RPSBLAST alignment for GI: 254780683 and conserved domain: COG0739

>gnl|CDD|31082 COG0739, NlpD, Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane]. Length = 277
 Score = 76.7 bits (187), Expect = 1e-15
 Identities = 31/79 (39%), Positives = 48/79 (60%)

Query: 1   MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           +V++ GN     GN ++I+H D  VTVY+H+ +  V++GQKV  G  IG  G +G +  P
Sbjct: 183 VVVFAGNGGWGYGNLVIIKHGDGYVTVYAHLSSILVKEGQKVKAGQVIGYVGSTGRSTGP 242

Query: 61  QVHFELRKNAIAMDPIKFL 79
            +HFE+RKN   + P+   
Sbjct: 243 HLHFEVRKNGKLVPPVNPA 261