HHsearch alignment for GI: 254780684 and conserved domain: COG3840

>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism].
Probab=94.04  E-value=0.045  Score=34.12  Aligned_cols=33  Identities=30%  Similarity=0.384  Sum_probs=28.3

Q ss_pred             HHHHCCCCEEEEECCCCCCHHHHHHHHHHHCCC
Q ss_conf             002235850375266788999999998740789
Q gi|254780684|r  155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCF  187 (438)
Q Consensus       155 l~pig~GQR~gIfg~~GvGKt~Ll~~i~~~~~~  187 (438)
T Consensus        19 dl~v~~ge~vAi~GpSGaGKSTLLnLIAGF~~P   51 (231)
T COG3840          19 DLTVPAGEIVAILGPSGAGKSTLLNLIAGFETP   51 (231)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHHHHHCCCC
T ss_conf             876067857999778886578899998742477