HHsearch alignment for GI: 254780684 and conserved domain: PRK06749

>PRK06749 replicative DNA helicase; Provisional.
Probab=91.70  E-value=0.4  Score=27.18  Aligned_cols=42  Identities=21%  Similarity=0.271  Sum_probs=30.8

Q ss_pred             CCHHHHHHHHHHHHH-HCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             001112458752002-235850375266788999999998740
Q gi|254780684|r  143 KGFKTGIRVIDIFTP-LCHGQRIGVFAGSGIGKSTLLSMFARS  184 (438)
Q Consensus       143 e~L~TGIr~ID~l~p-ig~GQR~gIfg~~GvGKt~Ll~~i~~~  184 (438)
T Consensus       167 ~Gi~TGf~~LD~lt~Gl~~g~LiviaaRPsmGKTa~alnia~~  209 (428)
T PRK06749        167 TGIETGYTSLNKMTCGLQEGDFVVLGARPSMGKTAFALNVGLH  209 (428)
T ss_pred             CCCCCCHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             7687783889875249998868999627989768999999999