RPSBLAST alignment of GI: 254780683 and SCOP domain: d1qwya_

Alignment
>d1qwya_ b.84.3.2 (A:) Peptidoglycan hydrolase LytM {Staphylococcus aureus [TaxId: 1280]} Length = 270
 Score = 76.6 bits (188), Expect = 6e-16
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 2   VIYVGNDLVELGNTILIRHDDS-IVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
           V+  G      GN + I+  +S     Y H +   V  G KV  G  I  SG +GN+  P
Sbjct: 187 VVQAGWSNYGGGNQVTIKEANSNNYQWYMHNNRLTVSAGDKVKAGDQIAYSGSTGNSTAP 246

Query: 61  QVHFELRKNAI----AMDPIKFLE 80
            VHF+     I    A+DP  +L+
Sbjct: 247 HVHFQRMSGGIGNQYAVDPTSYLQ 270

SCOP domain information

class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Duplicated hybrid motif
family: Peptidoglycan hydrolase LytM
domain: Peptidoglycan hydrolase LytM
species: Staphylococcus aureus [TaxId: 1280]