HHsearch alignment for GI: 254780684 and conserved domain: PRK08533

>PRK08533 flagellar accessory protein FlaH; Reviewed.
Probab=97.13  E-value=0.014  Score=37.72  Aligned_cols=156  Identities=15%  Similarity=0.122  Sum_probs=84.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH--CCCCCEEEEECCCCCHHHHHHHHHHHCCC------C-CCEEEEEEC----CC
Q ss_conf             35850375266788999999998740--78983899312465223889999864277------5-532898415----77
Q gi|254780684|r  159 CHGQRIGVFAGSGIGKSTLLSMFARS--DCFDKVIISLVGERGREVREFIEDYLGDN------L-KKSVVVVAT----SD  225 (438)
Q Consensus       159 g~GQR~gIfg~~GvGKt~Ll~~i~~~--~~~dv~V~alIGeR~rev~efi~~~~~~~------l-~~tvvv~~t----~d  225 (438)
T Consensus        22 p~gs~~li~G~~GtGKsi~~~~~~~~~l~~g~~~~yis~e~t~---~~~i~qm~s~g~di~~~~~~G~l~~i~~~~~~~~   98 (230)
T PRK08533         22 PFGSIILIEGDESTGKSILSQRLAYGFLQNGYSVSYVSSQLTT---TEFIKQMMSLGYDINKKLISGKLLYIPVYPLLSG   98 (230)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCH---HHHHHHHHHCCCCCHHHHHCCCEEEEECCCCCCC
T ss_conf             8984899986899878999999999998789869999943899---9999999986998179975796799961343354


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCHHHHHHHCCCCCCC
Q ss_conf             88034444445677788886426798899970989999998766540477843236632455420044444311367885
Q gi|254780684|r  226 ESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKG  305 (438)
Q Consensus       226 ~~~~~r~~a~~~a~~iAEyfr~~G~~Vll~~Ds~tr~a~A~reis~~~ge~P~~~gyp~~~~~~~~~l~ERag~~~~~~G  305 (438)
T Consensus        99 ~~~~~----~~L~-~ll~~~~~~~~dv-IIIDSlS~l~~~~--------------~~~~~~~~~~~-~lk~l~---s~gk  154 (230)
T PRK08533         99 NSEKR----DFLD-KLMNTRRFYEKDV-VIIDSLSSLVSRD--------------ASEVQIRDLMA-FFKRIS---SLNK  154 (230)
T ss_pred             HHHHH----HHHH-HHHHHHHHCCCCE-EEEECCHHHHHCC--------------CCHHHHHHHHH-HHHHHH---HCCC
T ss_conf             04578----9999-9973266437989-9990531885167--------------77899999999-999998---5898


Q ss_pred             CEEEEEEEEECCCCCCCHHHHHHHHHCCCEEEEEHHHHHC
Q ss_conf             2355433342167642027899986126089870427758
Q gi|254780684|r  306 NITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEE  345 (438)
Q Consensus       306 SiT~~~~v~~~~dd~~~pi~~~~~~i~DG~i~L~r~la~~  345 (438)
T Consensus       155 --tIilTv--~p~~~~e~~l~~lrs~aDv~i~L~~~~vGg  190 (230)
T PRK08533        155 --VIILTA--NPKELPESVLLILRTASTILIRLEVKVFGG  190 (230)
T ss_pred             --EEEEEE--CCCCCCHHHHHHHHEEEEEEEEEEEEECCC
T ss_conf             --899995--633136245442041048999987361098