HHsearch alignment for GI: 254780684 and conserved domain: PRK07196

>PRK07196 fliI flagellum-specific ATP synthase; Validated.
Probab=100.00  E-value=0  Score=976.93  Aligned_cols=427  Identities=36%  Similarity=0.582  Sum_probs=401.4

Q ss_pred             HHHHHHHHHHHHCCCCEEEEEEEEEEECCEEEEECCCCCCCCCCEEEEECC-CCCEEEEEEEECCCEEEEEECCCCCCCC
Q ss_conf             699999999741334212012899995258999826888873518999569-9607999997419979999804855746
Q gi|254780684|r    4 NLETLAQLAEDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQGK-NSDNLGQVIRINLDIVYICPVGIGEEIS   82 (438)
Q Consensus         4 ~l~~l~~~~~~~~~~l~~~~G~V~~V~G~ii~v~Gl~~~v~iGelv~i~~~-~~~v~geVi~~~~~~~~l~~~~~~~gI~   82 (438)
T Consensus         1 ~l~~~~~~~~~~--~~~r~~GrV~~i~G~~ie~~g~~--~~iG~~c~I~~~~g~~v~aEVVgf~~~~~~L~p~~~~~Gi~   76 (434)
T PRK07196          1 ALDHALKSIENI--HLARVAGRLVRVTGLLLESVGCR--LAIGQRCRIESVDETFIEAQVVGFDRDITYLMPFKHPGGVL   76 (434)
T ss_pred             CHHHHHHHHHCC--CCCEEEEEEEEEECCEEEEECCC--CCCCCEEEEEECCCCEEEEEEEEECCCEEEEEECCCCCCCC
T ss_conf             958999997559--86248889999971089998069--89899899980899888999999819969999888877889


Q ss_pred             CCCEEEECCC-CEEECCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             7888997288-555246668865430776304788777555301211254333000133110011124587520022358
Q gi|254780684|r   83 LGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHG  161 (438)
Q Consensus        83 ~G~~V~~~g~-~~i~vG~~lLGRViD~lG~PlDg~~~l~~~~~~~~i~~~~p~p~~R~~i~e~L~TGIr~ID~l~pig~G  161 (438)
T Consensus        77 ~G~~V~~~g~~~~v~vg~~lLGRVvD~~G~PlDg~g~~~~-~~~~~~~~~~~nPl~R~~i~e~l~TGIraID~l~pigrG  155 (434)
T PRK07196         77 GGARVFPSEQDGELLIGDSWLGRVINGLGEPLDGKGQLGG-STPLQQQLPQIHPLQRRAVDTPLDVGVNAINGLLTIGKG  155 (434)
T ss_pred             CCCEEEECCCCCEEECCHHHCCCEECCCCCCCCCCCCCCC-CCEEECCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCC
T ss_conf             9999998899876776862247577678862689988888-846556689998301378887212686244155770245


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHC-CCCCCEEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             50375266788999999998740789838993124652238899998642-77553289841577880344444456777
Q gi|254780684|r  162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVT  240 (438)
Q Consensus       162 QR~gIfg~~GvGKt~Ll~~i~~~~~~dv~V~alIGeR~rev~efi~~~~~-~~l~~tvvv~~t~d~~~~~r~~a~~~a~~  240 (438)
T Consensus       156 QRigIfggsGvGKs~Ll~~I~r~~~advvVi~lIGeRgrEv~efi~~~~~~~~l~~svvv~atsd~~p~~r~~a~~~a~a  235 (434)
T PRK07196        156 QRVGLMAGSGVGKSVLLGMITRYTQADVVVVGLIGERGREVKEFIEHSLQAAGMAKSVVVAAPADESPLMRIKATELCHA  235 (434)
T ss_pred             CEEEECCCCCCCHHHHHHHHHHHHCCCEEEEEECCEEHHHHHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             24210147899789999999897379989997422234999999998742467432699984588987888899988998


Q ss_pred             HHHHHHHCCCCEEEEEECHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCHHHHHHHCCCCCCCCEEEEEEEEECCCCC
Q ss_conf             88886426798899970989999998766540477843236632455420044444311367885235543334216764
Q gi|254780684|r  241 IAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNH  320 (438)
Q Consensus       241 iAEyfr~~G~~Vll~~Ds~tr~a~A~reis~~~ge~P~~~gyp~~~~~~~~~l~ERag~~~~~~GSiT~~~~v~~~~dd~  320 (438)
T Consensus       236 iAEyfrd~G~~VLl~~Dsltr~A~A~REisl~~ge~P~~~gyp~svf~~l~~l~ERaG~~~-~~GSITa~~tv~~~~dD~  314 (434)
T PRK07196        236 IATYYRDKGHDVLLLVDSLTRYAMAQREIALSLGEPPATKGYPPSAFSIIPRLAESAGNSS-GNGTMTAIYTVLAEGDDQ  314 (434)
T ss_pred             HHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCC-CCEEEEEEEEEECCCCCC
T ss_conf             9999986798569995474688999999997568999867758438888589998521578-862488888886268887


Q ss_pred             CCHHHHHHHHHCCCEEEEEHHHHHCCCCCCCCCCCCCCCCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             20278999861260898704277589713114456400022120899999999999999999999999998523446999
Q gi|254780684|r  321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSS