RPSBLAST alignment of GI: 254780683 and protein with PDBid: 3csq

>3csq_A Morphogenesis protein 1; hydrolase, infection, late protein; 1.80A {Bacteriophage phi-29} Length = 334
 Score = 68.6 bits (167), Expect = 4e-13
 Identities = 14/75 (18%), Positives = 26/75 (34%), Gaps = 6/75 (8%)

Query: 2   VIYVG--NDLVELGNTILIRHDDSIVT----VYSHIDTPYVQKGQKVSRGHTIGLSGKSG 55
            ++ G  +  +   +   +   D  V     V  H        G+K+ +G  +G +G  G
Sbjct: 213 CVWRGDASAYLAWTSDKEVMCADGSVRYITWVNVHESPLPFDVGKKLKKGDLMGHTGIGG 272

Query: 56  NAQHPQVHFELRKNA 70
           N      HF +    
Sbjct: 273 NVTGDHWHFNVIDGK 287