HHsearch alignment for GI: 254780684 and conserved domain: COG1155

>COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion].
Probab=100.00  E-value=0  Score=574.24  Aligned_cols=411  Identities=24%  Similarity=0.320  Sum_probs=361.8

Q ss_pred             EEEEEEEECCEEEEECCCCCCCCCCEEEEECCCCCEEEEEEEECCCEEEEEECCCCCCCCCCCEEEECCC-CEEECCHHH
Q ss_conf             1289999525899982688887351899956996079999974199799998048557467888997288-555246668
Q gi|254780684|r   23 GGYISSITSVYYTVTCLSQYVCLGDFVVHQGKNSDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACW  101 (438)
Q Consensus        23 ~G~V~~V~G~ii~v~Gl~~~v~iGelv~i~~~~~~v~geVi~~~~~~~~l~~~~~~~gI~~G~~V~~~g~-~~i~vG~~l  101 (438)
T Consensus         2 ~G~i~~isGp~V~a~gm~-~~~my~~v~V--g~~~L~gEiI~i~gd~a~iQVyE~T~Gi~~Ge~V~~Tg~pLsvELGPGl   78 (588)
T COG1155           2 MGKIIRISGPVVVAEGME-GAKMYDVVKV--GEMGLIGEIIRIEGNRATIQVYEDTAGIRPGEKVENTGRPLSVELGPGL   78 (588)
T ss_pred             CCEEEEEECCEEEEECCC-CCCEEEEEEE--CCCCEEEEEEEEECCEEEEEEEEECCCCCCCCEEECCCCCEEEEECCCH
T ss_conf             746999877799980576-7741789997--5775058999985876899999605899999832127982278747547


Q ss_pred             HHHHHHHHHHHCC-------------------------------------------------------------------
Q ss_conf             8654307763047-------------------------------------------------------------------
Q gi|254780684|r  102 CGRVINALGKPID-------------------------------------------------------------------  114 (438)
Q Consensus       102 LGRViD~lG~PlD-------------------------------------------------------------------  114 (438)
T Consensus        79 l~~IyDGiQrPL~~i~e~sg~Fi~RGv~~p~Ldr~~kW~F~P~~~~Gd~V~~GdvlGtV~Et~~i~~imvpp~~~~~~v~  158 (588)
T COG1155          79 LKSIYDGIQRPLDVIKETSGDFIARGLNPPALDRKKKWDFVPAVKKGDTVYPGDVLGTVQETSLITHRIMVPPGVSGKVT  158 (588)
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEECCCCEEEEECCCCCEEEEEECCCCCCEEEE
T ss_conf             76444311474799998740175457889988855520003466669875268548986067735799837887762899


Q ss_pred             -------------------CCCCCC-CCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCH
Q ss_conf             -------------------887775-553012112543330001331100111245875200223585037526678899
Q gi|254780684|r  115 -------------------GDDSLG-KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGK  174 (438)
Q Consensus       115 -------------------g~~~l~-~~~~~~~i~~~~p~p~~R~~i~e~L~TGIr~ID~l~pig~GQR~gIfg~~GvGK  174 (438)
T Consensus       159 ~i~~~G~ytv~d~ia~v~~~~g~~~~~m~~~WPVR~~rp~-~eKl~p~~Pl~TGqRviDt~FPvaKGGTaaiPGpFGsGK  237 (588)
T COG1155         159 WIAEEGEYTVEDVIATVSTEGGEVDVQMMTTWPVRKARPV-KRKLPPEIPLVTGQRVIDTLFPVAKGGTAAVPGPFGSGK  237 (588)
T ss_pred             EEECCCCCEEEEEEEEEECCCCEEEEEEEEECCCCCCCCC-CCCCCCCCCCCCCCEEEHHHCCCCCCCCCCCCCCCCCCC
T ss_conf             9955887156679999952797487888872664677641-024898775212542310102111576512668888983


Q ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHC-----CC---CCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999998740789838993124652238899998642-----77---553289841577880344444456777888864
Q gi|254780684|r  175 STLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-----DN---LKKSVVVVATSDESPILRKMAPLTAVTIAEYFS  246 (438)
Q Consensus       175 t~Ll~~i~~~~~~dv~V~alIGeR~rev~efi~~~~~-----~~---l~~tvvv~~t~d~~~~~r~~a~~~a~~iAEyfr  246 (438)
T Consensus       238 TV~qh~laK~sdadiVVyigCGERGNEmtevL~eFPeL~Dp~tg~~lm~RT~liaNTSnMPVAAREasIYtGiTiaEY~R  317 (588)
T COG1155         238 TVSQHTLSKLADGDIVIYVGCGERGNEMTEVLQEFPELKDPNTGQPLMDRTVLIANTSNMPVAAREASIYTGITIAEYYR  317 (588)
T ss_pred             EEHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             75243565640688899981577652389999868666689999712000367625766618886643532231999887


Q ss_pred             HCCCCEEEEEECHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCHHHHHHHCC-----CCCCCCEEEEEEEEECCCCCC
Q ss_conf             267988999709899999987665404778432366324554200444443113-----678852355433342167642
Q gi|254780684|r  247 SKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPS-----EKEKGNITAVISVLVDGDNHN  321 (438)
Q Consensus       247 ~~G~~Vll~~Ds~tr~a~A~reis~~~ge~P~~~gyp~~~~~~~~~l~ERag~~-----~~~~GSiT~~~~v~~~~dd~~  321 (438)
T Consensus       318 DmGy~v~lmADSTSRWAEAlREisgRleEmPgeegyPaYL~srlA~fYERaG~v~~~~~~~r~GsvtV~gaVSPpGGdfS  397 (588)
T COG1155         318 DMGYDVALMADSTSRWAEALREISGRLEEMPGEEGYPAYLGSRLAEFYERAGRVRLVSPEERFGSITVIGAVSPPGGDFS  397 (588)
T ss_pred             HHHHHHHHHHCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCEEEECCCCCCEEEEEEECCCCCCCCCCC
T ss_conf             63025677501389999999987335002886444416789999999985472342278862589998257789999847


Q ss_pred             CHHHHHHHHHCCCEEEEEHHHHHCCCCCCCCCCCCCCCCCHH-------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             027899986126089870427758971311445640002212-------0899999999999999999999999998523
Q gi|254780684|r  322 DPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADK-------AWSADEKKLVSSLTHLIHRFEETRDIRLIGG  394 (438)
Q Consensus       322 ~pi~~~~~~i~DG~i~L~r~la~~g~~Paid~~~S~SR~~~~-------~~~~~~~~~~~~~~~~l~~y~~~~~l~~~g~  394 (438)
T Consensus       398 EPVtq~Tlriv~vFw~Ld~~la~~rhfPaInwl~syS~Y~~~~~~~~~~~v~~~~~~~r~~a~~~Lq~e~elqeiv~lVG  477 (588)
T COG1155         398 EPVTQNTLRVVRVFWALDAALANRRHFPSINWLNSYSLYTEDLRSWYDENVSPEWGALRDQAMEILQRESELQEIVQLVG  477 (588)
T ss_pred             CCCCHHEEEEEEEECCCCHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             65211003556642001444532323765673777999898888776402582389999999999887799999999857


Q ss_pred             CCCCCCHHHHHHHHHHHHHHH-HHCCCCCCCCC-HHHHHHHHHHCC
Q ss_conf             446999899999999999999-83599888999-768999998709
Q gi|254780684|r  395 YRPGVDLILDKAVHQVPIIYD-FLKQSPSDLSS-EDVFQEITKKLQ  438 (438)
Q Consensus       395 y~~g~d~~~d~~i~~~~~i~~-fl~Q~~~e~~~-~~~~~~~~~~l~  438 (438)
T Consensus       478 ~ea-l~e~~~~il~va~~ire~fLqQnafd~vD~~~~~~kq~~mm~  522 (588)
T COG1155         478 YDA-LPEKEKSILDVARIIREDFLQQNAFDEIDAYCSLRKQYLMLK  522 (588)
T ss_pred             CCC-CCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHH
T ss_conf             423-662888999999999988876515673101388899999999