HHsearch alignment for GI: 254780684 and conserved domain: PRK10418

>PRK10418 nikD nickel transporter ATP-binding protein; Provisional.
Probab=93.52  E-value=0.05  Score=33.75  Aligned_cols=33  Identities=24%  Similarity=0.252  Sum_probs=27.7

Q ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHC
Q ss_conf             520022358503752667889999999987407
Q gi|254780684|r  153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSD  185 (438)
Q Consensus       153 D~l~pig~GQR~gIfg~~GvGKt~Ll~~i~~~~  185 (438)
T Consensus        21 ~Isl~v~~Ge~~aiiG~SGsGKStl~k~llgll   53 (254)
T PRK10418         21 GVSLTLQRGRVLALVGGSGSGKSLTCAAALGIL   53 (254)
T ss_pred             CEEEEECCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             607289899999999999878999999995799