HHsearch alignment for GI: 254780684 and conserved domain: COG1120

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].
Probab=94.63  E-value=0.068  Score=32.80  Aligned_cols=34  Identities=32%  Similarity=0.403  Sum_probs=28.9

Q ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHCC
Q ss_conf             5200223585037526678899999999874078
Q gi|254780684|r  153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDC  186 (438)
Q Consensus       153 D~l~pig~GQR~gIfg~~GvGKt~Ll~~i~~~~~  186 (438)
T Consensus        20 ~ls~~i~~G~i~~iiGpNG~GKSTLLk~l~~~l~   53 (258)
T COG1120          20 DLSFSIPKGEITGILGPNGSGKSTLLKCLAGLLK   53 (258)
T ss_pred             CCEEEECCCCEEEEECCCCCCHHHHHHHHHCCCC
T ss_conf             2368865997999989988899999999865678