HHsearch alignment for GI: 254780684 and conserved domain: PRK09580

>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed.
Probab=94.60  E-value=0.027  Score=35.68  Aligned_cols=30  Identities=27%  Similarity=0.308  Sum_probs=26.9

Q ss_pred             HHHHCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             002235850375266788999999998740
Q gi|254780684|r  155 FTPLCHGQRIGVFAGSGIGKSTLLSMFARS  184 (438)
Q Consensus       155 l~pig~GQR~gIfg~~GvGKt~Ll~~i~~~  184 (438)
T Consensus        21 sl~i~~Gei~~iiG~nGaGKSTLl~~i~G~   50 (248)
T PRK09580         21 NLEVRPGEVHAIMGPNGSGKSTLSATLAGR   50 (248)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHHHHHCC
T ss_conf             889849979999999999999999998377