HHsearch alignment for GI: 254780684 and conserved domain: PRK09302

>PRK09302 circadian clock protein KaiC; Reviewed.
Probab=98.29  E-value=1.5e-05  Score=59.49  Aligned_cols=195  Identities=16%  Similarity=0.183  Sum_probs=116.5

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHH--HCCCCEEEEECCCCCCHHHHHHHHHHH--CCCCCEEEEECCCCCHHHHHHHHHH--
Q ss_conf             0013311001112458752002--235850375266788999999998740--7898389931246522388999986--
Q gi|254780684|r  136 MNRQRVEKGFKTGIRVIDIFTP--LCHGQRIGVFAGSGIGKSTLLSMFARS--DCFDKVIISLVGERGREVREFIEDY--  209 (438)
Q Consensus       136 ~~R~~i~e~L~TGIr~ID~l~p--ig~GQR~gIfg~~GvGKt~Ll~~i~~~--~~~dv~V~alIGeR~rev~efi~~~--  209 (438)
T Consensus       239 ~~~~~~~~rv~tGi~~LD~llgGGl~~GsstLi~Gp~GtGKTtla~qFl~~~a~~GE~~l~~~FeE~~~~l~~~a~~~G~  318 (501)
T PRK09302        239 LTQRSSNERISSGVPDLDEMCGGGFFRGSIILVSGATGTGKTLLVSKFAEAACRRGERCLLFAFEESRAQLVRNATSWGI  318 (501)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHHCCC
T ss_conf             35666520004797327887259975894699988999888999999999998659908999996799999999997399


Q ss_pred             -HCCCCCC-EEEEE-E-CCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHHHHHHCCCCCCCCCCCHH
Q ss_conf             -4277553-28984-1-577880344444456777888864267988999709899999987665404778432366324
Q gi|254780684|r  210 -LGDNLKK-SVVVV-A-TSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTS  285 (438)
Q Consensus       210 -~~~~l~~-tvvv~-~-t~d~~~~~r~~a~~~a~~iAEyfr~~G~~Vll~~Ds~tr~a~A~reis~~~ge~P~~~gyp~~  285 (438)
T Consensus       319 dl~~~~~~G~l~i~~~~p~~~~~~e~------~~~i~~~v~~~~~~-rVvIDsls~~~~~~~~~~-----------~r~~  380 (501)
T PRK09302        319 DLEEMERKGLLKIICARPESTGLEDH------LQIIKREIEEFKPS-RVAVDPLSALARGGSLNE-----------FRQF  380 (501)
T ss_pred             CHHHHHHCCCEEEEEECCCCCCHHHH------HHHHHHHHHHCCCC-EEEECCHHHHHHHCCHHH-----------HHHH
T ss_conf             84888748947999837000598999------99999999972998-999958068765268599-----------9999


Q ss_pred             HHHHCCHHHHHHHCCCCCCCCEEEEEEEEECCCCC-CCHHHHHHHHHCCCEEEEEHHHHHCCCCCCCCCCCCC
Q ss_conf             55420044444311367885235543334216764-2027899986126089870427758971311445640
Q gi|254780684|r  286 VFSELPRLLERIGPSEKEKGNITAVISVLVDGDNH-NDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASV  357 (438)
Q Consensus       286 ~~~~~~~l~ERag~~~~~~GSiT~~~~v~~~~dd~-~~pi~~~~~~i~DG~i~L~r~la~~g~~Paid~~~S~  357 (438)
T Consensus       381 l~-~L~~~L------k~~--gvT~l~t~~~~~~~g~~~~t~~~iS~l~D~ii~Lry~E~~g~l~R~i~VlK~R  444 (501)
T PRK09302        381 VI-RLTDYL------KQE--EITGLFTNLTPDFMGSHSITESHISSLTDTWILLQYVEINGEMNRALNVLKMR  444 (501)
T ss_pred             HH-HHHHHH------HHC--CCEEEEEEECCCCCCCCCCCCCCHHHHCCEEEEEEEEEECCEEEEEEEEEEEC
T ss_conf             99-999999------768--97899976123556766447666001112478999871389998989999936