BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780683|ref|YP_003065096.1| lipoprotein [Candidatus
Liberibacter asiaticus str. psy62]
         (84 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780683|ref|YP_003065096.1| lipoprotein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 84

 Score =  173 bits (439), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%)

Query: 1  MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60
          MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP
Sbjct: 1  MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60

Query: 61 QVHFELRKNAIAMDPIKFLEEKIP 84
          QVHFELRKNAIAMDPIKFLEEKIP
Sbjct: 61 QVHFELRKNAIAMDPIKFLEEKIP 84


>gi|254780879|ref|YP_003065292.1| hypothetical protein CLIBASIA_03880 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 652

 Score = 42.0 bits (97), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 9/85 (10%)

Query: 2   VIYVGNDLVE-------LGNTILIRHDDSIVTVYSHID--TPYVQKGQKVSRGHTIGLSG 52
           ++ VG+ +VE        G   LI H +  V+ Y+H D     ++ G  V +G  IG  G
Sbjct: 526 IVAVGDGIVEKANWAGGYGKQTLIHHGNGYVSSYNHQDAIAKNIKAGTAVKQGQIIGWIG 585

Query: 53  KSGNAQHPQVHFELRKNAIAMDPIK 77
            +G +  P +H+EL  N I +D  K
Sbjct: 586 TTGLSTGPHLHYELIVNGIKVDSTK 610


>gi|254780799|ref|YP_003065212.1| DNA translocase FtsK [Candidatus Liberibacter asiaticus str. psy62]
          Length = 806

 Score = 22.3 bits (46), Expect = 1.4,   Method: Composition-based stats.
 Identities = 10/33 (30%), Positives = 16/33 (48%)

Query: 35  YVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELR 67
           Y   G+K +R    G   K+G A +   HF+ +
Sbjct: 555 YHNTGKKFNRTVQTGFDRKTGEAIYETEHFDFQ 587


>gi|254780313|ref|YP_003064726.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Candidatus
          Liberibacter asiaticus str. psy62]
          Length = 227

 Score = 21.6 bits (44), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 7/11 (63%), Positives = 9/11 (81%)

Query: 30 HIDTPYVQKGQ 40
          HI+ PYVQ+ Q
Sbjct: 33 HINDPYVQRAQ 43


>gi|254780327|ref|YP_003064740.1| preprotein translocase subunit SecA [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 890

 Score = 21.6 bits (44), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 8/23 (34%), Positives = 13/23 (56%)

Query: 24  IVTVYSHIDTPYVQKGQKVSRGH 46
           ++   + +DTP V K  K+ R H
Sbjct: 850 VIQKENELDTPNVCKTSKIKRNH 872


>gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus
          Liberibacter asiaticus str. psy62]
          Length = 438

 Score = 21.6 bits (44), Expect = 3.0,   Method: Composition-based stats.
 Identities = 8/17 (47%), Positives = 12/17 (70%)

Query: 42 VSRGHTIGLSGKSGNAQ 58
          VS G  +GL G+SG+ +
Sbjct: 40 VSSGEIVGLLGRSGSGK 56


>gi|254780546|ref|YP_003064959.1| hypothetical protein CLIBASIA_02165 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 423

 Score = 21.2 bits (43), Expect = 3.4,   Method: Composition-based stats.
 Identities = 9/23 (39%), Positives = 12/23 (52%)

Query: 21  DDSIVTVYSHIDTPYVQKGQKVS 43
           DD + TVY      Y +KG  +S
Sbjct: 129 DDQLETVYMRSQRDYAEKGMGLS 151


>gi|254780959|ref|YP_003065372.1| putative hydrolase serine protease transmembrane protein
          [Candidatus Liberibacter asiaticus str. psy62]
          Length = 302

 Score = 20.8 bits (42), Expect = 4.7,   Method: Composition-based stats.
 Identities = 6/26 (23%), Positives = 19/26 (73%)

Query: 58 QHPQVHFELRKNAIAMDPIKFLEEKI 83
          + P ++F++  + + +D +K+L+++I
Sbjct: 46 REPGIYFKMPFSFMNVDRVKYLQKQI 71


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.319    0.138    0.398 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 56,928
Number of Sequences: 1233
Number of extensions: 1971
Number of successful extensions: 10
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of query: 84
length of database: 328,796
effective HSP length: 53
effective length of query: 31
effective length of database: 263,447
effective search space:  8166857
effective search space used:  8166857
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)
S2: 31 (16.5 bits)