HHsearch alignment for GI: 254780684 and conserved domain: PRK01889

>PRK01889 ribosome-associated GTPase; Reviewed.
Probab=92.38  E-value=0.13  Score=30.79  Aligned_cols=33  Identities=27%  Similarity=0.534  Sum_probs=25.3

Q ss_pred             HHHHHHHHCC-CCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             8752002235-85037526678899999999874
Q gi|254780684|r  151 VIDIFTPLCH-GQRIGVFAGSGIGKSTLLSMFAR  183 (438)
Q Consensus       151 ~ID~l~pig~-GQR~gIfg~~GvGKt~Ll~~i~~  183 (438)
T Consensus       183 gl~~L~~~l~~GkT~vl~G~SGVGKSTLiN~L~g  216 (353)
T PRK01889        183 GVDALQAWLKPGKTVALLGSSGVGKSTLVNALLG  216 (353)
T ss_pred             CHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHCC
T ss_conf             7899999863497899977888669999987565