HHsearch alignment for GI: 254780684 and conserved domain: PRK05748

>PRK05748 replicative DNA helicase; Provisional.
Probab=92.57  E-value=0.25  Score=28.63  Aligned_cols=42  Identities=31%  Similarity=0.363  Sum_probs=33.0

Q ss_pred             CHHHHHHHHHHHHH-HCCCCEEEEECCCCCCHHHHHHHHHHHC
Q ss_conf             01112458752002-2358503752667889999999987407
Q gi|254780684|r  144 GFKTGIRVIDIFTP-LCHGQRIGVFAGSGIGKSTLLSMFARSD  185 (438)
Q Consensus       144 ~L~TGIr~ID~l~p-ig~GQR~gIfg~~GvGKt~Ll~~i~~~~  185 (438)
T Consensus       185 Gi~TG~~~LD~~~~G~~~g~LiviaaRP~mGKTa~alnia~~~  227 (448)
T PRK05748        185 GIPTGFRDLDKMTSGLQPNDLIIVAARPSVGKTAFALNIAQNV  227 (448)
T ss_pred             EEECCHHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             1057827899982798867379998479987689999999999