RPSBLAST alignment for GI: 254780683 and conserved domain: PRK11637

>gnl|CDD|183249 PRK11637, PRK11637, AmiB activator; Provisional. Length = 428
 Score = 37.4 bits (87), Expect = 7e-04
 Identities = 19/67 (28%), Positives = 35/67 (52%)

Query: 13  GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72
           G  +++ H    +++Y +  +  V  G +V  G  I L G SG    P ++FE+R+   A
Sbjct: 360 GLVVVVEHGKGDMSLYGYNQSALVSVGAQVRAGQPIALVGSSGGQGRPSLYFEIRRQGQA 419

Query: 73  MDPIKFL 79
           ++P  +L
Sbjct: 420 VNPQPWL 426