HHsearch alignment for GI: 254780684 and conserved domain: PRK08472

>PRK08472 fliI flagellum-specific ATP synthase; Validated.
Probab=100.00  E-value=0  Score=967.85  Aligned_cols=427  Identities=39%  Similarity=0.627  Sum_probs=399.9

Q ss_pred             HHHHHHHH-HHHCCCCEEEEEEEEEEECCEEEEECCCCCCCCCCEEEEE--CCCCCEEEEEEEECCCEEEEEECCCCCCC
Q ss_conf             99999999-7413342120128999952589998268888735189995--69960799999741997999980485574
Q gi|254780684|r    5 LETLAQLA-EDYSKNLVVQGGYISSITSVYYTVTCLSQYVCLGDFVVHQ--GKNSDNLGQVIRINLDIVYICPVGIGEEI   81 (438)
Q Consensus         5 l~~l~~~~-~~~~~~l~~~~G~V~~V~G~ii~v~Gl~~~v~iGelv~i~--~~~~~v~geVi~~~~~~~~l~~~~~~~gI   81 (438)
T Consensus         3 ~~~~~~~~~~~~~~--s~~yG~V~~V~G~li~v~G~~--~~iGe~~~I~~~~~g~~~~geVvg~~~~~v~l~~~~~~~Gi   78 (435)
T PRK08472          3 LESLKNKLNQHFSL--SPRFGSITKISANIIEARGLK--PSVGDIVKIVEENDGKECLGMVVVIEKEQFGISPFSFIEGF   78 (435)
T ss_pred             HHHHHHHHHHCCCC--CCCCCEEEEEECEEEEEEECC--CCCCCEEEEEECCCCCEEEEEEEEEECCEEEEEECCCCCCC
T ss_conf             68999998735676--677868999957399999458--87678799997699967789999885998999983688789


Q ss_pred             CCCCEEEECCC-CEEECCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             67888997288-55524666886543077630478877755530121125433300013311001112458752002235
Q gi|254780684|r   82 SLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCH  160 (438)
Q Consensus        82 ~~G~~V~~~g~-~~i~vG~~lLGRViD~lG~PlDg~~~l~~~~~~~~i~~~~p~p~~R~~i~e~L~TGIr~ID~l~pig~  160 (438)
T Consensus        79 ~~G~~V~~tg~~~~vpvg~~lLGRVvD~lG~PlDg~g~i~~~-~~~pi~~~~~~p~~R~~i~epl~TGIraID~l~pigr  157 (435)
T PRK08472         79 KIGDKVFISDEGLNIPVGRNLLGRVVDPLGRPIDGKGAIDYT-EYAPIMRAPIAAMKRGLIDEVFSVGVKSIDGLLTCGK  157 (435)
T ss_pred             CCCCEEEECCCCCEEECCCCCCCCEECCCCCCCCCCCCCCCC-CEEECCCCCCCHHHHCCCCCCCCCCCEEEECCCCCCC
T ss_conf             999999989997378758340278877788645899998876-2301147898804516888741158557743266247


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             85037526678899999999874078983899312465223889999864277553289841577880344444456777
Q gi|254780684|r  161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVT  240 (438)
Q Consensus       161 GQR~gIfg~~GvGKt~Ll~~i~~~~~~dv~V~alIGeR~rev~efi~~~~~~~l~~tvvv~~t~d~~~~~r~~a~~~a~~  240 (438)
T Consensus       158 GQR~gIf~g~GvGKt~Ll~~i~~~~~~dv~V~~lIGeR~rEv~efie~~~~~~l~~tvvvvatsd~p~~~r~~a~~~a~a  237 (435)
T PRK08472        158 GQKLGIFAGSGVGKSTLMGMIVKGCLAPIKVVALIGERGREIPEFIEKNLGGDLSNTVIVVATSDDSPLMRKYGAFCAMS  237 (435)
T ss_pred             CCEEECCCCCCCCCCHHHHHHHHHHCCCEEEEEEECEEHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             76651235899983357888877615998899761312278999999874113222599984688998999888889999


Q ss_pred             HHHHHHHCCCCEEEEEECHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCHHHHHHHCCCCCCCCEEEEEEEEECCCCC
Q ss_conf             88886426798899970989999998766540477843236632455420044444311367885235543334216764
Q gi|254780684|r  241 IAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNH  320 (438)
Q Consensus       241 iAEyfr~~G~~Vll~~Ds~tr~a~A~reis~~~ge~P~~~gyp~~~~~~~~~l~ERag~~~~~~GSiT~~~~v~~~~dd~  320 (438)
T Consensus       238 iAEyfrd~G~~VLl~~Dsltr~A~A~REisl~~ge~P~~~gYp~~vf~~l~~l~ERag~~~-~~GSIT~i~~v~~~gdD~  316 (435)
T PRK08472        238 VAEYFKNQGLDVLFIMDSVTRFAMAQREIGLALGEPPTSKGYPPSVLSLLPQLMERAGKEE-GKGSITAFFTVLVEGDDM  316 (435)
T ss_pred             HHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHCCCC-CCCCEEEEEEEEECCCCC
T ss_conf             9999986798489984362788999999998658999755638357766578888642588-985148887785048876


Q ss_pred             CCHHHHHHHHHCCCEEEEEHHHHHCCCCCCCCCCCCCCCCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             20278999861260898704277589713114456400022120899999999999999999999999998523446999
Q gi|254780684|r  321 NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSS