HHsearch alignment for GI: 254780684 and conserved domain: KOG1351

>KOG1351 consensus.
Probab=100.00  E-value=0  Score=571.39  Aligned_cols=429  Identities=21%  Similarity=0.334  Sum_probs=388.5

Q ss_pred             HHHHHHHHHCCCCEEEEEEEEEEECCEEEEECCCCCCCCCCEEEEECCC-CCEEEEEEEECCCEEEEEECCCCCCCCCC-
Q ss_conf             9999997413342120128999952589998268888735189995699-60799999741997999980485574678-
Q gi|254780684|r    7 TLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGKN-SDNLGQVIRINLDIVYICPVGIGEEISLG-   84 (438)
Q Consensus         7 ~l~~~~~~~~~~l~~~~G~V~~V~G~ii~v~Gl~~~v~iGelv~i~~~~-~~v~geVi~~~~~~~~l~~~~~~~gI~~G-   84 (438)
T Consensus         8 ~~~a~~~~~~~~prl~y~tv~gvngplvild~v-kfp~y~eiv~ltlpdgt~r~gqvlev~g~kavvqvfegtsgid~k~   86 (489)
T KOG1351           8 HATAVIENYTTEPRLTYRTVSGVNGPLVILDKV-KFPKYAEIVNLTLPDGSVRSGQVLEVSGEKAVVQVFEGTSGIDAKK   86 (489)
T ss_pred             HHHHHHHCCCCCCCEEEEEECCCCCCEEEEECC-CCCCHHHHEEEECCCCCEECCEEEEECCCEEEEEEECCCCCCCCCC
T ss_conf             788876324567742676531567756997525-6512043067766898711331799608735899950666655442


Q ss_pred             CEEEECCC-CEEECCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCE
Q ss_conf             88997288-55524666886543077630478877755530121125433300013311001112458752002235850
Q gi|254780684|r   85 DLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQR  163 (438)
Q Consensus        85 ~~V~~~g~-~~i~vG~~lLGRViD~lG~PlDg~~~l~~~~~~~~i~~~~p~p~~R~~i~e~L~TGIr~ID~l~pig~GQR  163 (438)
T Consensus        87 t~~eftg~~lr~pvsedmlgrifngsgkpid~gp~vl~ed-yldi~gqpinp~~riypeemiqtgis~idvmnsiargqk  165 (489)
T KOG1351          87 TTVEFTGEILRTPVSEDMLGRIFNGSGKPIDKGPPVLAED-YLDINGQPINPYARIYPEEMIQTGISAIDVMNSIARGQK  165 (489)
T ss_pred             CEEEEECCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCHHH-HHCCCCCCCCCCCCCCHHHHHHHCCHHHHHHHHHHCCCC
T ss_conf             2688743410365568776544268998268899757177-611479808940001869998727327765667742674


Q ss_pred             EEEECCCCCCHHHHHHHHHHHCC---------------CCCEEEEECCCCCHHHHHHHHHHHCCC-CCCEEEEEECCCCC
Q ss_conf             37526678899999999874078---------------983899312465223889999864277-55328984157788
Q gi|254780684|r  164 IGVFAGSGIGKSTLLSMFARSDC---------------FDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDES  227 (438)
Q Consensus       164 ~gIfg~~GvGKt~Ll~~i~~~~~---------------~dv~V~alIGeR~rev~efi~~~~~~~-l~~tvvv~~t~d~~  227 (438)
T Consensus       166 ipifsaaglphneiaaqicrqaglvk~~~k~~~d~~~dnfaivfaamgvnmetarffk~dfeengsm~~v~lflnlandp  245 (489)
T KOG1351         166 IPIFSAAGLPHNEIAAQICRQAGLVKRPEKDVHDGHEDNFAIVFAAMGVNMETARFFKQDFEENGSMERVCLFLNLANDP  245 (489)
T ss_pred             CCEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCEEEEEECCCCC
T ss_conf             53233378980589999988537111688664446676547760031565888899886687558700057787417897


Q ss_pred             HHHHHHHHHHHHHHHHHHHH-CCCCEEEEEECHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCHHHHHHHCCCCCCCC
Q ss_conf             03444444567778888642-67988999709899999987665404778432366324554200444443113678852
Q gi|254780684|r  228 PILRKMAPLTAVTIAEYFSS-KGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGN  306 (438)
Q Consensus       228 ~~~r~~a~~~a~~iAEyfr~-~G~~Vll~~Ds~tr~a~A~reis~~~ge~P~~~gyp~~~~~~~~~l~ERag~~~~~~GS  306 (438)
T Consensus       246 tieriitprlalt~aeflayq~ekhvlviltdmssya~alrevsaareevpgrrg~pgymytdlatiyeragrvegr~gs  325 (489)
T KOG1351         246 TIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLATIYERAGRVEGRNGS  325 (489)
T ss_pred             CHHHHCCHHHHHHHHHHHHHHHCCEEEEEEECCHHHHHHHHHHHHHHHHCCCCCCCCCEEHHHHHHHHHHHCCCCCCCCC
T ss_conf             44320240356668999987634738999833077899999977766427886788861002479999873333367885


Q ss_pred             EEEEEEEEECCCCCCCHHHHHHHHHCCCEEEEEHHHHHCCCCCCCCCCCCCCCCCHHCCC-----HHHHHHHHHHHHHHH
Q ss_conf             355433342167642027899986126089870427758971311445640002212089-----999999999999999
Q gi|254780684|r  307 ITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWS-----ADEKKLVSSLTHLIH  381 (438)
Q C