HHsearch alignment for GI: 254780684 and conserved domain: PRK00889

>PRK00889 adenylylsulfate kinase; Provisional.
Probab=91.75  E-value=1  Score=24.18  Aligned_cols=91  Identities=21%  Similarity=0.064  Sum_probs=58.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH-CCCCCEEEEECCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHH
Q ss_conf             35850375266788999999998740-78983899312465223889999864277553289841577880344444456
Q gi|254780684|r  159 CHGQRIGVFAGSGIGKSTLLSMFARS-DCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLT  237 (438)
Q Consensus       159 g~GQR~gIfg~~GvGKt~Ll~~i~~~-~~~dv~V~alIGeR~rev~efi~~~~~~~l~~tvvv~~t~d~~~~~r~~a~~~  237 (438)
T Consensus         2 ~kg~viWltGlsgSGKTTia~~l~~~L~~~~~~~~~LDG---D~lR~~l~~~--------------lgfs~~dR~~n~~r   64 (175)
T PRK00889          2 QRGVTVWFTGLSGAGKTTISHALAEKLRARGYPVEVLDG---DIVRTNLSKG--------------LGFSKEDRDTNIRR   64 (175)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECC---HHHHHHHCCC--------------CCCCHHHHHHHHHH
T ss_conf             988899988989999999999999999986996799776---8888753678--------------89898999999999


Q ss_pred             HHHHHHHHHHCCCCEEEEEECHHHHHHHH
Q ss_conf             77788886426798899970989999998
Q gi|254780684|r  238 AVTIAEYFSSKGDNVLLILDSITRFAHSI  266 (438)
Q Consensus       238 a~~iAEyfr~~G~~Vll~~Ds~tr~a~A~  266 (438)
T Consensus        65 ~~~la~~l~~~g~~vIvs~isp~~~~R~~   93 (175)
T PRK00889         65 IGFVAHLLTRHGVIVLVSAISPYRETREE   93 (175)
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCHHHHHH
T ss_conf             99999999818986888504799999999