HHsearch alignment for GI: 254780684 and conserved domain: PRK09984

>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional.
Probab=94.91  E-value=0.019  Score=36.77  Aligned_cols=32  Identities=31%  Similarity=0.428  Sum_probs=28.2

Q ss_pred             HHHHHCCCCEEEEECCCCCCHHHHHHHHHHHC
Q ss_conf             20022358503752667889999999987407
Q gi|254780684|r  154 IFTPLCHGQRIGVFAGSGIGKSTLLSMFARSD  185 (438)
Q Consensus       154 ~l~pig~GQR~gIfg~~GvGKt~Ll~~i~~~~  185 (438)
T Consensus        23 isl~i~~GE~~~iiGpNGaGKSTLlk~i~Gll   54 (262)
T PRK09984         23 VDLNIHHGEMVALLGPSGSGKSTLLRHLSGLI   54 (262)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             27898799899999899960999999997567