HHsearch alignment for GI: 254780684 and conserved domain: COG4167

>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].
Probab=93.54  E-value=0.056  Score=33.41  Aligned_cols=30  Identities=37%  Similarity=0.478  Sum_probs=26.9

Q ss_pred             HHHHCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             002235850375266788999999998740
Q gi|254780684|r  155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARS  184 (438)
Q Consensus       155 l~pig~GQR~gIfg~~GvGKt~Ll~~i~~~  184 (438)
T Consensus        33 SFtL~~~QTlaiIG~NGSGKSTLakMlaGm   62 (267)
T COG4167          33 SFTLREGQTLAIIGENGSGKSTLAKMLAGM   62 (267)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHHHHCC
T ss_conf             789607967999826997475899998355