HHsearch alignment for GI: 254780684 and conserved domain: PRK10261

>PRK10261 glutathione transporter ATP-binding protein; Provisional.
Probab=92.67  E-value=0.17  Score=29.83  Aligned_cols=31  Identities=26%  Similarity=0.236  Sum_probs=13.0

Q ss_pred             HHHHHHHHHC--CCCCCCCCCCHHHHHHCCHHH
Q ss_conf             9987665404--778432366324554200444
Q gi|254780684|r  264 HSIREIATNS--GELPVARGYPTSVFSELPRLL  294 (438)
Q Consensus       264 ~A~reis~~~--ge~P~~~gyp~~~~~~~~~l~  294 (438)
T Consensus       338 ~av~~vsf~i~~GE~l~lvG~sGsGKSTl~r~l  370 (623)
T PRK10261        338 HAVEKVSFDLWPGETLSLVGESGSGKSTTGRAL  370 (623)
T ss_pred             EEEECCCCCCCCCCEEEEECCCCCCHHHHHHHH
T ss_conf             665234003589958999767876689999998