +   T Y+H+    V+ G  V RG TIG  G SG +   
Sbjct: 256 VVRFAGWQ-GGYGRVIIIDHANGYQTRYAHLSDINVETGAAVKRGQTIGNLGNSGRSTGS 314

Query: 61  QVHFELRKNAIAMDPIKF-LEEKIP 84
            +H+E+R N I  DP+   L    P
Sbjct: 315 HLHYEVRINDIPHDPMTVDLPSTRP 339


>gi|329895790|ref|ZP_08271166.1| Peptidase, M23/M37 family protein [gamma proteobacterium IMCC3088]
 gi|328922152|gb|EGG29509.1| Peptidase, M23/M37 family protein [gamma proteobacterium IMCC3088]
          Length = 374

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++    L   G  ++I H ++ +++Y+H ++  V++GQ V     I  +G +G  + P 
Sbjct: 297 VVFADW-LRGYGLLVIIDHGENYMSLYAHNNSISVEEGQWVDPSTVIASAGNTGGQEEPG 355

Query: 62  VHFELRKNAIAMDPIKF 78
           ++FE+R      +P  +
Sbjct: 356 LYFEVRHQGEPQNPAHW 372


>gi|17229354|ref|NP_485902.1| hypothetical protein all1862 [Nostoc sp. PCC 7120]
 gi|17130952|dbj|BAB73561.1| all1862 [Nostoc sp. PCC 7120]
          Length = 333

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 33/79 (41%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ VG D   LGN I I+H +  VTVY H     V KGQ+V +G  I   G +GN+  P 
Sbjct: 99  VVKVGWDEWGLGNAIEIKHPNGSVTVYGHNRRLLVSKGQQVKQGQIIAEMGSTGNSTAPH 158

Query: 62  VHFELRKNAI-AMDPIKFL 79
           +HFE   N   A++P+  L
Sbjct: 159 LHFEYYPNGKVAVNPMTVL 177


>gi|225620635|ref|YP_002721893.1| peptidase [Brachyspira hyodysenteriae WA1]
 gi|225215455|gb|ACN84189.1| peptidase [Brachyspira hyodysenteriae WA1]
          Length = 397

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      G  +LI H +   T Y H     V  GQKV RG  I L G +G     
Sbjct: 316 VVTFAGWRN-GYGWFVLITHANGYQTAYGHNSKLLVDYGQKVKRGERIALIGNTGRTTGI 374

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
             HFE+R      +P+ +L  +
Sbjct: 375 HCHFEVRVGGDHKNPMPYLSAR 396


>gi|170702187|ref|ZP_02893093.1| peptidase M23B [Burkholderia ambifaria IOP40-10]
 gi|170132896|gb|EDT01318.1| peptidase M23B [Burkholderia ambifaria IOP40-10]
          Length = 360

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  +++ H D   T Y+H+      ++ G+ V +G  IG  G +G A 
Sbjct: 215 VVSFVGTDPDGYGRYVIVDHADGYSTYYAHLSAYARGLKTGETVKQGQRIGSVGMTGAAT 274

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 275 GPHLHFEVRVANDPVDPL 292


>gi|85712525|ref|ZP_01043573.1| Membrane protein [Idiomarina baltica OS145]
 gi|85693659|gb|EAQ31609.1| Membrane protein [Idiomarina baltica OS145]
          Length = 308

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G +    GN + I H   + T Y H +T  VQ G  V+RG  I   G +G +  P
Sbjct: 226 VVTWAG-ERWGYGNLVEIDHGGGLKTRYGHNETINVQVGDVVTRGQVIAEMGNTGRSTGP 284

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VH+E+ +N   +DP +F+
Sbjct: 285 HVHYEVLRNGKQIDPNRFV 303


>gi|284799933|ref|ZP_05985250.2| peptidase M23B [Neisseria subflava NJ9703]
 gi|284796385|gb|EFC51732.1| peptidase M23B [Neisseria subflava NJ9703]
          Length = 317

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S ++ Y H     V + Q V RG TI   G + +A   Q
Sbjct: 239 VVYAGSGLRGYGNLVIIQHNSSFLSAYGHNQRLLVNENQTVKRGQTIAHMGNT-DASRTQ 297

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 298 LHFEIRQNGKPVNPANYV 315


>gi|330721382|gb|EGG99449.1| Lipoprotein NlpD [gamma proteobacterium IMCC2047]
          Length = 258

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G+ L+  GN ++I+H  + ++ Y+H     V +  KV  G  I   G SG A   
Sbjct: 179 VVVYAGSGLIGYGNLVIIKHSQTFLSAYAHNKKVLVAEKNKVKAGQKIAEIGSSG-ASEN 237

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
           ++HFE+RKN   ++P+ +L +
Sbjct: 238 KLHFEIRKNGKPVNPLWYLPK 258


>gi|317403090|gb|EFV83623.1| peptidase [Achromobacter xylosoxidans C54]
          Length = 286

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +  LGN I++ H +  +T Y+H  T  V+ GQ V RG  I   G+S +   P+
Sbjct: 207 VMYSGNGVRGLGNLIIVNHQNGFITAYAHNRTLLVKTGQDVKRGAKIAEIGQS-DTTSPR 265

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  K
Sbjct: 266 LHFEIRRQGTPVDPMQYLPAK 286


>gi|163868044|ref|YP_001609248.1| putative virulence determinant [Bartonella tribocorum CIP 105476]
 gi|161017695|emb|CAK01253.1| putative virulence determinant [Bartonella tribocorum CIP 105476]
          Length = 389

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 59/80 (73%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L ELGN ++IRH+++I+T+Y       V KGQ++ RG  I  SG SGN + P
Sbjct: 309 VVIYAGDGLKELGNVVMIRHENNIITIYGCNSKITVNKGQRIRRGDEIAKSGVSGNVKTP 368

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           +V+FE+RKN++ +DP+K+LE
Sbjct: 369 RVYFEMRKNSLPVDPLKYLE 388


>gi|303248235|ref|ZP_07334498.1| Peptidase M23 [Desulfovibrio fructosovorans JJ]
 gi|302490373|gb|EFL50284.1| Peptidase M23 [Desulfovibrio fructosovorans JJ]
          Length = 336

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      GN + + H     ++Y H+    V+ G  V+ G  I   G +G +  P 
Sbjct: 250 VVFAG-AKGGYGNVVEVEHPGGWKSIYGHLSHYSVKAGDHVAAGGKIAEVGSTGRSTGPH 308

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFELR+    +DP + L
Sbjct: 309 LHFELRRGEGTVDPQRML 326


>gi|224531978|ref|ZP_03672610.1| M23 peptidase domain protein [Borrelia valaisiana VS116]
 gi|224511443|gb|EEF81849.1| M23 peptidase domain protein [Borrelia valaisiana VS116]
          Length = 410

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+ VG +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 331 IVVTVGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 390

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 391 HLHFTIFKNGKTENPMKYLR 410


>gi|261392263|emb|CAX49783.1| putative metallopeptidase [Neisseria meningitidis 8013]
          Length = 415

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|309378351|emb|CBX23048.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 346

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 268 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 326

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 327 LHFEVRQNGKPVNPNSYI 344


>gi|319786404|ref|YP_004145879.1| peptidase M23 [Pseudoxanthomonas suwonensis 11-1]
 gi|317464916|gb|ADV26648.1| Peptidase M23 [Pseudoxanthomonas suwonensis 11-1]
          Length = 278

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+++H++  ++ Y H     V +GQ V  G  I   G++G     
Sbjct: 198 VVVYSGAGLVGYGELIIVKHNEQWLSAYGHNRKRLVSEGQAVKAGQQIAEMGRTG-TDRE 256

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
           ++HFE+R N   +DP+ +L +K
Sbjct: 257 KLHFEIRYNGKPVDPLLYLPKK 278


>gi|301064138|ref|ZP_07204585.1| peptidase, M23 family [delta proteobacterium NaphS2]
 gi|300441758|gb|EFK06076.1| peptidase, M23 family [delta proteobacterium NaphS2]
          Length = 302

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G      G  I+++H     T Y+H+    V+KGQ V +G  IGL GK+G    P 
Sbjct: 224 VIFNGWQ-SGYGRVIVLKHARGFKTKYAHLRKSLVKKGQYVKKGTKIGLVGKTGRTTGPH 282

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+  N   ++P++++
Sbjct: 283 LHYEVHLNNAPVNPLRYI 300


>gi|257438820|ref|ZP_05614575.1| peptidase, M23/M37 family [Faecalibacterium prausnitzii A2-165]
 gi|257198729|gb|EEU97013.1| peptidase, M23/M37 family [Faecalibacterium prausnitzii A2-165]
          Length = 405

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 39/89 (43%), Gaps = 8/89 (8%)

Query: 2   VIYVGNDLVELGNTILIRHD-----DSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGN 56
           V   G      GN ++I H      +   T+Y H+ +     G+ V +G  IG  G +GN
Sbjct: 317 VQVAGWSSGGYGNYVIIYHGKMSDGNQYSTLYGHMRSVATSAGKYVQQGEIIGYVGSTGN 376

Query: 57  AQHPQVHFELRKNA---IAMDPIKFLEEK 82
           +    +H E+ K      A++P  ++  K
Sbjct: 377 STGNHLHLEVWKGGSKANAVNPRGYIPMK 405


>gi|117618478|ref|YP_858317.1| M23/M37 peptidase domain-containing protein [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117559885|gb|ABK36833.1| M23/M37 peptidase domain protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 301

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G    E GN + I H + +VT Y+H     V+ G  V  G  I L G++G A   
Sbjct: 219 VVSWAGRHP-EFGNMVEINHGNGLVTRYAHNSKLLVEVGTLVDEGQKIALMGRTGRATGV 277

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +H+E+ K+   +DP +FL  +
Sbjct: 278 HLHYEVLKDGRQVDPARFLNAR 299


>gi|325915627|ref|ZP_08177935.1| metalloendopeptidase-like membrane protein [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325538187|gb|EGD09875.1| metalloendopeptidase-like membrane protein [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 297

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  VT Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 207 VVSYAG-VRGGYGNVVEVDHGNGYVTRYAHNSRLVVKVGDLVRAGQQVARAGSSGRSTGA 265

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+  +   ++P KFL
Sbjct: 266 HVHFEVWADGRVVNPRKFL 284


>gi|153855916|ref|ZP_01996878.1| hypothetical protein DORLON_02903 [Dorea longicatena DSM 13814]
 gi|149751819|gb|EDM61750.1| hypothetical protein DORLON_02903 [Dorea longicatena DSM 13814]
          Length = 388

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN ++I H + ++T Y H +  YV  GQKVSRG  +   G +GN+  P 
Sbjct: 312 VISAGYAGNA-GNLLVISHGNGLLTYYMHCNAIYVSAGQKVSRGQNVAAVGTTGNSTGPH 370

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++  N   ++P  +L
Sbjct: 371 LHFQVMLNGTPVNPANYL 388


>gi|291556887|emb|CBL34004.1| Membrane-bound metallopeptidase [Eubacterium siraeum V10Sc8a]
          Length = 435

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 3/81 (3%)

Query: 2   VIYVGNDL---VELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           VI            G  +++ H     T Y+H+   YV  GQ+V++G ++G  G +G + 
Sbjct: 352 VIVAETSYIPGYSYGMYVVVDHGGGYTTTYAHLSDVYVYVGQEVAQGESLGAVGSTGYST 411

Query: 59  HPQVHFELRKNAIAMDPIKFL 79
            P +HFE+R N    +P  ++
Sbjct: 412 GPHLHFEIRLNGEPENPFNYV 432


>gi|291530004|emb|CBK95589.1| Membrane-bound metallopeptidase [Eubacterium siraeum 70/3]
          Length = 435

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 3/81 (3%)

Query: 2   VIYVGNDL---VELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           VI            G  +++ H     T Y+H+   YV  GQ+V++G ++G  G +G + 
Sbjct: 352 VIVAETSYIPGYSYGMYVVVDHGGGYTTTYAHLSDVYVYVGQEVAQGESLGAVGSTGYST 411

Query: 59  HPQVHFELRKNAIAMDPIKFL 79
            P +HFE+R N    +P  ++
Sbjct: 412 GPHLHFEIRLNGEPENPFNYV 432


>gi|167751091|ref|ZP_02423218.1| hypothetical protein EUBSIR_02076 [Eubacterium siraeum DSM 15702]
 gi|167656009|gb|EDS00139.1| hypothetical protein EUBSIR_02076 [Eubacterium siraeum DSM 15702]
          Length = 435

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 3/81 (3%)

Query: 2   VIYVGNDL---VELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           VI            G  +++ H     T Y+H+   YV  GQ+V++G ++G  G +G + 
Sbjct: 352 VIVAETSYIPGYSYGMYVVVDHGGGYTTTYAHLSDVYVYVGQEVAQGESLGAVGSTGYST 411

Query: 59  HPQVHFELRKNAIAMDPIKFL 79
            P +HFE+R N    +P  ++
Sbjct: 412 GPHLHFEIRLNGEPENPFNYV 432


>gi|148978208|ref|ZP_01814738.1| lipoprotein NlpD [Vibrionales bacterium SWAT-3]
 gi|145962630|gb|EDK27906.1| lipoprotein NlpD [Vibrionales bacterium SWAT-3]
          Length = 304

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+D+ ++ Y+H D   V +GQ V  G  I   G SG +   +
Sbjct: 227 VVYSGNALRGYGNLVIVKHNDNYLSAYAHNDRLLVSEGQSVKPGQKIATMGSSGASS-VR 285

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    +++P ++L 
Sbjct: 286 LHFEIRYQGKSVNPKRYLP 304


>gi|198276956|ref|ZP_03209487.1| hypothetical protein BACPLE_03161 [Bacteroides plebeius DSM 17135]
 gi|198270481|gb|EDY94751.1| hypothetical protein BACPLE_03161 [Bacteroides plebeius DSM 17135]
          Length = 285

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G D    GN I+I H    VT Y+H++   V+ GQ V+RG  IG  G +G +  P 
Sbjct: 185 VKQAGWD-GLYGNCIIIDHGFGYVTRYAHLNKIEVKVGQNVARGEVIGQVGSTGKSTGPH 243

Query: 62  VHFELRKNAIAMDPIKF 78
           +H+E+R     ++P+ +
Sbjct: 244 LHYEVRVKGKIVNPVNY 260


>gi|119510691|ref|ZP_01629819.1| hypothetical protein N9414_22003 [Nodularia spumigena CCY9414]
 gi|119464645|gb|EAW45554.1| hypothetical protein N9414_22003 [Nodularia spumigena CCY9414]
          Length = 904

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G +    G  + IRH+D  +T Y+H     V+ GQ+V++G  I   G +G +  P
Sbjct: 820 VVAKSGWNRGGYGILVEIRHEDGTMTRYAHNSRTLVRAGQQVTQGQQIANMGSTGFSTGP 879

Query: 61  QVHFELRKNAI-AMDPIKFLEE 81
             HFE+      A DPI FL +
Sbjct: 880 HTHFEIHPAGKGATDPIAFLPK 901


>gi|114568069|ref|YP_755223.1| metalloendopeptidase-like membrane protein [Syntrophomonas wolfei
           subsp. wolfei str. Goettingen]
 gi|114339004|gb|ABI69852.1| metalloendopeptidase-like membrane protein [Syntrophomonas wolfei
           subsp. wolfei str. Goettingen]
          Length = 304

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G   V  G T+ I H    ++ Y H     V KG KV +G TI   G +GN+  P 
Sbjct: 227 VIFAGWKAV-YGKTVEIDHGYGFISRYGHNSAILVNKGDKVKKGETIARLGNTGNSTGPH 285

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HF + KN  ++ P+ +L 
Sbjct: 286 LHFSIMKNNESVSPVNYLP 304


>gi|78063788|ref|YP_373696.1| peptidase M23B [Burkholderia sp. 383]
 gi|77971673|gb|ABB13052.1| Peptidase M23B [Burkholderia sp. 383]
          Length = 454

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 47/78 (60%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V ++G +    G  +++RHDD   + Y+H+    P ++ G +V+RG  +G  G +G A 
Sbjct: 327 VVTFIGTEPRGYGKYVVVRHDDGYASYYAHLSAFEPALRTGMRVARGQRVGAVGSTGTAT 386

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R++   +DP+
Sbjct: 387 GPHLHFEVRRHDRLVDPV 404


>gi|118595112|ref|ZP_01552459.1| lipoprotein NlpD, putative [Methylophilales bacterium HTCC2181]
 gi|118440890|gb|EAV47517.1| lipoprotein NlpD, putative [Methylophilales bacterium HTCC2181]
          Length = 289

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 51/80 (63%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G DL   G  I+I+HD+ +++VY H +  +V++GQ V     IG  G++G     +
Sbjct: 211 VIYAGEDLKGYGRLIIIKHDNDLLSVYGHNEEIFVREGQTVEALEAIGTMGRTG-TDRVK 269

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           ++FE+RK   +++P+ ++++
Sbjct: 270 LYFEIRKGGQSVNPLLYIKK 289


>gi|71899135|ref|ZP_00681299.1| Peptidase M23B [Xylella fastidiosa Ann-1]
 gi|71731129|gb|EAO33196.1| Peptidase  M23B [Xylella fastidiosa Ann-1]
          Length = 364

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  +T Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 270 VVSYAGYRN-GYGNVVDVDHSNGYLTRYAHNSRLTVKVGDLVRTGQEVAKAGSSGRSTGA 328

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFE+ K+ + M+PIKFL
Sbjct: 329 HVHFEVWKDGVVMNPIKFL 347


>gi|332994557|gb|AEF04612.1| putative lipoprotein NlpD [Alteromonas sp. SN2]
          Length = 287

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D+ ++ Y++ D   V++   VS G  I   G SG     +
Sbjct: 206 VVYSGSALRGYGNLVIIKHTDTFLSAYAYNDNIIVKERDWVSAGQKIATMGDSGTNS-VK 264

Query: 62  VHFELRKNAIAMDPIKFLEEKIP 84
           +HFE+R    ++DP+++L    P
Sbjct: 265 LHFEVRYRGKSLDPLRYLPATRP 287


>gi|312796756|ref|YP_004029678.1| peptidoglycan-specific endopeptidase, M23 family [Burkholderia
           rhizoxinica HKI 454]
 gi|312168531|emb|CBW75534.1| Peptidoglycan-specific endopeptidase, M23 family [Burkholderia
           rhizoxinica HKI 454]
          Length = 267

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 49/79 (62%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+ + +T Y+H     V++GQ V++G TI   G S ++    
Sbjct: 188 VVYAGNGLRGYGNLLIIKHNANFLTAYAHNRALLVKEGQNVTQGQTIAEMGDS-DSNRVA 246

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFELR +  ++DP ++L 
Sbjct: 247 LHFELRYDGKSIDPARYLP 265


>gi|332526106|ref|ZP_08402244.1| peptidase m23 [Rubrivivax benzoatilyticus JA2]
 gi|332109949|gb|EGJ10577.1| peptidase m23 [Rubrivivax benzoatilyticus JA2]
          Length = 295

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+++H+ + ++ Y+H  T  V++ Q V RG  I   G S +A   Q
Sbjct: 216 VVYAGSGLRGYGNLIIVKHNATFLSAYAHNQTLLVKEDQVVRRGQKIAEMGSS-DADRVQ 274

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP K L  +
Sbjct: 275 LHFEIRRQGKPVDPAKLLPSR 295


>gi|311106596|ref|YP_003979449.1| LysM domain-containing protein 3 [Achromobacter xylosoxidans A8]
 gi|310761285|gb|ADP16734.1| LysM domain protein 3 [Achromobacter xylosoxidans A8]
          Length = 284

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y GN +  LGN I++ H +  +T Y+H     V+ GQ V RG  I   G+S +   P+
Sbjct: 205 VKYSGNGVRGLGNLIIVEHQNGFITAYAHNRAVLVKTGQTVKRGAKIAELGQS-DTTSPR 263

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  K
Sbjct: 264 LHFEIRRQGQPVDPMQYLPAK 284


>gi|46199713|ref|YP_005380.1| cell wall endopeptidase [Thermus thermophilus HB27]
 gi|46197339|gb|AAS81753.1| cell wall endopeptidase, family M23/M37 [Thermus thermophilus HB27]
          Length = 299

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G  +   G  +++ H     T+Y H+    V+ GQ+V+RG  +G  G +G +  P
Sbjct: 215 VVVQAGW-MGVYGLAVVVDHARGYRTLYGHLSRLAVRPGQRVARGGLLGYVGSTGRSTGP 273

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+ + +    +DP  +L+
Sbjct: 274 HLHYGVYRYGTPVDPRAYLD 293


>gi|328958039|ref|YP_004375425.1| peptidoglycan DL-endopeptidase CwlO [Carnobacterium sp. 17-4]
 gi|328674363|gb|AEB30409.1| peptidoglycan DL-endopeptidase CwlO [Carnobacterium sp. 17-4]
          Length = 501

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTP--YVQKGQKVSRGHTIGLSGKSGNAQH 59
           V+  G D    G  + I H + + T+Y+H+      V  GQ+VS+G  IG  G +G++  
Sbjct: 423 VVIAGYD-SSWGYYVKIDHGNGMQTLYAHMVAGSLLVSPGQQVSQGQQIGTMGTTGSSTG 481

Query: 60  PQVHFELRKNAIAMDPIKFL 79
             +HFE+ KN   ++P  +L
Sbjct: 482 VHLHFEMYKNGSRVNPASYL 501


>gi|291556872|emb|CBL33989.1| Membrane proteins related to metalloendopeptidases [Eubacterium
           siraeum V10Sc8a]
          Length = 628

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G D   LGN ++I H D   TVY+H    +V  GQ+V++G  I   G++G A    
Sbjct: 542 VIFAGWDNGGLGNAVMILHPDGYTTVYAHNSEIFVSAGQEVNQGECIAAVGETGLAYGCH 601

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R  +  ++P  +L
Sbjct: 602 CHFEVRYGSERLNPRYYL 619


>gi|225570772|ref|ZP_03779795.1| hypothetical protein CLOHYLEM_06875 [Clostridium hylemonae DSM
           15053]
 gi|225160234|gb|EEG72853.1| hypothetical protein CLOHYLEM_06875 [Clostridium hylemonae DSM
           15053]
          Length = 369

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G      GN I+I H + + T Y H +  YV+ GQ VSRG  I   G +GN+  P 
Sbjct: 293 VVSAGYSGNA-GNLIIINHGNGLQTYYMHCNNIYVRAGQTVSRGQNIAAVGTTGNSTGPH 351

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++    I ++P  + 
Sbjct: 352 LHFQVMSGGIPVNPRNYF 369


>gi|260775504|ref|ZP_05884401.1| lipoprotein NlpD [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608685|gb|EEX34850.1| lipoprotein NlpD [Vibrio coralliilyticus ATCC BAA-450]
          Length = 303

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++I+H+D+ ++ Y+H +   V +GQ V  G  I   G SG     +
Sbjct: 226 VVYSGNALRGYGNLVIIKHNDNYLSAYAHNERLLVHEGQSVKAGQKIATMGSSGTNS-VR 284

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    +++P ++L 
Sbjct: 285 LHFEIRYQGKSVNPKRYLP 303


>gi|144898797|emb|CAM75661.1| peptidase family M23 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 374

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      G T+ I H + + T Y+H+    VQ GQKV+R   IGL G +G +  P 
Sbjct: 288 VIDAGEKSR-YGQTVDIDHGNGLETRYAHLSRIKVQPGQKVTRATIIGLVGNTGRSTGPH 346

Query: 62  VHFELRKNAIAMDPIKFL 79
           +H+E+R N +  DPIKF+
Sbjct: 347 LHYEVRLNDVPRDPIKFI 364


>gi|332284224|ref|YP_004416135.1| putative peptidase [Pusillimonas sp. T7-7]
 gi|330428177|gb|AEC19511.1| putative peptidase [Pusillimonas sp. T7-7]
          Length = 263

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +  LGN IL+ H +  +T Y+H  +  V+ GQ++ +G  I   G++ +   P+
Sbjct: 184 VMYAGNGVRGLGNLILLGHGNGFITAYAHNQSLLVKTGQEIKKGAKIAAIGQT-DTTSPR 242

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    ++P+ +L  +
Sbjct: 243 LHFEIRRKGTPVNPLSYLPAR 263


>gi|260891960|ref|YP_003238057.1| peptidase M23 [Ammonifex degensii KC4]
 gi|260864101|gb|ACX51207.1| Peptidase M23 [Ammonifex degensii KC4]
          Length = 445

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      G T+ I H   +VT Y+H+   YV  G+ V +G  IG  G +G A    
Sbjct: 368 VIRAGW-YAGYGETVDIDHGGGVVTRYAHLSAIYVGVGEWVVQGQRIGSIGMTGRATGSH 426

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+    +  DP ++L 
Sbjct: 427 LHFEVIIGGVPRDPQRYLP 445


>gi|291529988|emb|CBK95573.1| Membrane proteins related to metalloendopeptidases [Eubacterium
           siraeum 70/3]
          Length = 628

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G D   LGN ++I H D   TVY+H    +V  GQ+V++G  I   G++G A    
Sbjct: 542 VIFAGWDNGGLGNAVMILHPDGYTTVYAHNSEIFVSAGQEVNQGDCIAAVGETGLAYGCH 601

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R  +  ++P  +L
Sbjct: 602 CHFEVRYGSERLNPRYYL 619


>gi|282896204|ref|ZP_06304227.1| Peptidoglycan-binding LysM [Raphidiopsis brookii D9]
 gi|281198893|gb|EFA73771.1| Peptidoglycan-binding LysM [Raphidiopsis brookii D9]
          Length = 593

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V   G +    G  + IRH+D  +T Y+H     V+ GQ+V +G TI   G +G +  P 
Sbjct: 509 VERAGWNNGGYGLLVEIRHEDGSMTRYAHNSRILVRVGQEVQQGETIAAMGSTGFSTGPH 568

Query: 62  VHFELRKNAI-AMDPIKFLEEK 82
            HFE+      A++PI FL  +
Sbjct: 569 THFEIHPTGKGAVNPIAFLPSQ 590


>gi|203287722|ref|YP_002222737.1| hypothetical protein BRE_269 [Borrelia recurrentis A1]
 gi|201084942|gb|ACH94516.1| uncharacterized conserved protein [Borrelia recurrentis A1]
          Length = 422

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 45/80 (56%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G  +   G  I+I H++   T+Y+H+ +  V+ G +VSRG  IG  G +G +   
Sbjct: 343 IVVTAGFSVGGYGKYIVIAHNNGFQTLYAHLGSFAVKVGDRVSRGQMIGRMGSTGYSTGN 402

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + K+    +P+K+L 
Sbjct: 403 HLHFTIFKDGKTSNPMKYLR 422


>gi|251800214|ref|YP_003014945.1| peptidase M23 [Paenibacillus sp. JDR-2]
 gi|247547840|gb|ACT04859.1| Peptidase M23 [Paenibacillus sp. JDR-2]
          Length = 518

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           ++ +VG      GN I++ H +   T+Y H+ +  V+KGQ V +G ++G+ G +G +   
Sbjct: 441 VIEFVG-QKTGYGNCIIVNHKNGYKTLYGHLKSIGVKKGQIVEKGDSLGIMGSTGESTGV 499

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+ KN +  +P+K+L
Sbjct: 500 HLHFEITKNGVLQNPLKYL 518


>gi|237752947|ref|ZP_04583427.1| conserved hypothetical protein [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375214|gb|EEO25305.1| conserved hypothetical protein [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 412

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 3/81 (3%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDT--PYVQKGQKVSRGHTIGLSGKSGNAQH 59
           VI+ G      G T++I+HD+   T+Y+H+      ++ G +V +G  IG  G +G +  
Sbjct: 275 VIFAGTK-GGYGRTVIIQHDNGYRTLYAHMHKIERGIRAGSQVKQGRKIGTVGSTGLSTG 333

Query: 60  PQVHFELRKNAIAMDPIKFLE 80
           P +HF L KN  A++PIK L 
Sbjct: 334 PHLHFGLYKNGNAVNPIKHLR 354


>gi|224369221|ref|YP_002603385.1| peptidase M23/M37 family protein [Desulfobacterium autotrophicum
           HRM2]
 gi|223691938|gb|ACN15221.1| peptidase M23/M37 family protein [Desulfobacterium autotrophicum
           HRM2]
          Length = 395

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y G      G  ++++H +   T Y+H      +KGQ V +G TI   G +G A  P 
Sbjct: 273 VTYSGWKT-GYGKVVILKHSNGYQTYYAHCSKLIAKKGQFVDQGQTIAKVGMTGVATGPH 331

Query: 62  VHFELRKNAIAMDPIKF 78
           VH+E+R     +DP+  
Sbjct: 332 VHYEVRIKGKPVDPMTV 348


>gi|206602545|gb|EDZ39026.1| Putative peptidase, M23B family [Leptospirillum sp. Group II '5-way
           CG']
          Length = 332

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI+VG D    G T+ IRH D IVT++ H+   +V  G +V RG  I   G +G +  P
Sbjct: 238 VVIWVGWD-AGFGKTVKIRHVDGIVTLFGHLSRYFVHMGDRVKRGQVIAALGNTGMSTGP 296

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+  NA  ++P+++ 
Sbjct: 297 HLHYEILVNAKPVNPLRYF 315


>gi|167587039|ref|ZP_02379427.1| Peptidase M23B [Burkholderia ubonensis Bu]
          Length = 137

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+HD + +T Y+H     V++G  V++G  I   G S +A    
Sbjct: 58  VVYAGNGLRGYGNLIIIKHDATYLTAYAHNRALMVKEGDAVTKGQKIAEMGNS-DADRVM 116

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+    +DP+K+L 
Sbjct: 117 LHFEVRRQGKPVDPLKYLP 135


>gi|284031498|ref|YP_003381429.1| peptidase M23 [Kribbella flavida DSM 17836]
 gi|283810791|gb|ADB32630.1| Peptidase M23 [Kribbella flavida DSM 17836]
          Length = 704

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 39/67 (58%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           GN + I H + + T+Y+H+ +  V  G +V+ G  IG  G  GN+  P +HFE+R     
Sbjct: 495 GNLVRIDHGNGLETLYAHLSSITVADGSRVAAGQQIGAVGNEGNSTGPHLHFEVRLGGDP 554

Query: 73  MDPIKFL 79
           ++P+ FL
Sbjct: 555 VNPMSFL 561


>gi|167751111|ref|ZP_02423238.1| hypothetical protein EUBSIR_02096 [Eubacterium siraeum DSM 15702]
 gi|167656029|gb|EDS00159.1| hypothetical protein EUBSIR_02096 [Eubacterium siraeum DSM 15702]
          Length = 628

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G D   LGN ++I H D   TVY+H    +V  GQ+V++G  I   G++G A    
Sbjct: 542 VIFAGWDNGGLGNAVMILHPDGYTTVYAHNSEIFVSAGQEVNQGECIAAVGETGLAYGCH 601

Query: 62  VHFELRKNAIAMDPIKFL 79
            HFE+R  +  ++P  +L
Sbjct: 602 CHFEVRYGSERLNPRYYL 619


>gi|147679080|ref|YP_001213295.1| membrane-bound metallopeptidase [Pelotomaculum thermopropionicum
           SI]
 gi|146275177|dbj|BAF60926.1| membrane-bound metallopeptidase [Pelotomaculum thermopropionicum
           SI]
          Length = 376

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 38/71 (53%)

Query: 9   LVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRK 68
           +   GN ++I H   + T+Y+H+    V +GQ+V +G  I   G +G +  P +HF +  
Sbjct: 306 MSGYGNIVMIDHGGGVTTLYAHLSAQLVGQGQEVRKGDAIARVGNTGLSTGPHLHFTVMV 365

Query: 69  NAIAMDPIKFL 79
           N   ++P  +L
Sbjct: 366 NGDPVNPFNYL 376


>gi|242308876|ref|ZP_04808031.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
 gi|239524540|gb|EEQ64406.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
          Length = 400

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 3/81 (3%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           VI+ G      G T++I+H++   T+Y H+      ++ G  VS+G  IG  G +G +  
Sbjct: 256 VIFAGTK-GGYGKTVIIQHENGYRTLYGHMHKINKGIRTGVYVSQGKQIGTVGSTGLSTG 314

Query: 60  PQVHFELRKNAIAMDPIKFLE 80
           P +HF L +N  A++P K L 
Sbjct: 315 PHLHFGLYRNGSALNPQKHLR 335


>gi|219871841|ref|YP_002476216.1| outer membrane antigenic lipoprotein B [Haemophilus parasuis
           SH0165]
 gi|219692045|gb|ACL33268.1| outer membrane antigenic lipoprotein B precursor [Haemophilus
           parasuis SH0165]
          Length = 391

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V++   V  G TI   G +G     +
Sbjct: 312 VVYAGNALQGYGNLIIIKHNDDFLSAYAHNDSIKVEEQDNVKAGETIATLGSTGTNS-NK 370

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  +
Sbjct: 371 LHFEIRYQGKSVDPARYLPRQ 391


>gi|167855930|ref|ZP_02478678.1| Outer membrane antigenic lipoprotein B precursor [Haemophilus
           parasuis 29755]
 gi|167852924|gb|EDS24190.1| Outer membrane antigenic lipoprotein B precursor [Haemophilus
           parasuis 29755]
          Length = 391

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H D+  V++   V  G TI   G +G     +
Sbjct: 312 VVYAGNALQGYGNLIIIKHNDDFLSAYAHNDSIKVEEQDNVKAGETIATLGSTGTNS-NK 370

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    ++DP ++L  +
Sbjct: 371 LHFEIRYQGKSVDPARYLPRQ 391


>gi|11761341|dbj|BAB19208.1| YebA [Shewanella violacea]
          Length = 299

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           ++ + G  +   G  + I H + + T Y H  +  V  G  V++G  I   G +G +  P
Sbjct: 217 VITWAGK-MSGYGELVEIDHGNGLRTRYGHNQSLSVTVGDVVAKGEGIAFMGSTGRSTGP 275

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VH+E+ +   A+DP KF+  K
Sbjct: 276 HVHYEVLRGGQAIDPKKFVYRK 297


>gi|317130983|ref|YP_004097265.1| peptidase M23 [Bacillus cellulosilyticus DSM 2522]
 gi|315475931|gb|ADU32534.1| Peptidase M23 [Bacillus cellulosilyticus DSM 2522]
          Length = 484

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 5   VGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHF 64
            G +    GNTI I H++ + T+Y+H+D+  V  GQ V +G  IG+ G +GN+    +HF
Sbjct: 409 AGWEN-GYGNTIRINHNNGMETMYAHLDSIDVSVGQTVGQGQKIGIMGSTGNSTGVHLHF 467

Query: 65  ELRKNAIAMDPIKFLEE 81
           E+  N    +P+ +L  
Sbjct: 468 EVYVNGQLKNPMDYLNR 484


>gi|296314082|ref|ZP_06864023.1| LysM domain/M23 peptidase domain protein [Neisseria polysaccharea
           ATCC 43768]
 gi|296839338|gb|EFH23276.1| LysM domain/M23 peptidase domain protein [Neisseria polysaccharea
           ATCC 43768]
          Length = 338

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 260 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 318

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 319 LHFEVRQNGKPVNPNSYI 336


>gi|269836237|ref|YP_003318465.1| peptidase M23 [Sphaerobacter thermophilus DSM 20745]
 gi|269785500|gb|ACZ37643.1| Peptidase M23 [Sphaerobacter thermophilus DSM 20745]
          Length = 363

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHI-DTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           V + G      G  + I H + + T+Y+H+   P+V  GQ V +G  IG  G +G +  P
Sbjct: 284 VTFAGWHGSGYGFMVQIDHGNGLSTLYAHMASQPWVSVGQWVEQGQHIGPIGSTGASTGP 343

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF +++N +  +P  +L 
Sbjct: 344 HLHFAVQRNGVWENPEHYLP 363


>gi|87118599|ref|ZP_01074498.1| Peptidoglycan-binding LysM:Peptidase M23B [Marinomonas sp. MED121]
 gi|86166233|gb|EAQ67499.1| Peptidoglycan-binding LysM:Peptidase  M23B [Marinomonas sp. MED121]
          Length = 281

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y GN L+  GN ++++H D  ++ Y++     V++ QKV  G  + + G  G  Q  
Sbjct: 202 VVVYAGNGLIGYGNLVIVKHSDEYLSAYAYNQRILVKEQQKVKAGQKLAIIGGKGE-QRS 260

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +HFE+RK+   ++P+K L +
Sbjct: 261 LLHFEVRKDGQPINPLKVLPK 281


>gi|308272528|emb|CBX29132.1| hypothetical protein N47_J01130 [uncultured Desulfobacterium sp.]
          Length = 399

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           +IY G      GN I+I H  S  T+Y+H++  +  KG  V     I  +G++G+     
Sbjct: 321 IIYSGW-FKGYGNMIIIDHGKSYYTIYAHLEESFKSKGDAVEADEVIASAGEAGSFSGTG 379

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           ++FE+R +   +DP+++ ++
Sbjct: 380 LYFEIRHHGKPLDPMEWFKK 399


>gi|203284183|ref|YP_002221923.1| hypothetical protein BDU_265 [Borrelia duttonii Ly]
 gi|201083626|gb|ACH93217.1| uncharacterized conserved protein [Borrelia duttonii Ly]
          Length = 422

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 45/80 (56%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G  +   G  I+I H++   T+Y+H+ +  V+ G +VSRG  IG  G +G +   
Sbjct: 343 IVVTAGFSVGGYGKYIVIAHNNGFQTLYAHLGSFAVKVGDRVSRGQMIGRMGSTGYSTGN 402

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + K+    +P+K+L 
Sbjct: 403 HLHFTIFKDGKTSNPMKYLR 422


>gi|134102137|ref|YP_001107798.1| membrane proteins related to metalloendopeptidases
           [Saccharopolyspora erythraea NRRL 2338]
 gi|291007612|ref|ZP_06565585.1| membrane proteins related to metalloendopeptidases
           [Saccharopolyspora erythraea NRRL 2338]
 gi|133914760|emb|CAM04873.1| membrane proteins related to metalloendopeptidases
           [Saccharopolyspora erythraea NRRL 2338]
          Length = 280

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      G  + ++HDD  VTVY HI+T  V  GQ+V  G  I   G  G +  P 
Sbjct: 197 VISAGPA-SGFGQWVRVQHDDGTVTVYGHINTIDVSVGQQVDAGEQIATMGNKGQSTGPH 255

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HFE+ +    ++P+ +L++
Sbjct: 256 LHFEVIEGGSKINPLPWLQK 275


>gi|126667565|ref|ZP_01738535.1| Membrane protein [Marinobacter sp. ELB17]
 gi|126627991|gb|EAZ98618.1| Membrane protein [Marinobacter sp. ELB17]
          Length = 268

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L+  GN +++ H +  ++ Y H     V++G+ V  G  I   G SG A+ P 
Sbjct: 189 VVYAGSGLLGYGNLVIVNHSEQYLSAYGHNRKILVKEGENVQAGQIIAELGSSG-AERPM 247

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+RKN   ++P  +L  +
Sbjct: 248 LHFEIRKNGNPVNPAYYLPAR 268


>gi|150396390|ref|YP_001326857.1| peptidase M23B [Sinorhizobium medicae WSM419]
 gi|150027905|gb|ABR60022.1| peptidase M23B [Sinorhizobium medicae WSM419]
          Length = 509

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 57/80 (71%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L ELGN +L+RHDD  VTVY +     VQ+GQKV RG T+  SG +G A  P
Sbjct: 430 VVIYSGSSLKELGNAVLVRHDDGTVTVYGNAAELKVQRGQKVQRGQTLASSGMTGRASRP 489

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RKNA  ++P+ +LE
Sbjct: 490 QVHFEVRKNATPVNPVTYLE 509


>gi|90020899|ref|YP_526726.1| lipoprotein NlpD [Saccharophagus degradans 2-40]
 gi|89950499|gb|ABD80514.1| peptidase M23B [Saccharophagus degradans 2-40]
          Length = 260

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  ++++H D  ++ Y+H     V++G  V+ G  I   G +G     +
Sbjct: 181 VVYAGDGLRGYGKLLIVKHSDKYLSAYAHNSRLLVKEGDVVAAGQKIAEMGSTG-TDSVK 239

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R +   ++P+ +L +K
Sbjct: 240 LHFEVRYDGQPVNPLNYLPKK 260


>gi|197121213|ref|YP_002133164.1| peptidase M23 [Anaeromyxobacter sp. K]
 gi|196171062|gb|ACG72035.1| Peptidase M23 [Anaeromyxobacter sp. K]
          Length = 294

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G      G  +++RHD  +VT+Y+H     V++G +V RG  I   G++G    P 
Sbjct: 217 VIYAGEQ-AGYGAVVILRHDGGLVTLYAHNSEVLVKEGARVDRGQPIARVGQTGRTTGPH 275

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+     +P+ FL 
Sbjct: 276 LHFEVREGTRPRNPLLFLP 294


>gi|148381545|ref|YP_001256086.1| putative peptidase [Clostridium botulinum A str. ATCC 3502]
 gi|153932276|ref|YP_001385919.1| putative peptidase [Clostridium botulinum A str. ATCC 19397]
 gi|153935479|ref|YP_001389326.1| putative peptidase [Clostridium botulinum A str. Hall]
 gi|148291029|emb|CAL85166.1| putative exported peptidase [Clostridium botulinum A str. ATCC
           3502]
 gi|152928320|gb|ABS33820.1| putative peptidase [Clostridium botulinum A str. ATCC 19397]
 gi|152931393|gb|ABS36892.1| putative peptidase [Clostridium botulinum A str. Hall]
          Length = 311

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G +    G  I I+H   ++T+Y+H    YV+ GQ V +G  IG  G +G +  P 
Sbjct: 234 VIYSGWE-EGYGKVIKIQHSSELITIYAHCSNLYVKVGQYVKKGEKIGEVGSTGRSTGPH 292

Query: 62  VHFELRKNAIAMDPIKFLE 80
           VHFELRKN    +P+ +++
Sbjct: 293 VHFELRKNNEPCNPLTYIK 311


>gi|71275115|ref|ZP_00651402.1| Peptidase M23B [Xylella fastidiosa Dixon]
 gi|71899667|ref|ZP_00681820.1| Peptidase M23B [Xylella fastidiosa Ann-1]
 gi|170731103|ref|YP_001776536.1| peptidase [Xylella fastidiosa M12]
 gi|71163924|gb|EAO13639.1| Peptidase  M23B [Xylella fastidiosa Dixon]
 gi|71730535|gb|EAO32613.1| Peptidase  M23B [Xylella fastidiosa Ann-1]
 gi|167965896|gb|ACA12906.1| peptidase [Xylella fastidiosa M12]
          Length = 369

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G      GN + + H +  +T Y+H     V+ G  V  G  +  +G SG +   
Sbjct: 275 VVSYAGYRN-GYGNVVDVDHSNGYLTRYAHNSRLMVKVGDLVRTGQEVAKAGSSGRSTGA 333

Query: 61  QVHFELRKNAIAMDPIKFL 79
            VHFEL K+ + M+PIKFL
Sbjct: 334 HVHFELWKDGVVMNPIKFL 352


>gi|145300342|ref|YP_001143183.1| lipoprotein NlpD [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142853114|gb|ABO91435.1| lipoprotein NlpD [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 348

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   G  I+++HDD  ++ Y+H D   V++G  V  G  I   G + +A   +
Sbjct: 269 VVYAGSALRGYGKLIILKHDDDYLSAYAHNDELRVKEGDSVKGGAVIANMGST-DAPDVR 327

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+ +L ++
Sbjct: 328 LHFEIRYRGKSINPMSYLPKR 348


>gi|89901552|ref|YP_524023.1| peptidase M23B [Rhodoferax ferrireducens T118]
 gi|89346289|gb|ABD70492.1| peptidase M23B [Rhodoferax ferrireducens T118]
          Length = 292

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVG  L   GN I+++H+++ +T Y+H  T  +++ Q V +G  I   G S ++   +
Sbjct: 213 VVYVGAGLRGYGNLIILKHNNTYLTAYAHNKTLLIKEDQSVRKGQKIAEMGSS-DSDRVK 271

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP ++L  +
Sbjct: 272 LHFEVRRQGKPVDPARYLPAR 292


>gi|241206498|ref|YP_002977594.1| peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860388|gb|ACS58055.1| Peptidase M23 [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 640

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           V   G D    GN  ++RH +   + Y+H       V  G K+ +G  IG  G +G +  
Sbjct: 524 VEKAGWDSGGYGNQTIVRHANGYESSYNHQSAIAKGVVPGAKIRQGQVIGWVGTTGESTG 583

Query: 60  PQVHFELRKNAIAMDPIKFLEEKIP 84
           P +H+EL  N   +DP   L  ++P
Sbjct: 584 PHLHYELIVNGTKVDP---LRIRLP 605


>gi|116254015|ref|YP_769853.1| transmembrane peptidase family protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258663|emb|CAK09767.1| putative transmembrane peptidase family protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 646

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           V   G D    GN  ++RH +   + Y+H       V  G K+ +G  IG  G +G +  
Sbjct: 530 VEKAGWDSGGYGNQTIVRHANGYESSYNHQSAIAKGVVPGAKIRQGQVIGWVGTTGESTG 589

Query: 60  PQVHFELRKNAIAMDPIKFLEEKIP 84
           P +H+EL  N   +DP   L  ++P
Sbjct: 590 PHLHYELIVNGTKVDP---LRIRLP 611


>gi|33863023|ref|NP_894583.1| M23/M37 familypeptidase [Prochlorococcus marinus str. MIT 9313]
 gi|33634940|emb|CAE20926.1| Peptidase family M23/M37 [Prochlorococcus marinus str. MIT 9313]
          Length = 335

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G  +   G  + I H D   T Y+H     V+KGQ V +G TI   G +G +  P
Sbjct: 252 IVTHAGW-MAGYGYLVEISHSDGASTRYAHNSKLLVRKGQLVPQGATISKMGSTGRSTGP 310

Query: 61  QVHFELR-KNAIAMDPIKFLE 80
            +HFE+R K  IAM+P   L 
Sbjct: 311 HLHFEIRKKGGIAMNPRTLLP 331


>gi|134295679|ref|YP_001119414.1| peptidase M23B [Burkholderia vietnamiensis G4]
 gi|134138836|gb|ABO54579.1| peptidase M23B [Burkholderia vietnamiensis G4]
          Length = 422

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G+ +++ H D   T Y+H+      ++ G+ V +G  IG  G +G A 
Sbjct: 277 VVSFVGTDPGGYGHYVIVDHADGYSTYYAHLSAYARGLKVGETVKQGQRIGSVGMTGAAT 336

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 337 GPHLHFEVRIANDPVDPL 354


>gi|325131208|gb|EGC53921.1| lysM domain protein [Neisseria meningitidis M6190]
          Length = 335

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 257 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 315

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 316 LHFEVRQNGKPVNPNSYI 333


>gi|326792556|ref|YP_004310377.1| peptidase M23 [Clostridium lentocellum DSM 5427]
 gi|326543320|gb|ADZ85179.1| Peptidase M23 [Clostridium lentocellum DSM 5427]
          Length = 380

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G  +   GNT++I H   IVT+Y H  +  V +GQ VS+G  +   G +G +   
Sbjct: 302 VVITAGW-INGYGNTVMISHGSGIVTLYGHNSSVVVSQGQTVSKGQVVAKIGSTGYSTGN 360

Query: 61  QVHFELRKNAIAMDPIKFLE 80
             HFE+R N     P  +L 
Sbjct: 361 HCHFEVRVNGSHTSPWPYLN 380


>gi|206896081|ref|YP_002246839.1| peptidase, M23/M37 family [Coprothermobacter proteolyticus DSM
           5265]
 gi|206738698|gb|ACI17776.1| peptidase, M23/M37 family [Coprothermobacter proteolyticus DSM
           5265]
          Length = 298

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G D    G +++I H +   T Y+H+ +  V+ GQ V +G  +G  G++G A   
Sbjct: 220 VVIQAGRD-GSYGLSVIISHGNGYTTRYAHLSSIAVKVGQTVLKGDYVGAIGQTGFATGC 278

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE++ N   +DP K L 
Sbjct: 279 HLHFEVKLNGTLIDPYKVLP 298


>gi|332288028|ref|YP_004169214.1| peptidase M23B [Bacillus thuringiensis CT43]
 gi|315273100|gb|ADU03169.1| peptidase M23B [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 294

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V + G  +   GN +++ H +   T Y+H+++  V K  KV  G  IG  G +G++    
Sbjct: 214 VTFAGT-MGGYGNLVILDHGNGFETRYAHLNSITVSKDAKVIAGQIIGHVGSTGDSTGAH 272

Query: 62  VHFELRKNAIAMDPIKF 78
           +H E R N   ++P+  
Sbjct: 273 LHLETRMNGQVLNPLSL 289


>gi|118471629|ref|YP_889763.1| peptidoglycan-binding LysM [Mycobacterium smegmatis str. MC2 155]
 gi|118172916|gb|ABK73812.1| peptidoglycan-binding LysM [Mycobacterium smegmatis str. MC2 155]
          Length = 347

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V  VG      G  + IRH D  VT+Y HI+T  V  G++V  G  I   G  G +  P
Sbjct: 257 VVTDVGP-TAGYGAWVKIRHSDGTVTLYGHINTWLVSVGERVMAGDQIATMGNRGYSTGP 315

Query: 61  QVHFELRKNAI-AMDPIKFLEEK 82
            +HFE+  N    +DP+ +L ++
Sbjct: 316 HLHFEVLTNGTNRIDPVGWLAKR 338


>gi|332703804|ref|ZP_08423892.1| Peptidase M23 [Desulfovibrio africanus str. Walvis Bay]
 gi|332553953|gb|EGJ50997.1| Peptidase M23 [Desulfovibrio africanus str. Walvis Bay]
          Length = 301

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G      G  + I H    +T Y H+    V+ GQ V+RG  +G  G +G +  P
Sbjct: 222 VVVNAGRR-GAYGLRVSIDHGAGTITRYGHMHRISVKPGQTVTRGELVGYVGTTGRSTGP 280

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+R N + +DP++++
Sbjct: 281 HLHYEVRLNGLPVDPMRYI 299


>gi|284097844|ref|ZP_06385820.1| peptidase M23B [Candidatus Poribacteria sp. WGA-A3]
 gi|283830639|gb|EFC34773.1| peptidase M23B [Candidatus Poribacteria sp. WGA-A3]
          Length = 383

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y    L   G  +++ H ++  T Y+H     V++G  V++G  +G +G SG      
Sbjct: 304 VVYADW-LRGYGLVVIVDHGNNYFTFYAHASKLLVKEGATVAKGAVLGETGSSGLTNRNV 362

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           ++FELRK    ++P+++L ++
Sbjct: 363 LYFELRKGTKPVNPLRWLAKR 383


>gi|170736684|ref|YP_001777944.1| peptidase M23B [Burkholderia cenocepacia MC0-3]
 gi|254249346|ref|ZP_04942666.1| hypothetical protein BCPG_04209 [Burkholderia cenocepacia PC184]
 gi|124875847|gb|EAY65837.1| hypothetical protein BCPG_04209 [Burkholderia cenocepacia PC184]
 gi|169818872|gb|ACA93454.1| peptidase M23B [Burkholderia cenocepacia MC0-3]
          Length = 457

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V ++G +    G  ++IRHD    + Y+H+    P ++ G +V RG  +G  G +G A 
Sbjct: 330 VVTFIGTEPRGYGKYVVIRHDGGYASYYAHLSAFEPTLRTGARVMRGQRVGAVGSTGTAT 389

Query: 59  HPQVHFELRKNAIAMDPIKFLE 80
            P +HFE+R++A  +DPI+ ++
Sbjct: 390 GPHLHFEVRRHARLVDPIELVQ 411


>gi|170748227|ref|YP_001754487.1| peptidase M23 [Methylobacterium radiotolerans JCM 2831]
 gi|170654749|gb|ACB23804.1| Peptidase M23 [Methylobacterium radiotolerans JCM 2831]
          Length = 414

 Score = 91.0 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 38/78 (48%)

Query: 3   IYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQV 62
           +         GN + I H   + T + H+    V+ GQ+V+ G  +G  G +G +    +
Sbjct: 324 VIAAEAAGGYGNMVEIDHGHGVSTRFGHLARIAVRPGQRVAAGDVVGAVGSTGRSTGAHL 383

Query: 63  HFELRKNAIAMDPIKFLE 80
           H+E R +   +DP +FLE
Sbjct: 384 HYETRIDGEPVDPQRFLE 401


>gi|325134601|gb|EGC57244.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           M13399]
          Length = 415

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|83644206|ref|YP_432641.1| membrane-bound metallopeptidase [Hahella chejuensis KCTC 2396]
 gi|83632249|gb|ABC28216.1| Membrane-bound metallopeptidase [Hahella chejuensis KCTC 2396]
          Length = 386

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++    L   G  ++I H D  +++Y +        G  V  G T+  +G SG      
Sbjct: 308 VVFADW-LRGFGLLMIIDHGDGYMSLYGYNQALLKDTGDWVRSGETVASAGSSGGQSETG 366

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           ++FE+R N    DP+++ ++
Sbjct: 367 LYFEIRHNGKPDDPLRWFKK 386


>gi|294142796|ref|YP_003558774.1| M23/M37 family peptidase [Shewanella violacea DSS12]
 gi|293329265|dbj|BAJ03996.1| peptidase, M23/M37 family [Shewanella violacea DSS12]
          Length = 299

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           ++ + G  +   G  + I H + + T Y H  +  V  G  V++G  I   G +G +  P
Sbjct: 217 VITWAGK-MSGYGELVEIDHGNGLRTRYGHNQSLSVTVGDVVAKGEGIAFMGSTGRSTGP 275

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VH+E+ +   A+DP KF+  K
Sbjct: 276 HVHYEVLRGGQAIDPKKFVYRK 297


>gi|237708797|ref|ZP_04539278.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|237724235|ref|ZP_04554716.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|265755937|ref|ZP_06090404.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|229437423|gb|EEO47500.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
 gi|229457223|gb|EEO62944.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263234015|gb|EEZ19616.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 322

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G +    GNTI + H    +T Y+H+    V+ GQKV RG  IG  G +G +  P
Sbjct: 221 VVVKAGWET-GYGNTIEVNHGFGYLTRYAHLSAYKVRPGQKVVRGEVIGAVGSTGKSTGP 279

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E+       +P+ +
Sbjct: 280 HLHYEVHVKGKVQNPVNY 297


>gi|187777408|ref|ZP_02993881.1| hypothetical protein CLOSPO_00975 [Clostridium sporogenes ATCC
           15579]
 gi|187774336|gb|EDU38138.1| hypothetical protein CLOSPO_00975 [Clostridium sporogenes ATCC
           15579]
          Length = 311

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G +    G  I I+H+  ++T+Y+H    YV+ GQ V +G  IG  G +G +  P 
Sbjct: 234 VIYSGWE-EGYGKVIKIKHNSELITIYAHCSKLYVKVGQYVKKGEKIGEVGNTGRSTGPH 292

Query: 62  VHFELRKNAIAMDPIKFLE 80
           VHFELRKN    +P+ +++
Sbjct: 293 VHFELRKNNEPCNPLIYIK 311


>gi|187478471|ref|YP_786495.1| peptidoglycan-binding peptidase [Bordetella avium 197N]
 gi|115423057|emb|CAJ49588.1| putative peptidoglycan-binding peptidase [Bordetella avium 197N]
          Length = 283

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN +  LGN I+I H +  +T Y+H  T  V+ GQ V RG  +   G+S +A  P+
Sbjct: 204 VMYSGNGVRGLGNLIIINHQNGFITAYAHNRTLLVKTGQDVKRGAKVAELGQS-DASSPK 262

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 263 LHFEIRRQGTPVDPMQYLPAR 283


>gi|294661198|ref|YP_003573074.1| hypothetical protein Aasi_1633 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|227336349|gb|ACP20946.1| hypothetical protein Aasi_1633 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 286

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 41/79 (51%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V  V   +   GN ++I H    +T Y+H+ +  V  G KV RG  IG  G +G    P
Sbjct: 184 VVKDVKKSMTGYGNQVVINHGYGFLTRYAHMQSFKVAPGDKVKRGQCIGYVGNTGCTSGP 243

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E+ KN   ++P  +L
Sbjct: 244 HLHYEVIKNGKKVNPTYYL 262


>gi|4929284|gb|AAD33932.1|AF144608_1 lipoprotein NlpD [Vibrio parahaemolyticus]
          Length = 203

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A+  +
Sbjct: 126 VVYSGNALRGYGNLIIVKHNDNYLSAYAHNDKLLVTEGQSVKSGQKIATMGSSG-AKSVK 184

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    +++P ++L 
Sbjct: 185 LHFEIRYQGKSVNPKRYLP 203


>gi|85058508|ref|YP_454210.1| lipoprotein NlpD [Sodalis glossinidius str. 'morsitans']
 gi|84779028|dbj|BAE73805.1| lipoprotein [Sodalis glossinidius str. 'morsitans']
          Length = 362

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H+D  ++ Y+H DT  V++ Q+V  G  I   G +G +   +
Sbjct: 283 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVRAGQKIATMGSTGTSTT-R 341

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R    +++P+++L ++
Sbjct: 342 LHFEIRYKGKSVNPLRYLPQR 362


>gi|293603452|ref|ZP_06685877.1| membrane-bound metalloendopeptidase [Achromobacter piechaudii ATCC
           43553]
 gi|292818154|gb|EFF77210.1| membrane-bound metalloendopeptidase [Achromobacter piechaudii ATCC
           43553]
          Length = 328

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+         GN + I H D ++T Y+H  +  V++GQ V RG  +   G SG +  P
Sbjct: 230 VVLEAKFQP-GFGNMVEIDHGDGLITRYAHASSLMVKQGQLVERGQQVARVGSSGRSTGP 288

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R     +DP  FL
Sbjct: 289 HLHFEVRLAGQPLDPRLFL 307


>gi|289547838|ref|YP_003472826.1| peptidase M23 [Thermocrinis albus DSM 14484]
 gi|289181455|gb|ADC88699.1| Peptidase M23 [Thermocrinis albus DSM 14484]
          Length = 438

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G  L   GNT++I H   ++++Y H+ +  V++GQ V +G  IG +GK+G A   
Sbjct: 344 VVVFTGP-LGIYGNTVVIDHGLGLMSLYGHLSSIQVKEGQYVRKGDIIGRTGKTGLALGD 402

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HF +      ++P+ +L+EK
Sbjct: 403 HLHFGILVQGYEVNPLPWLDEK 424


>gi|254819359|ref|ZP_05224360.1| hypothetical protein MintA_05508 [Mycobacterium intracellulare ATCC
           13950]
          Length = 215

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G      G  + +RH D  VT+Y HI+T  V  G++V  G  I   G  GN+  P
Sbjct: 125 VVIEAGPA-GGYGMLVKLRHADGTVTLYGHINTALVSVGERVMAGDQIATMGNRGNSTGP 183

Query: 61  QVHFELRKNAI-AMDPIKFLEEK 82
            +HFE+ +     +DP+ +L ++
Sbjct: 184 HLHFEVLQGGTERIDPVPWLAKR 206


>gi|170696975|ref|ZP_02888071.1| peptidase M23B [Burkholderia ambifaria IOP40-10]
 gi|170138149|gb|EDT06381.1| peptidase M23B [Burkholderia ambifaria IOP40-10]
          Length = 409

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (60%), Gaps = 2/82 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V ++GN+    G  ++IRHD    + Y+H+    P ++ G +V RG  +G  G +G A 
Sbjct: 282 VVTFIGNEPGGYGKYVVIRHDGGYASYYAHLSAFEPTLRTGARVVRGQRVGAVGSTGTAT 341

Query: 59  HPQVHFELRKNAIAMDPIKFLE 80
            P +HFE+R++A  ++PI+ +E
Sbjct: 342 GPHLHFEVRRHARLVNPIELVE 363


>gi|290968087|ref|ZP_06559636.1| peptidase, M23 family [Megasphaera genomosp. type_1 str. 28L]
 gi|290781993|gb|EFD94572.1| peptidase, M23 family [Megasphaera genomosp. type_1 str. 28L]
          Length = 308

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 34/76 (44%), Gaps = 1/76 (1%)

Query: 5   VGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHF 64
               +   GN + I H     T Y+H     V  GQ V  G  I LSG +G    P VH+
Sbjct: 234 AAW-IAGYGNLVEIAHGQGYSTRYAHNSLLLVVAGQHVQAGDIIALSGNTGRTTGPHVHY 292

Query: 65  ELRKNAIAMDPIKFLE 80
           E+R     +DP+ FL 
Sbjct: 293 EVRIQGKPVDPMLFLP 308


>gi|169830497|ref|YP_001716479.1| peptidase M23B [Candidatus Desulforudis audaxviator MP104C]
 gi|169637341|gb|ACA58847.1| peptidase M23B [Candidatus Desulforudis audaxviator MP104C]
          Length = 374

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVG  L   GN I++ H   + T+Y+H+ T  V +GQ V++G TI   G +G +  P 
Sbjct: 297 VLYVGT-LRGYGNVIVLDHGGGVTTLYAHLSTMGVSEGQIVAQGETIARVGSTGLSTGPH 355

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HF +R++   + P  +L 
Sbjct: 356 LHFTVREHGEVVSPWNYLR 374


>gi|285017951|ref|YP_003375662.1| outer membrane lipoprotein precursor [Xanthomonas albilineans GPE
           PC73]
 gi|283473169|emb|CBA15675.1| putative outer membrane lipoprotein precursor [Xanthomonas
           albilineans]
          Length = 267

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+++H++  ++ Y H     V +GQ V  G  I   G+SG A   
Sbjct: 187 VVVYSGAGLVGYGELIIVKHNEQWLSAYGHNRKRLVNEGQNVKAGQQIAEMGRSG-AARD 245

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R N   +DP+ +L  +
Sbjct: 246 MLHFEIRYNGKPVDPLLYLPPR 267


>gi|284989896|ref|YP_003408450.1| peptidase M23 [Geodermatophilus obscurus DSM 43160]
 gi|284063141|gb|ADB74079.1| Peptidase M23 [Geodermatophilus obscurus DSM 43160]
          Length = 320

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 43/85 (50%), Gaps = 4/85 (4%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G      G  + ++H +  VTVY H+D   V  GQ V  G TI L G  G +  P
Sbjct: 233 VVLEAGPA-SGYGLAVFVQHGNGDVTVYGHMDEILVSAGQVVRAGDTIALLGNRGQSTGP 291

Query: 61  QVHFELR---KNAIAMDPIKFLEEK 82
            +HFE+R        +DP+ +L E+
Sbjct: 292 HLHFEVRLGGLGGQKVDPVPYLRER 316


>gi|325205762|gb|ADZ01215.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           M04-240196]
          Length = 415

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|119953061|ref|YP_945270.1| cell wall endopeptidase, family M23/M37 [Borrelia turicatae 91E135]
 gi|119861832|gb|AAX17600.1| cell wall endopeptidase, family M23/M37 [Borrelia turicatae 91E135]
          Length = 421

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 46/80 (57%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G  +   G  I+I H++   T+Y+H+ +  V+ GQ+VSRG  IG  G +G +   
Sbjct: 342 IVVTAGFSVGGYGKYIIISHNNGFQTLYAHLGSFAVKVGQRVSRGQIIGRMGSTGYSTGN 401

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + K+    +P+K+L 
Sbjct: 402 HLHFTIFKDGKTGNPMKYLR 421


>gi|291540818|emb|CBL13929.1| Membrane proteins related to metalloendopeptidases [Roseburia
           intestinalis XB6B4]
          Length = 520

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI    +    GN+++I H D  +T Y+H     V+ GQKV +G  I LSG +G +  P 
Sbjct: 442 VIQASYN-GGYGNSVVISHADGRLTRYAHNSKLLVKVGQKVEQGEPIALSGSTGRSTGPH 500

Query: 62  VHFELRKNAIAMDPIKFL 79
           VHFE+     A++P+K++
Sbjct: 501 VHFEIYIGGAAVNPLKYI 518


>gi|161870350|ref|YP_001599520.1| lipoprotein NlpD, putative [Neisseria meningitidis 053442]
 gi|161595903|gb|ABX73563.1| lipoprotein NlpD, putative [Neisseria meningitidis 053442]
 gi|308389118|gb|ADO31438.1| putative lipoprotein NlpD [Neisseria meningitidis alpha710]
 gi|325130557|gb|EGC53309.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           OX99.30304]
 gi|325136624|gb|EGC59225.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           M0579]
          Length = 415

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|85716323|ref|ZP_01047296.1| peptidase M23B [Nitrobacter sp. Nb-311A]
 gi|85696839|gb|EAQ34724.1| peptidase  M23B [Nitrobacter sp. Nb-311A]
          Length = 398

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 37/78 (47%)

Query: 3   IYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQV 62
           +   N     G  + + H + + T Y H+    V+ GQ V  G  +G  G +G +  P +
Sbjct: 313 VIAANWTGGYGRMVEVNHGNGLSTRYGHLSAINVKVGQSVKAGQVVGEVGSTGRSTGPHL 372

Query: 63  HFELRKNAIAMDPIKFLE 80
           H+E R    A+DP KFL 
Sbjct: 373 HYETRIEGDAVDPQKFLR 390


>gi|325268020|ref|ZP_08134666.1| M23 peptidase domain protein [Kingella denitrificans ATCC 33394]
 gi|324980405|gb|EGC16071.1| M23 peptidase domain protein [Kingella denitrificans ATCC 33394]
          Length = 446

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V + G      GN +++ H + + T+Y H+      V++G  V  G  IGL G +G + 
Sbjct: 328 VVRFRGWK-GGYGNAVILAHGNGLETLYGHLSAFISGVEEGTSVQAGDVIGLVGSTGRST 386

Query: 59  HPQVHFELRKNAIAMDPIK 77
            P +H+E+R +   ++P  
Sbjct: 387 GPHLHYEVRIDGQHVNPAT 405


>gi|83589115|ref|YP_429124.1| peptidase M23B [Moorella thermoacetica ATCC 39073]
 gi|83572029|gb|ABC18581.1| Peptidase M23B [Moorella thermoacetica ATCC 39073]
          Length = 377

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G  L   GN I+I H   + T+Y+H+    VQ GQ+V +G  IG  G +G +  P 
Sbjct: 301 VISTGY-LGGYGNHIVIDHGGGLSTMYAHLSAILVQNGQEVKKGQVIGRVGSTGWSTGPH 359

Query: 62  VHFELRKNAIAMDPIKF 78
           +HF +       +P+ +
Sbjct: 360 LHFMVLLQGEPTNPMNY 376


>gi|298207537|ref|YP_003715716.1| putative peptidase [Croceibacter atlanticus HTCC2559]
 gi|83850173|gb|EAP88041.1| putative peptidase [Croceibacter atlanticus HTCC2559]
          Length = 325

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           ++    +     GN I I H     ++Y+H+    V+KGQ+V RG  IG  G +G +Q P
Sbjct: 223 VIERADSRSTGYGNHIRIDHGYGYTSLYAHLYKYNVKKGQRVKRGDVIGFVGSTGRSQAP 282

Query: 61  QVHFELRKNAIAMDPIKF 78
            +H+E+ K+   ++PI F
Sbjct: 283 HLHYEIFKDGERINPINF 300


>gi|299541795|ref|ZP_07052118.1| metalloprotease yebA precursor [Lysinibacillus fusiformis ZC1]
 gi|298725533|gb|EFI66174.1| metalloprotease yebA precursor [Lysinibacillus fusiformis ZC1]
          Length = 486

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G      GN I+I H++   T+Y H+ +  V+ GQ V +G  IG+ G +GN+   
Sbjct: 407 VVVAAGTS-GTYGNRIVINHNNGFTTLYGHLSSINVEVGQVVEKGSVIGIMGSTGNSTGT 465

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +HFE+ KN    +P+ ++  
Sbjct: 466 HLHFEVEKNGSLENPLSYVGR 486


>gi|254480037|ref|ZP_05093285.1| M23 peptidase domain protein [marine gamma proteobacterium
           HTCC2148]
 gi|214039599|gb|EEB80258.1| M23 peptidase domain protein [marine gamma proteobacterium
           HTCC2148]
          Length = 273

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G+     G  + I H D  VT YSH     V+ G  V +G  I L G +G +   
Sbjct: 191 VVTYTGSK-SGYGEMVEISHGDGFVTRYSHNKEVLVKSGDVVRKGEAIALMGSTGRSTGA 249

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VH+E+ K+  ++DP  ++  
Sbjct: 250 HVHYEVYKHGRSVDPSSYVRR 270


>gi|319901113|ref|YP_004160841.1| Peptidase M23 [Bacteroides helcogenes P 36-108]
 gi|319416144|gb|ADV43255.1| Peptidase M23 [Bacteroides helcogenes P 36-108]
          Length = 322

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G +    GN ++I H     T Y+H+     + G+KV RG  IG  G +G +  P 
Sbjct: 222 VIKAGWET-GYGNVVIIDHGFGYQTWYAHLQGFRTKPGKKVVRGEVIGEVGSTGKSTGPH 280

Query: 62  VHFELRKNAIAMDPIKF 78
           +H+E+      ++P+ +
Sbjct: 281 LHYEVHVKGRVVNPVNY 297


>gi|325201826|gb|ADY97280.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           M01-240149]
 gi|325208422|gb|ADZ03874.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           NZ-05/33]
          Length = 415

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|206890222|ref|YP_002247906.1| membrane protein [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206742160|gb|ACI21217.1| membrane protein [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 278

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G      GN ++I+H     TVY+H     V  GQKV RG  I +SG +G+   P
Sbjct: 197 IVVFSGYQGR-NGNVVMIKHGYGFTTVYAHNKQNLVNVGQKVKRGDIIAISGNTGSTTGP 255

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +H+E+ KN   + P+ +L+E
Sbjct: 256 HLHYEVWKNNSPVSPLSYLKE 276


>gi|216264621|ref|ZP_03436613.1| M23 peptidase domain protein [Borrelia burgdorferi 156a]
 gi|215981094|gb|EEC21901.1| M23 peptidase domain protein [Borrelia burgdorferi 156a]
          Length = 417

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 46/80 (57%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +++  G +    G  I+I H +   T+Y+H+++  V+ G+KVSRG  IG  G +G +   
Sbjct: 338 VIVTAGFNAGGYGKYIVISHSNGFQTLYAHLNSFAVKVGKKVSRGAVIGYMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + KN    +P+K+L 
Sbjct: 398 HLHFTIFKNGKTENPMKYLR 417


>gi|218460656|ref|ZP_03500747.1| lipoprotein precursor protein [Rhizobium etli Kim 5]
          Length = 161

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 82  VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVARGQKIQRGQTVAVSGMSGDVKQP 141

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 142 QVHFEVRKDASPVNPMTFLE 161


>gi|319427217|gb|ADV55291.1| Peptidase M23 [Shewanella putrefaciens 200]
          Length = 294

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H +  ++ Y+H D   V++ Q V  G T+   G +G      
Sbjct: 215 VVYAGSALRGYGNLVIIKHSEDYLSAYAHTDQILVEEKQHVLAGQTVAKMGSTG-TDQVM 273

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           + FE+R +  +++P+ +L ++
Sbjct: 274 LRFEIRYHGQSVNPLNYLPKQ 294


>gi|56459555|ref|YP_154836.1| hypothetical protein IL0444 [Idiomarina loihiensis L2TR]
 gi|56178565|gb|AAV81287.1| Membrane protein [Idiomarina loihiensis L2TR]
          Length = 310

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G D    G  + I H   + T Y H D   V  G  V+RG  I   G SG +  P
Sbjct: 226 VVTWAG-DRYGYGTLVEIDHGGGLKTRYGHNDELTVSVGDVVTRGQQIAKMGSSGRSTGP 284

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VH+E+ +N   +DP +F+  K
Sbjct: 285 HVHYEVLRNGRQIDPNQFVYRK 306


>gi|296134395|ref|YP_003641642.1| Peptidase M23 [Thermincola sp. JR]
 gi|296032973|gb|ADG83741.1| Peptidase M23 [Thermincola potens JR]
          Length = 276

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G +    GN +++ H D + T+Y+H     V +G+ V +G  I L G +G +  P
Sbjct: 195 VVVFAG-ERGTYGNAVIVDHGDGLRTLYAHASKVLVSEGEVVEKGQVIALVGNTGRSTGP 253

Query: 61  QVHFELRKNAIAMDPIKFLE 80
             HFE+      ++P  +L 
Sbjct: 254 HTHFEVLAGGRPLNPAYYLP 273


>gi|307296489|ref|ZP_07576312.1| Peptidase M23 [Sphingobium chlorophenolicum L-1]
 gi|306878003|gb|EFN09227.1| Peptidase M23 [Sphingobium chlorophenolicum L-1]
          Length = 230

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V   G      G  + + H   + T Y H+    VQ GQ+V R   IG  G +G +  P
Sbjct: 155 IVSRAGWS-GGYGLLVALNHGQRMATRYGHMSRLAVQPGQRVLRNSIIGYVGSTGRSTGP 213

Query: 61  QVHFELRKNAIAMDPIK 77
            +H+E+ +N  A+DP+ 
Sbjct: 214 HLHYEVLRNGRAVDPLN 230


>gi|304316122|ref|YP_003851267.1| peptidase M23 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302777624|gb|ADL68183.1| Peptidase M23 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 379

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 38/67 (56%)

Query: 14  NTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAM 73
           N ++I H   I T+Y H     V  G+ V RG  I  +G +G +  P  HFE+RKN + +
Sbjct: 313 NAVIIDHGGGITTLYGHNSELLVTVGESVKRGQQIAKAGSTGLSTGPHCHFEVRKNGVPV 372

Query: 74  DPIKFLE 80
           +P+ +L+
Sbjct: 373 NPMDWLK 379


>gi|68536645|ref|YP_251350.1| putative secreted metallopeptidase [Corynebacterium jeikeium K411]
 gi|68264244|emb|CAI37732.1| putative secreted metallopeptidase [Corynebacterium jeikeium K411]
          Length = 252

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN I I+HDD  +TVY H+ T  V+ G +V+ G  I   G  G +    
Sbjct: 168 VIDSGPA-SGFGNWIRIKHDDGTITVYGHMATLDVKVGDRVTAGQKIAGMGSEGFSTGSH 226

Query: 62  VHFELRKN-AIAMDPIKFLEEK 82
           +HFE+R N   A+DP  +L E+
Sbjct: 227 LHFEVRPNDGDAIDPKPWLAER 248


>gi|301167119|emb|CBW26698.1| putative exported peptidase [Bacteriovorax marinus SJ]
          Length = 217

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 50/82 (60%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G ++   GN  ++ H + I +VY+H    Y  KGQKV +G  I L G +G +  P
Sbjct: 134 VVVYSGKEMGGYGNITVVAHKNGIFSVYAHASKNYTAKGQKVHKGQVIALVGSTGRSTGP 193

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            +HFE+R+N+ A++P  F+  K
Sbjct: 194 HLHFEIRRNSKALNPKNFVSYK 215


>gi|304387121|ref|ZP_07369369.1| lipoprotein NlpD [Neisseria meningitidis ATCC 13091]
 gi|304338795|gb|EFM04901.1| lipoprotein NlpD [Neisseria meningitidis ATCC 13091]
          Length = 180

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 102 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 160

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 161 LHFEVRQNGKPVNPNSYI 178


>gi|172060592|ref|YP_001808244.1| peptidase M23 [Burkholderia ambifaria MC40-6]
 gi|171993109|gb|ACB64028.1| Peptidase M23 [Burkholderia ambifaria MC40-6]
          Length = 425

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D    G  +++ H D   T Y+H+      ++ G+ V +G  IG  G +G A 
Sbjct: 280 VVSFVGTDADGYGRYVIVDHADGYSTYYAHLSAYARGLKTGETVKQGQRIGSVGMTGAAT 339

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R     +DP+
Sbjct: 340 GPHLHFEVRVANDPVDPL 357


>gi|86157096|ref|YP_463881.1| peptidase M23B [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773607|gb|ABC80444.1| peptidase M23B [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 372

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      GN +++ H D   T+ +H+ +     G+ V+ G  +G  G +G+ + P 
Sbjct: 294 VVHAGW-FKGYGNIVIVDHGDGFHTLVAHLASMRTAMGEDVAAGAVLGTVGDTGSLKGPY 352

Query: 62  VHFELRKNAIAMDPIKFL 79
           ++FELR+    +DP  +L
Sbjct: 353 LYFELREKGRPVDPRPWL 370


>gi|325204466|gb|ADY99919.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           M01-240355]
          Length = 415

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|302343761|ref|YP_003808290.1| peptidase M23 [Desulfarculus baarsii DSM 2075]
 gi|301640374|gb|ADK85696.1| Peptidase M23 [Desulfarculus baarsii DSM 2075]
          Length = 265

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+ G +    GN +++RH D   T Y+H     V +GQ+VSRG  I   G +G +  P 
Sbjct: 180 VIFAGEN-GGYGNLVIVRHVDGRQTYYAHCQDILVAEGQQVSRGQVIATVGSTGTSTGPH 238

Query: 62  VHFELRKN-AIAMDPIK 77
           +HFE+R +     DP+ 
Sbjct: 239 LHFEVRNSVGQPQDPLP 255


>gi|332298381|ref|YP_004440303.1| Peptidase M23 [Treponema brennaborense DSM 12168]
 gi|332181484|gb|AEE17172.1| Peptidase M23 [Treponema brennaborense DSM 12168]
          Length = 311

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 42/69 (60%)

Query: 12  LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAI 71
            GN I+I HD++  +VY+H+    V+KG  V+ G  IG  G +G +  P +HFE+R N  
Sbjct: 241 YGNFIIIDHDNNTQSVYAHLSRILVEKGNSVTGGSIIGNVGSTGLSTGPHLHFEIRINGS 300

Query: 72  AMDPIKFLE 80
           A DP KFL 
Sbjct: 301 AQDPRKFLP 309


>gi|297614549|gb|ADI48580.1| putative lipoprotein NlpD [uncultured bacterium fss6]
          Length = 286

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   G  I+++H+D  +T Y+H     V++ Q V++G  I   G + +A+  +
Sbjct: 205 VVYAGNALKGYGQLIILKHNDDYITAYAHNQQLLVKEQQWVNKGDEIAAMGDT-DAERVK 263

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           +HF++R    +++P  +L  
Sbjct: 264 LHFQVRFRGKSVNPRHYLPR 283


>gi|75910952|ref|YP_325248.1| peptidase M23B [Anabaena variabilis ATCC 29413]
 gi|75704677|gb|ABA24353.1| Peptidase M23B [Anabaena variabilis ATCC 29413]
          Length = 333

 Score = 90.6 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 34/88 (38%), Positives = 45/88 (51%), Gaps = 5/88 (5%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G D   LGN I I+H +  VTVY H       KGQ+V +G  I   G +GN+  P 
Sbjct: 99  VVKAGWDEWGLGNAIEIKHPNGSVTVYGHNRRLLASKGQQVRQGQIIAEMGSTGNSTAPH 158

Query: 62  VHFELRKNAI-AMDPIKFLEE----KIP 84
           +HFE   N   A++P+  L      KIP
Sbjct: 159 LHFEYYPNGKVAVNPMTVLASATANKIP 186


>gi|121635163|ref|YP_975408.1| putative membrane peptidase [Neisseria meningitidis FAM18]
 gi|120866869|emb|CAM10628.1| putative membrane peptidase [Neisseria meningitidis FAM18]
          Length = 415

 Score = 90.6 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|254230503|ref|ZP_04923876.1| M23 peptidase domain protein [Vibrio sp. Ex25]
 gi|262393288|ref|YP_003285142.1| membrane protein [Vibrio sp. Ex25]
 gi|151936975|gb|EDN55860.1| M23 peptidase domain protein [Vibrio sp. Ex25]
 gi|262336882|gb|ACY50677.1| membrane protein [Vibrio sp. Ex25]
          Length = 307

 Score = 90.6 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A+  +
Sbjct: 230 VVYSGNALRGYGNLIIVKHNDNYLSAYAHNDKLLVSEGQSVKSGQKIATMGSSG-AKSVK 288

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    +++P ++L 
Sbjct: 289 LHFEIRYQGKSVNPKRYLP 307


>gi|212211993|ref|YP_002302929.1| peptidoglycan-specific endopeptidase, M23 family [Coxiella burnetii
           CbuG_Q212]
 gi|212010403|gb|ACJ17784.1| peptidoglycan-specific endopeptidase, M23 family [Coxiella burnetii
           CbuG_Q212]
          Length = 230

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  +   GN I+++H ++ ++ Y+      V++G +V  G  I   G++ N+   
Sbjct: 152 VVVYSGAGIRGYGNLIIVKHTNTYLSAYAFNKRILVKEGSRVCAGQKIAEMGRT-NSGRV 210

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+R+N   ++P+++L
Sbjct: 211 MLHFEIRRNGQPVNPLRYL 229


>gi|91227835|ref|ZP_01262008.1| lipoprotein NlpD [Vibrio alginolyticus 12G01]
 gi|91188345|gb|EAS74641.1| lipoprotein NlpD [Vibrio alginolyticus 12G01]
          Length = 307

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A+  +
Sbjct: 230 VVYSGNALRGYGNLIIVKHNDNYLSAYAHNDKLLVTEGQSVKSGQKIATMGSSG-AKSVK 288

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    +++P ++L 
Sbjct: 289 LHFEIRYQGKSVNPKRYLP 307


>gi|332971680|gb|EGK10628.1| M24/M37 family peptidase [Desmospora sp. 8437]
          Length = 378

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 2/80 (2%)

Query: 3   IYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKG--QKVSRGHTIGLSGKSGNAQHP 60
           +     +   G  ++I H   I T+Y+H+    V+    Q VSRG  I L G +G +  P
Sbjct: 299 VIASRPMRGYGYIVVIDHGGGISTLYAHVYAQDVKVSVGQSVSRGQVIALVGNNGWSTGP 358

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HFE+ KN    DP+ +L+
Sbjct: 359 HLHFEVLKNGEHTDPMPYLK 378


>gi|289209352|ref|YP_003461418.1| peptidase M23 [Thioalkalivibrio sp. K90mix]
 gi|288944983|gb|ADC72682.1| Peptidase M23 [Thioalkalivibrio sp. K90mix]
          Length = 296

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ G      G  + I H   + T Y+H     V+ GQ+V  G TI   G++G A   
Sbjct: 215 IVVFSGKRDA-YGKMVEIDHGGGLRTRYAHNSELLVEPGQRVDAGDTIARMGRTGRATDT 273

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            +H+E+ K   A++P  FL  
Sbjct: 274 HLHYEVLKAGQAVNPYDFLPS 294


>gi|239815016|ref|YP_002943926.1| peptidase M23 [Variovorax paradoxus S110]
 gi|239801593|gb|ACS18660.1| Peptidase M23 [Variovorax paradoxus S110]
          Length = 167

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+YVG +L   GN ++I+H+++ +T Y+H  T  V++   V +G  I   GKS      +
Sbjct: 85  VVYVGGELRSYGNMVIIKHNETFLTAYAHAQTILVKENAVVRQGQKIAEMGKS-ETDRVK 143

Query: 62  VHFELRKNAIAMDPIKFLEEKI 83
           +HFE+RKN  A+DP  +L  ++
Sbjct: 144 LHFEIRKNGTAVDPEPYLNGRL 165


>gi|254180176|ref|ZP_04886775.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1655]
 gi|184210716|gb|EDU07759.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1655]
          Length = 233

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++HD   +T Y+H     V++GQ V++G  I   G + N     
Sbjct: 154 VVYAGNGLRGYGNLLIVKHDADFLTTYAHNRALLVKEGQTVAQGQKIAEMGDTDNN-RVA 212

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 213 LHFELRYGGRSIDPARYLPSR 233


>gi|220915917|ref|YP_002491221.1| Peptidase M23 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219953771|gb|ACL64155.1| Peptidase M23 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 292

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G      G  +++RHD  +VT+Y+H     V++G +V RG  I   G++G    P 
Sbjct: 215 VIYAGEQ-AGYGAVVILRHDGGLVTLYAHNSEVLVKEGARVDRGQPIARVGQTGRTTGPH 273

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+     +P+ FL 
Sbjct: 274 LHFEVREGTRPRNPLLFLP 292


>gi|194365239|ref|YP_002027849.1| peptidase M23 [Stenotrophomonas maltophilia R551-3]
 gi|194348043|gb|ACF51166.1| Peptidase M23 [Stenotrophomonas maltophilia R551-3]
          Length = 261

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  LV  G  I+I+H D  ++ Y H     V +GQ V  G  I   G++G A   
Sbjct: 181 VVVYSGAGLVGYGELIIIKHSDQWLSAYGHNRKRLVNEGQSVKAGEQIAEMGRTG-ANRD 239

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
            VHFE+R N   +DP ++L  +
Sbjct: 240 MVHFEIRYNGKPVDPQQYLPAR 261


>gi|86132031|ref|ZP_01050627.1| peptidase family M23 [Dokdonia donghaensis MED134]
 gi|85817365|gb|EAQ38545.1| peptidase family M23 [Dokdonia donghaensis MED134]
          Length = 323

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V  VG      G  ++I H     T Y+H+     + G+KV RG  IG  G +G +  P 
Sbjct: 223 VTKVGLG-SGYGKMVIIEHGFGYKTYYAHMSKYNTKVGRKVKRGEIIGYVGNTGLSSGPH 281

Query: 62  VHFELRKNAIAMDPIKF 78
           +H+E+ KN   ++P+ F
Sbjct: 282 LHYEVWKNGKVVNPVNF 298


>gi|296118281|ref|ZP_06836862.1| peptidase, M23/M37 family [Corynebacterium ammoniagenes DSM 20306]
 gi|295968839|gb|EFG82083.1| peptidase, M23/M37 family [Corynebacterium ammoniagenes DSM 20306]
          Length = 258

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 2/83 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VI  G      GN I I+H+D  +TVY H++T  V  G+ V  G  I   G  G +   
Sbjct: 172 IVIDSGPA-SGFGNWIRIKHEDGTITVYGHMETLDVSVGETVHAGQKIAGMGNLGFSTGS 230

Query: 61  QVHFELRKNA-IAMDPIKFLEEK 82
            +HFE+  +   A+DP+ +LEE+
Sbjct: 231 HLHFEVYPDGNTAVDPVPWLEER 253


>gi|322807930|emb|CBZ05505.1| peptidase, M23/M37 family [Clostridium botulinum H04402 065]
          Length = 311

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G +    G  I I+H+  ++T+Y+H    YV+ GQ V +G  IG  G +G +  P 
Sbjct: 234 VIYSGWE-EGYGKVIKIKHNSELITIYAHCSKLYVKVGQYVKKGEKIGEVGSTGRSTGPH 292

Query: 62  VHFELRKNAIAMDPIKFLE 80
           VHFELRKN    +P+ +++
Sbjct: 293 VHFELRKNNEPCNPLIYIK 311


>gi|258591452|emb|CBE67753.1| putative Peptidase, M23/M37 family [NC10 bacterium 'Dutch
           sediment']
          Length = 321

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V Y G  L   GN + + H + I T Y+H+    V +GQ+V RG  IGL G +G    P
Sbjct: 228 VVTYTGP-LGGFGNVVSVNHGNKISTFYAHLQQHKVSQGQRVRRGDVIGLVGTTGRVTGP 286

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +H+E++ N + +DP K++
Sbjct: 287 HLHYEIQVNEVPVDPTKYV 305


>gi|51891206|ref|YP_073897.1| putative peptidase [Symbiobacterium thermophilum IAM 14863]
 gi|51854895|dbj|BAD39053.1| putative peptidase [Symbiobacterium thermophilum IAM 14863]
          Length = 252

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+  G ++   G T++I HDD   T+Y+H     V+ G+ V +G  I   G +GN+  P 
Sbjct: 172 VLLAG-EVEGYGLTVVIGHDDGTRTLYAHASALLVEAGEWVEQGQPIARVGSTGNSTGPH 230

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+      +DP+ +L  +
Sbjct: 231 LHFEIIVGDRPVDPLDYLPPR 251


>gi|325128559|gb|EGC51432.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           N1568]
          Length = 415

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|254805258|ref|YP_003083479.1| putative membrane peptidase [Neisseria meningitidis alpha14]
 gi|254668800|emb|CBA06762.1| putative membrane peptidase [Neisseria meningitidis alpha14]
 gi|325198613|gb|ADY94069.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           G2136]
          Length = 415

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|149927142|ref|ZP_01915399.1| Peptidase M23B [Limnobacter sp. MED105]
 gi|149824081|gb|EDM83302.1| Peptidase M23B [Limnobacter sp. MED105]
          Length = 301

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 10  VELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKN 69
              GN + I H++   T Y+H     V+ G  V  G  I L G +G +  P +HFE+R +
Sbjct: 203 PGYGNMVEIEHNNKTTTRYAHASRLLVKPGDIVRLGQKIALVGSTGRSTGPHLHFEVRVD 262

Query: 70  AIAMDPIKFLEEK-IP 84
            +  +P KFLE+  +P
Sbjct: 263 GVPQNPNKFLEKNGLP 278


>gi|119504838|ref|ZP_01626916.1| membrane protein [marine gamma proteobacterium HTCC2080]
 gi|119459443|gb|EAW40540.1| membrane protein [marine gamma proteobacterium HTCC2080]
          Length = 351

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+Y G  L   G  ++++H++  ++ Y H +   V +G  +S G  I   G SG     
Sbjct: 271 VVVYAGTGLKGYGALLIVKHNEQFLSAYGHNEVMLVAEGTNISAGQQIARMGSSG-TDTV 329

Query: 61  QVHFELRKNAIAMDPIKFLEEK 82
           ++HFE+R+    +DP++ L  +
Sbjct: 330 KLHFEIRRKGQPVDPLRLLPRR 351


>gi|126665237|ref|ZP_01736220.1| Membrane protein [Marinobacter sp. ELB17]
 gi|126630607|gb|EBA01222.1| Membrane protein [Marinobacter sp. ELB17]
          Length = 310

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V + G      GN + I H D +VT Y+H     V+ G  V +   + L G +G +  P
Sbjct: 228 VVTWAGKR-RGYGNLVEIAHGDGLVTRYAHAKAVSVKVGDLVQKAQVVALMGSTGRSTGP 286

Query: 61  QVHFELRKNAIAMDPIKFLEE 81
            VHFE+ K+    DP+K++  
Sbjct: 287 HVHFEVLKHGRTTDPVKYMAR 307


>gi|229592921|ref|YP_002875040.1| putative peptidase [Pseudomonas fluorescens SBW25]
 gi|229364787|emb|CAY52796.1| putative peptidase [Pseudomonas fluorescens SBW25]
          Length = 472

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 46/85 (54%), Gaps = 6/85 (7%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           V+  G      GNT++I+H ++  T+Y H+      VQ G  V +G  IG  G +G +  
Sbjct: 355 VLLAGRR-GGYGNTVIIQHGNTYRTLYGHMQGFAKGVQTGGTVKQGQVIGYIGTTGLSTG 413

Query: 60  PQVHFELRKNAIAMDPIKFLEEKIP 84
           P +H+E + N + +DP   L +K+P
Sbjct: 414 PHLHYEFQVNGVHVDP---LGQKLP 435


>gi|86157179|ref|YP_463964.1| peptidoglycan-binding peptidase M23B [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85773690|gb|ABC80527.1| peptidoglycan-binding peptidase M23B [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 291

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G      G  +++RHD  +VT+Y+H     V++G +V RG  I   G++G    P 
Sbjct: 214 VIYAGEQ-AGYGAVVILRHDGGLVTLYAHNSEVLVKEGARVGRGQPIARVGQTGRTTGPH 272

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+     +P+ FL 
Sbjct: 273 LHFEVREGTRPRNPLLFLP 291


>gi|298368538|ref|ZP_06979856.1| LysM domain/M23 peptidase domain protein [Neisseria sp. oral taxon
           014 str. F0314]
 gi|298282541|gb|EFI24028.1| LysM domain/M23 peptidase domain protein [Neisseria sp. oral taxon
           014 str. F0314]
          Length = 315

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H  + ++ Y H  +  V +GQ V RG TI   G S +A   Q
Sbjct: 237 VVYAGSGLRGYGNLVIIQHSPTFLSAYGHNQSLLVNEGQTVKRGQTIAKMGNS-DASRTQ 295

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 296 LHFEVRQNGKPVNPANYV 313


>gi|218677890|ref|ZP_03525787.1| putative peptidase [Rhizobium etli CIAT 894]
          Length = 160

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 46/80 (57%), Positives = 61/80 (76%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY GN L ELGNT+L+RHDD  VTVY + DT  V +GQK+ RG T+ +SG SG+ + P
Sbjct: 81  VVIYAGNGLKELGNTVLVRHDDGTVTVYGNADTLSVTRGQKIQRGQTVAVSGMSGDVKQP 140

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           QVHFE+RK+A  ++P+ FLE
Sbjct: 141 QVHFEVRKDASPVNPMTFLE 160


>gi|7416822|dbj|BAA94071.1| nlpD [Rubrivivax gelatinosus]
          Length = 314

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN I+++H+ + ++ Y+H  T  V++ Q V RG  I   G S +A   Q
Sbjct: 235 VVYAGSGLRGYGNLIIVKHNATFLSAYAHNQTLLVKEDQAVRRGQKIAEMGAS-DADRVQ 293

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP K L  +
Sbjct: 294 LHFEIRRQGKPVDPAKLLPSR 314


>gi|126442274|ref|YP_001058553.1| peptidase [Burkholderia pseudomallei 668]
 gi|126221767|gb|ABN85273.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei 668]
          Length = 236

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++H+   +T Y+H     V++GQ V++G  I   G + +     
Sbjct: 157 VVYAGNGLRGYGNLLIVKHNADFLTTYAHNRALLVKEGQTVAQGQKIAEMGDT-DNDRVA 215

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 216 LHFELRYGGRSIDPARYLPSR 236


>gi|307823284|ref|ZP_07653514.1| Peptidase M23 [Methylobacter tundripaludum SV96]
 gi|307736059|gb|EFO06906.1| Peptidase M23 [Methylobacter tundripaludum SV96]
          Length = 407

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y    L   G  I+I H    +T+Y+   + Y Q G+ V  G  +   G+SG   HP 
Sbjct: 329 VVYSDW-LRGYGLLIIIDHGKGYMTLYAFNQSVYRQVGEWVDAGEVVASVGQSGGRSHPG 387

Query: 62  VHFELRKNAIAMDPIKFLEE 81
           ++F +R     +DP+++  +
Sbjct: 388 LYFGIRNKGKPVDPLEWCRK 407


>gi|325144776|gb|EGC67068.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           M01-240013]
          Length = 415

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|313668127|ref|YP_004048411.1| membrane peptidase [Neisseria lactamica ST-640]
 gi|313005589|emb|CBN87025.1| putative membrane peptidase [Neisseria lactamica 020-06]
          Length = 337

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 259 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASKTQ 317

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 318 LHFEVRQNGKPVNPNSYI 335


>gi|269965238|ref|ZP_06179372.1| lipoprotein NlpD [Vibrio alginolyticus 40B]
 gi|269830224|gb|EEZ84451.1| lipoprotein NlpD [Vibrio alginolyticus 40B]
          Length = 307

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+++H+D+ ++ Y+H D   V +GQ V  G  I   G SG A+  +
Sbjct: 230 VVYSGNALRGYGNLIIVKHNDNYLSAYAHNDKLLVTEGQSVKSGQKIATMGSSG-AKSVK 288

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    +++P ++L 
Sbjct: 289 LHFEIRYQGKSVNPKRYLP 307


>gi|254259037|ref|ZP_04950091.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1710a]
 gi|254217726|gb|EET07110.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1710a]
          Length = 232

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++HD   +T Y+H     V++GQ V++G  I   G + +     
Sbjct: 153 VVYAGNGLRGYGNLLIVKHDADFLTTYAHNRALLVKEGQTVAQGQKIAEMGDT-DNDRVA 211

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 212 LHFELRYGGRSIDPARYLPSR 232


>gi|76810588|ref|YP_333112.1| peptidase [Burkholderia pseudomallei 1710b]
 gi|238562786|ref|ZP_00439880.2| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei GB8 horse 4]
 gi|251767629|ref|ZP_02267936.2| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei PRL-20]
 gi|262193298|ref|YP_001080170.2| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei NCTC 10247]
 gi|76580041|gb|ABA49516.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei
           1710b]
 gi|238521956|gb|EEP85404.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei GB8 horse 4]
 gi|243062132|gb|EES44318.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei PRL-20]
 gi|261826011|gb|ABN03374.2| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei NCTC 10229]
 gi|261835051|gb|ABO05114.2| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei NCTC 10247]
          Length = 296

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++HD   +T Y+H     V++GQ V++G  I   G + +     
Sbjct: 217 VVYAGNGLRGYGNLLIVKHDADFLTTYAHNRALLVKEGQTVAQGQKIAEMGDT-DNDRVA 275

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 276 LHFELRYGGRSIDPARYLPSR 296


>gi|53719020|ref|YP_108006.1| peptidase [Burkholderia pseudomallei K96243]
 gi|52209434|emb|CAH35381.1| subfamily M23B unassigned peptidase [Burkholderia pseudomallei
           K96243]
          Length = 237

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++HD   +T Y+H     V++GQ V++G  I   G + +     
Sbjct: 158 VVYAGNGLRGYGNLLIVKHDADFLTTYAHNRALLVKEGQTVAQGQKIAEMGDT-DNDRVA 216

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 217 LHFELRYGGRSIDPARYLPSR 237


>gi|53725511|ref|YP_102562.1| lipoprotein NlpD [Burkholderia mallei ATCC 23344]
 gi|121601016|ref|YP_992653.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei SAVP1]
 gi|124386085|ref|YP_001026550.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei NCTC 10229]
 gi|126451856|ref|YP_001065814.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1106a]
 gi|134282708|ref|ZP_01769411.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 305]
 gi|167719095|ref|ZP_02402331.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei DM98]
 gi|167738093|ref|ZP_02410867.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 14]
 gi|167815280|ref|ZP_02446960.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 91]
 gi|167823685|ref|ZP_02455156.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 9]
 gi|167845231|ref|ZP_02470739.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei B7210]
 gi|167893780|ref|ZP_02481182.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 7894]
 gi|167902232|ref|ZP_02489437.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei NCTC 13177]
 gi|167910474|ref|ZP_02497565.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 112]
 gi|167918499|ref|ZP_02505590.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei BCC215]
 gi|217423577|ref|ZP_03455078.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 576]
 gi|226196151|ref|ZP_03791736.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei Pakistan 9]
 gi|237811809|ref|YP_002896260.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           MSHR346]
 gi|242314503|ref|ZP_04813519.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1106b]
 gi|254178139|ref|ZP_04884794.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei ATCC 10399]
 gi|254188402|ref|ZP_04894913.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254197462|ref|ZP_04903884.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei S13]
 gi|254199478|ref|ZP_04905844.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei FMH]
 gi|254205792|ref|ZP_04912144.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei JHU]
 gi|254298012|ref|ZP_04965465.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 406e]
 gi|254358808|ref|ZP_04975081.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei 2002721280]
 gi|52428934|gb|AAU49527.1| lipoprotein NlpD, putative [Burkholderia mallei ATCC 23344]
 gi|121229826|gb|ABM52344.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei SAVP1]
 gi|126225498|gb|ABN89038.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1106a]
 gi|134245794|gb|EBA45885.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 305]
 gi|147749074|gb|EDK56148.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei FMH]
 gi|147753235|gb|EDK60300.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei JHU]
 gi|148027935|gb|EDK85956.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei 2002721280]
 gi|157807957|gb|EDO85127.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 406e]
 gi|157936081|gb|EDO91751.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160699178|gb|EDP89148.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           mallei ATCC 10399]
 gi|169654203|gb|EDS86896.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei S13]
 gi|217393435|gb|EEC33456.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 576]
 gi|225931737|gb|EEH27739.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei Pakistan 9]
 gi|237506704|gb|ACQ99022.1| LysM domain/M23 peptidase domain protein [Burkholderia pseudomallei
           MSHR346]
 gi|242137742|gb|EES24144.1| putative peptidoglycan-binding LysM/M23B peptidase [Burkholderia
           pseudomallei 1106b]
          Length = 233

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN ++++HD   +T Y+H     V++GQ V++G  I   G + +     
Sbjct: 154 VVYAGNGLRGYGNLLIVKHDADFLTTYAHNRALLVKEGQTVAQGQKIAEMGDT-DNDRVA 212

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFELR    ++DP ++L  +
Sbjct: 213 LHFELRYGGRSIDPARYLPSR 233


>gi|222055742|ref|YP_002538104.1| Peptidase M23 [Geobacter sp. FRC-32]
 gi|221565031|gb|ACM21003.1| Peptidase M23 [Geobacter sp. FRC-32]
          Length = 392

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 17/79 (21%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+        GN I++ H     ++Y+H  +   + G  V++   +   G S ++    
Sbjct: 315 VIFADY-FKGYGNMIIVDHGGGFFSLYAHASSINKRVGATVAKNDVVASVGDSDSSNGSM 373

Query: 62  VHFELRKNAIAMDPIKFLE 80
           ++FE+R     +DP  +  
Sbjct: 374 LYFEIRYQGKPVDPSPWFR 392


>gi|187918136|ref|YP_001883699.1| cell wall endopeptidase, family M23/M37 [Borrelia hermsii DAH]
 gi|119860984|gb|AAX16779.1| cell wall endopeptidase, family M23/M37 [Borrelia hermsii DAH]
          Length = 417

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 47/80 (58%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+ VG  +   G  I+I H++   T+Y+H+ +  V+ GQ+VSRG  IG  G +G +   
Sbjct: 338 IVVTVGFSVGGYGKYIVISHNNGFQTLYAHLGSFAVKVGQRVSRGQIIGRMGSTGYSTGN 397

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +HF + K+    +P+K+L 
Sbjct: 398 HLHFTIFKDGKTGNPMKYLR 417


>gi|170760060|ref|YP_001788950.1| putative peptidase [Clostridium botulinum A3 str. Loch Maree]
 gi|169407049|gb|ACA55460.1| putative peptidase [Clostridium botulinum A3 str. Loch Maree]
          Length = 311

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G +    G  I I+H   ++T+Y+H    YV+ GQ V +G  IG  G +G +  P 
Sbjct: 234 VIYSGWE-EGYGKVIKIQHSSELITIYAHCSNLYVKVGQYVKKGEKIGEVGSTGRSTGPH 292

Query: 62  VHFELRKNAIAMDPIKFLE 80
           VHFELRKN    +P+ +++
Sbjct: 293 VHFELRKNNEPCNPLIYIK 311


>gi|39937491|ref|NP_949767.1| peptidase M23B [Rhodopseudomonas palustris CGA009]
 gi|192293278|ref|YP_001993883.1| peptidase M23 [Rhodopseudomonas palustris TIE-1]
 gi|39651350|emb|CAE29872.1| Peptidase M23/M37 [Rhodopseudomonas palustris CGA009]
 gi|192287027|gb|ACF03408.1| Peptidase M23 [Rhodopseudomonas palustris TIE-1]
          Length = 676

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 6/86 (6%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQ--KVSRGHTIGLSGKSGNAQ 58
           +V   G +    G  I I+H +   T Y H+           +V +G  IG  G +G + 
Sbjct: 543 VVEKAGWE-GGYGKYIRIKHANGYETAYGHMSAFAKGMEPGKRVRQGQVIGFVGSTGLST 601

Query: 59  HPQVHFELRKNAIAMDPIKFLEEKIP 84
              VH+E+  N   +DP++    ++P
Sbjct: 602 GAHVHYEIIVNGRFVDPMRV---RLP 624


>gi|120598085|ref|YP_962659.1| peptidase M23B [Shewanella sp. W3-18-1]
 gi|146293844|ref|YP_001184268.1| peptidase M23B [Shewanella putrefaciens CN-32]
 gi|120558178|gb|ABM24105.1| peptidase M23B [Shewanella sp. W3-18-1]
 gi|145565534|gb|ABP76469.1| peptidase M23B [Shewanella putrefaciens CN-32]
          Length = 294

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H +  ++ Y+H D   V++ Q V  G T+   G +G      
Sbjct: 215 VVYAGSALRGYGNLVIIKHSEDYLSAYAHTDQILVEEKQHVLAGQTVAKMGSTG-TDQVM 273

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           + FE+R +  +++P+ +L ++
Sbjct: 274 LRFEIRYHGQSVNPLNYLPKQ 294


>gi|330963949|gb|EGH64209.1| peptidase, M23/M37 family protein [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 474

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 6/85 (7%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           V+  G      GNT++I+H D+  T+Y H+      VQ G  V +G  IG  G +G +  
Sbjct: 357 VLLAGRR-GGYGNTVIIQHGDTYRTLYGHMQGFAKGVQTGGTVKQGQVIGYIGTTGLSTG 415

Query: 60  PQVHFELRKNAIAMDPIKFLEEKIP 84
           P +H+E + N + +DP   L +K+P
Sbjct: 416 PHLHYEFQVNGVHVDP---LGQKLP 437


>gi|330878331|gb|EGH12480.1| peptidase, M23/M37 family protein [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 474

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 6/85 (7%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           V+  G      GNT++I+H D+  T+Y H+      VQ G  V +G  IG  G +G +  
Sbjct: 357 VLLAGRR-GGYGNTVIIQHGDTYRTLYGHMQGFAKGVQTGGTVKQGQVIGYIGTTGLSTG 415

Query: 60  PQVHFELRKNAIAMDPIKFLEEKIP 84
           P +H+E + N + +DP   L +K+P
Sbjct: 416 PHLHYEFQVNGVHVDP---LGQKLP 437


>gi|332290486|ref|YP_004421338.1| Peptidase family M23 [Gallibacterium anatis UMN179]
 gi|330433382|gb|AEC18441.1| Peptidase family M23 [Gallibacterium anatis UMN179]
          Length = 486

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+ V       G  +++RH     TVY H+  P V+ GQ V +G  I LSG +G +  P
Sbjct: 379 VVVKVSYQAGGAGRYVMLRHGREYQTVYMHLSRPLVKPGQSVKKGQRIALSGNTGRSTGP 438

Query: 61  QVHFELRKNAIAMDPIKFLEEKIP 84
            +H+E   N +A++P+K    K+P
Sbjct: 439 HLHYEFHINGVAVNPMKV---KLP 459


>gi|213967617|ref|ZP_03395764.1| peptidase, M23/M37 family [Pseudomonas syringae pv. tomato T1]
 gi|301381482|ref|ZP_07229900.1| peptidase, M23/M37 family protein [Pseudomonas syringae pv. tomato
           Max13]
 gi|302058571|ref|ZP_07250112.1| peptidase, M23/M37 family protein [Pseudomonas syringae pv. tomato
           K40]
 gi|302132205|ref|ZP_07258195.1| peptidase, M23/M37 family protein [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213927393|gb|EEB60941.1| peptidase, M23/M37 family [Pseudomonas syringae pv. tomato T1]
          Length = 474

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 6/85 (7%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           V+  G      GNT++I+H D+  T+Y H+      VQ G  V +G  IG  G +G +  
Sbjct: 357 VLLAGRR-GGYGNTVIIQHGDTYRTLYGHMQGFAKGVQTGGTVKQGQVIGYIGTTGLSTG 415

Query: 60  PQVHFELRKNAIAMDPIKFLEEKIP 84
           P +H+E + N + +DP   L +K+P
Sbjct: 416 PHLHYEFQVNGVHVDP---LGQKLP 437


>gi|28867835|ref|NP_790454.1| peptidase, M23/M37 family [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28851071|gb|AAO54149.1| peptidase, M23/M37 family [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|331017520|gb|EGH97576.1| peptidase, M23/M37 family protein [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 474

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 6/85 (7%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           V+  G      GNT++I+H D+  T+Y H+      VQ G  V +G  IG  G +G +  
Sbjct: 357 VLLAGRR-GGYGNTVIIQHGDTYRTLYGHMQGFAKGVQTGGTVKQGQVIGYIGTTGLSTG 415

Query: 60  PQVHFELRKNAIAMDPIKFLEEKIP 84
           P +H+E + N + +DP   L +K+P
Sbjct: 416 PHLHYEFQVNGVHVDP---LGQKLP 437


>gi|299067257|emb|CBJ38454.1| putative outer membrane metallopeptidase lipoprotein nlpD/
           [Ralstonia solanacearum CMR15]
          Length = 275

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 2/79 (2%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI+VG  L   GN ++I+H+D+ +T Y + D   V +   V +G  I   G + +A   +
Sbjct: 197 VIHVGP-LRGYGNLVIIKHNDTFLTAYGNNDKVLVTEQSTVKKGQKIAEMGST-DADRVK 254

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R+N   +DP++FL 
Sbjct: 255 LHFEVRRNGKPVDPMRFLP 273


>gi|240850249|ref|YP_002971642.1| putative virulence determinant [Bartonella grahamii as4aup]
 gi|240267372|gb|ACS50960.1| putative virulence determinant [Bartonella grahamii as4aup]
          Length = 393

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 39/80 (48%), Positives = 59/80 (73%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +VIY G+ L ELGN ++IRH+++I+T+Y       V KGQ++ RG  I  SG SGN + P
Sbjct: 313 VVIYAGDGLKELGNVVMIRHENNIITIYGCNSKLVVNKGQRIRRGDEIAKSGVSGNVKTP 372

Query: 61  QVHFELRKNAIAMDPIKFLE 80
           +V+FE+RKN++ +DP+K+LE
Sbjct: 373 RVYFEMRKNSLPVDPLKYLE 392


>gi|221134006|ref|ZP_03560311.1| hypothetical lipoprotein NlpD [Glaciecola sp. HTCC2999]
          Length = 273

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y GN L   GN I+I+H +  ++ Y+H     V++   V  G  I + G SG     +
Sbjct: 194 VVYSGNALRGYGNLIIIKHTNKFLSAYAHNSKILVKERDFVQAGEQIAIMGDSGTNS-IK 252

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           + FE+R N  ++DP+K+L +K
Sbjct: 253 LRFEIRYNGKSLDPLKYLPKK 273


>gi|239995278|ref|ZP_04715802.1| hypothetical lipoprotein NlpD [Alteromonas macleodii ATCC 27126]
          Length = 260

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 48/79 (60%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H D+ ++ Y++ DT  V++ + VS G  I   G SG     +
Sbjct: 180 VVYSGSALRGYGNLVIIKHTDTFLSAYAYNDTILVKEREWVSAGQQIATMGDSGTNS-VK 238

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+R    ++DP+K+L 
Sbjct: 239 LHFEVRYRGKSLDPMKYLP 257


>gi|167836671|ref|ZP_02463554.1| Peptidase family M23/M37 [Burkholderia thailandensis MSMB43]
          Length = 328

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQ 58
           +V +VG D +  G  ++I H D   T Y+H+      +  G  V++G  IG  G +G A 
Sbjct: 183 VVSFVGYDALGYGKYVVIDHPDRTSTYYAHLSAFAPGLDVGMTVAQGQRIGSVGATGAAT 242

Query: 59  HPQVHFELRKNAIAMDPI 76
            P +HFE+R +   +DP+
Sbjct: 243 GPHLHFEVRVDDRPVDPL 260


>gi|15677336|ref|NP_274491.1| putative lipoprotein NlpD [Neisseria meningitidis MC58]
 gi|7226723|gb|AAF41839.1| putative lipoprotein NlpD [Neisseria meningitidis MC58]
 gi|325140580|gb|EGC63100.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           CU385]
 gi|325199909|gb|ADY95364.1| LysM domain/M23 peptidase domain protein [Neisseria meningitidis
           H44/76]
          Length = 415

 Score = 90.2 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y G+ L   GN ++I+H+ S +T Y H     V +GQ+V RG  + L G + +A   Q
Sbjct: 337 VVYAGSGLRGYGNLVIIQHNSSFLTAYGHNQKLLVGEGQQVKRGQQVALMGNT-DASRTQ 395

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HFE+R+N   ++P  ++
Sbjct: 396 LHFEVRQNGKPVNPNSYI 413


>gi|29349404|ref|NP_812907.1| putative peptidase [Bacteroides thetaiotaomicron VPI-5482]
 gi|253570245|ref|ZP_04847654.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|298384932|ref|ZP_06994491.1| peptidase [Bacteroides sp. 1_1_14]
 gi|29341313|gb|AAO79101.1| putative peptidase [Bacteroides thetaiotaomicron VPI-5482]
 gi|251840626|gb|EES68708.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|298262076|gb|EFI04941.1| peptidase [Bacteroides sp. 1_1_14]
          Length = 322

 Score = 90.2 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+ VG +    GNTI I H    +T Y+H+ +   + G+KV RG  IG  G +G +  P 
Sbjct: 222 VVKVGWET-GYGNTIEIDHGFGYLTRYAHLQSYNTKVGKKVVRGEVIGKVGSTGKSTGPH 280

Query: 62  VHFELRKNAIAMDPIKF 78
           +H+E+      ++P+ +
Sbjct: 281 LHYEVHVKGKVVNPVNY 297


>gi|153938526|ref|YP_001392962.1| putative peptidase [Clostridium botulinum F str. Langeland]
 gi|152934422|gb|ABS39920.1| putative peptidase [Clostridium botulinum F str. Langeland]
 gi|295320939|gb|ADG01317.1| putative peptidase [Clostridium botulinum F str. 230613]
          Length = 311

 Score = 90.2 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G +    G  I I+H   ++T+Y+H    YV+ GQ V +G  IG  G +G +  P 
Sbjct: 234 VIYSGWE-EGYGKVIKIQHSSELITIYAHCSNLYVKVGQYVRKGEKIGEVGSTGRSTGPH 292

Query: 62  VHFELRKNAIAMDPIKFLE 80
           VHFELRKN    +P+ +++
Sbjct: 293 VHFELRKNNEPCNPLIYIK 311


>gi|206562050|ref|YP_002232813.1| subfamily M23B metallopeptidase [Burkholderia cenocepacia J2315]
 gi|198038090|emb|CAR54038.1| metallo peptidase, subfamily M23B [Burkholderia cenocepacia J2315]
          Length = 457

 Score = 90.2 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V ++G +    G  ++IRHD    + Y+H+    P ++ G +V RG  +G  G +G A 
Sbjct: 330 VVTFIGTEPRGYGKYVVIRHDGGYASYYAHLSAFEPTLRTGARVMRGQRVGAVGSTGTAT 389

Query: 59  HPQVHFELRKNAIAMDPIKFL 79
            P +HFE+R++A  +DPI+ +
Sbjct: 390 GPHLHFEVRRHARLVDPIELV 410


>gi|167629157|ref|YP_001679656.1| cell wall peptidase m23, putative [Heliobacterium modesticaldum
           Ice1]
 gi|167591897|gb|ABZ83645.1| cell wall peptidase m23, putative [Heliobacterium modesticaldum
           Ice1]
          Length = 353

 Score = 90.2 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 34/78 (43%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G     LG  + I H     T Y H+    V+  Q + RG  +G  G SG +  P 
Sbjct: 275 VVFTGWKP-GLGRVVEIDHGHGFQTAYCHLSAITVKVNQVLERGDMLGKVGNSGRSTGPH 333

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF +       DP  +L
Sbjct: 334 LHFMVYHQGKLQDPEGYL 351


>gi|313679350|ref|YP_004057089.1| peptidase m23 [Oceanithermus profundus DSM 14977]
 gi|313152065|gb|ADR35916.1| Peptidase M23 [Oceanithermus profundus DSM 14977]
          Length = 310

 Score = 90.2 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      G  + I H     T+Y H+    V++GQ V RG  IG  G +G +  P 
Sbjct: 226 VIEAGWSN-IFGRYVKIDHGYGYRTLYGHMSKILVKRGQTVERGQVIGKVGSTGRSSGPH 284

Query: 62  VHFELRKNAIAMDPIKFLE 80
           VH+ +     A++P+ +L+
Sbjct: 285 VHYSVYVWGKAVNPVPYLK 303


>gi|319789804|ref|YP_004151437.1| Peptidase M23 [Thermovibrio ammonificans HB-1]
 gi|317114306|gb|ADU96796.1| Peptidase M23 [Thermovibrio ammonificans HB-1]
          Length = 299

 Score = 90.2 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V+  G     +G  + I+H   I T Y H+    V KG+ VSRG  IG+ G SG +  P
Sbjct: 211 VVVRAGWC-GLMGRCVEIKHGSGIYTYYGHLSKITVFKGEHVSRGMIIGIMGSSGRSTGP 269

Query: 61  QVHFELRKNAIAMDPIKFLE 80
            +H+ +R +   ++P+ F+E
Sbjct: 270 HLHYSVRIDGKLVNPLPFME 289


>gi|171315589|ref|ZP_02904824.1| peptidase M23B [Burkholderia ambifaria MEX-5]
 gi|171099260|gb|EDT44019.1| peptidase M23B [Burkholderia ambifaria MEX-5]
          Length = 451

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 50/82 (60%), Gaps = 2/82 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V ++G++    G  ++IRHD    + Y+H+    P ++ G +V RG  +G  G +G A 
Sbjct: 324 VVTFIGSEPGGYGKYVVIRHDGGYASYYAHLSAFEPTLRTGARVVRGQRVGAVGSTGTAT 383

Query: 59  HPQVHFELRKNAIAMDPIKFLE 80
            P +HFE+R++A  +DPI+ ++
Sbjct: 384 GPHLHFEVRRHARLVDPIELVQ 405


>gi|330812095|ref|YP_004356557.1| peptidase [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
 gi|327380203|gb|AEA71553.1| putative peptidase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 440

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 6/85 (7%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTIGLSGKSGNAQH 59
           V+  G      GNT++I+H ++  T+Y H+      V+ G  V +G  IG  G +G +  
Sbjct: 323 VLLAGRR-GGYGNTVIIQHGNTYRTLYGHMQGFAKGVKTGGTVKQGQVIGYIGTTGLSTG 381

Query: 60  PQVHFELRKNAIAMDPIKFLEEKIP 84
           P +H+E + N + +DP   L +K+P
Sbjct: 382 PHLHYEFQVNGVHVDP---LGQKLP 403


>gi|293605697|ref|ZP_06688074.1| lipoprotein NlpD/lppB-like protein [Achromobacter piechaudii ATCC
           43553]
 gi|292815876|gb|EFF74980.1| lipoprotein NlpD/lppB-like protein [Achromobacter piechaudii ATCC
           43553]
          Length = 285

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V Y GN +  LGN I++ H +  +T Y+H  T  V+ GQ V RG  I   G+S +   P+
Sbjct: 206 VKYSGNGVRGLGNLIIVEHQNGFITAYAHNRTLLVKTGQNVKRGAKIAELGQS-DTTSPR 264

Query: 62  VHFELRKNAIAMDPIKFLEEK 82
           +HFE+R+    +DP+++L  +
Sbjct: 265 LHFEIRRQGTPVDPMQYLPTR 285


>gi|291549451|emb|CBL25713.1| Membrane-bound metallopeptidase [Ruminococcus torques L2-14]
          Length = 390

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VI  G      GN ++I H + +VT Y H  +  V  GQ+V++G  IG  G +G +    
Sbjct: 314 VITAGWSNSA-GNWVVISHGNGLVTKYMHHSSICVSAGQRVAKGQQIGYVGSTGYSTGAH 372

Query: 62  VHFELRKNAIAMDPIKFL 79
           +HF++  N   ++P  ++
Sbjct: 373 LHFQVELNGTPVNPNNYM 390


>gi|172062294|ref|YP_001809945.1| peptidase M23 [Burkholderia ambifaria MC40-6]
 gi|171994811|gb|ACB65729.1| Peptidase M23 [Burkholderia ambifaria MC40-6]
          Length = 450

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHI--DTPYVQKGQKVSRGHTIGLSGKSGNAQ 58
           +V ++G +    G  ++IRHD    + Y+H+    P ++ G +V RG  +G  G +G A 
Sbjct: 323 VVTFIGTEPGGYGKYVVIRHDGGYASYYAHLSAFEPTLRTGARVVRGQRVGAVGSTGTAT 382

Query: 59  HPQVHFELRKNAIAMDPIKFLE 80
            P +HFE+R++A  +DPI+ ++
Sbjct: 383 GPHLHFEVRRHARLVDPIELVQ 404


>gi|87198871|ref|YP_496128.1| peptidase M23B [Novosphingobium aromaticivorans DSM 12444]
 gi|87134552|gb|ABD25294.1| peptidase M23B [Novosphingobium aromaticivorans DSM 12444]
          Length = 251

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 47/82 (57%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           VIY G +    G  I+I H    VT Y+++ +  V++GQ V+    I L GKSG A  P 
Sbjct: 170 VIYAGKEPERFGQLIIIDHGGGFVTAYAYLGSMTVKEGQIVTARERIALVGKSGEATRPT 229

Query: 62  VHFELRKNAIAMDPIKFLEEKI 83
           VHFELR+N +  +P  +L  ++
Sbjct: 230 VHFELRRNNVPRNPELYLPPRL 251


>gi|325280524|ref|YP_004253066.1| Peptidase M23 [Odoribacter splanchnicus DSM 20712]
 gi|324312333|gb|ADY32886.1| Peptidase M23 [Odoribacter splanchnicus DSM 20712]
          Length = 323

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+Y        G  +LI H  +  T+Y+H+    V+ GQKV RG  IG  G +G +  P 
Sbjct: 223 VVYAEIH-QGYGKCVLIDHGFNYQTLYAHMSAYNVKAGQKVKRGDIIGYMGNTGMSTGPH 281

Query: 62  VHFELRKNAIAMDPIKF 78
           +H+E++KN I +DPI +
Sbjct: 282 IHYEVKKNGIPVDPINY 298


>gi|148242335|ref|YP_001227492.1| Zinc metallopeptidase [Synechococcus sp. RCC307]
 gi|147850645|emb|CAK28139.1| Zinc metallopeptidase [Synechococcus sp. RCC307]
          Length = 303

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V++ G      G  + + H D   T Y+H     V+KGQ V +G  I   G +G +  P 
Sbjct: 221 VVFSGWSSGGYGYLVELAHTDGSKTRYAHNSALLVKKGQSVRQGTAIARMGSTGRSTGPH 280

Query: 62  VHFELRKNA-IAMDPIKFLEEK 82
           +HFE+ K    A++P+  L  +
Sbjct: 281 LHFEIIKPGLGAVNPVSHLSRR 302


>gi|253576802|ref|ZP_04854128.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843833|gb|EES71855.1| peptidase M23B [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 332

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 2   VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61
           V+    D    G  I+I H   + T Y H+    V  G +V +G +IG  G +G +  P 
Sbjct: 255 VVTATRD-GSHGKYIVIEHPGGLQTWYMHLSDIDVSVGDEVKKGDSIGNLGSTGRSTGPH 313

Query: 62  VHFELRKNAIAMDPIKFLE 80
           +HFE+ K   A+DP+ +L+
Sbjct: 314 LHFEIVKGGKAVDPMPYLK 332


>gi|771